3USQA

Structure of d159s/y194f glycogenin mutant truncated at residue 270
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
266
structure length
256
Chain Sequence
MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTSRRLAVLTTPQVSDTMRKALEIVFDEVITVDILDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFEREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHVASEQGSFSGGDQGLLNTFFNSWATTDIRKHLPFIYNLSSISIFSYLPAFKAFGANAKVVHFLGQTKPWNYTYDTKTKSVRPQFLNVWWDIFTTSVVPLLQQFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycogenin-1
publication title Mechanisms of monomeric and dimeric glycogenin autoglucosylation.
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 84
structure length 256
sequence length 266
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3usqA00
1FXJA 4M2BA 3SX5A 1YROB 1HV9A 1JYKA 1HM8A 5C36A 5FUHA 3F1YA 2JCLA 2XWNA 2UX8A 1GQ9A 1R7VA 1XZ6A 3IOIA 4MYBA 4P02A 2Y6PA 4KT7A 1H7HA 3IOJA 3DK5A 3Q7UA 3DJ4A 5AJPA 2RIXA 2RJ4A 1FWYA 2VXLA 3SXDA 4FRBA 2VXMA 1FXOA 1JV1A 2V0JA 4KPXA 3U2UA 1HJJA 1H7LA 2WVKA 1O7QA 1R80A 2JCJA 1FG5N 5C3BA 1FZWA 2PGVA 3FOQA 4M28A 2P72A 3LW6A 5FYEA 1O0RA 2ICYA 5DDTA 4G3SA 2FFUA 3HL3A 4FREA 2E8BA 2RJ6A 2FYDB 5C1LA 2FYCB 2AESA 4G3QA 4DDZA 4NANA 5FV9A 1MC3A 1NF5B 3I0JA 2I7BA 2X60A 4GBPA 4FRLA 1W55A 1TZFA 4KC1A 2GGOA 3EE5A 1WT2A 3GUEA 4KNXA 1R7UA 2V0KA 4AYLA 2RIZA 3O3PA 1H7EA 4AAWA 2X5ZA 3U2TA 1R7XA 1FR9A 2O1HA 3SX3A 1QGQA 1GX4A 2VSIA 3E25A 5C47A 1GA8A 2XWMA 2I5KA 3SXCA 4KRVA 1TW1A 1VGUA 3RSBA 4DE7A 5JQQA 4NAIA 3V0MA 1INIA 2I5EA 4D0ZA 2YC5A 2WAWA 2FYBA 2OEFA 2AE7A 1JVGA 4M2AA 3K8DA 1VZXA 1G1LA 1R7YA 2XWLA 3E26A 4B3UA 4HO4A 1G95A 4BMAA 1H5SB 4HO5A 1H7QA 3NGWA 3FWWA 3OAMA 3I0HA 1LL0A 1WT0A 2BO4A 2X65A 3D5NA 5AJNA 3U0XA 3SXAA 4DECA 1OQMB 2CU2A 2NXVA 1HM0A 5AJOA 1GQCA 1NHEB 1H5RA 1WT1A 3BCVA 2PX7A 2V0HA 4J18A 1H4CA 2AM3A 3USQA 1H3MA 1NQIB 3D98A 1G8OA 1TW5A 3R2WA 2RITA 3PKQA 3CKJA 4HG6A 3ZGGA 5DDVA 2AM4A 3OKRA 3ZLKA 2ICXA 1O7OA 3CKQA 3V0NA 5J49A 3I0CA 1YP4A 4ZDQA 5IFYA 3DUVA 3KIAA 2VS5A 5CQNX 3SXBA 1H4EA 1HJLA 1VH1A 2PGYA 2FFVA 4D48A 3I0FA 2ZU8A 4LW6A 3JUKA 5EJZA 2P73A 4AYJA 1H4DA 4EEGA 5L6SA 3ZF8A 4Y62A 3OH4A 2OI5A 4B4BA 4CJ8A 2AGDA 3V90A 1NMMB 4HO6A 1H5SD 4CVHA 3SPTA 2GGQA 1H7FA 1YP3A 3POLA 4IRQA 4B2XA 5C8RA 1JVDA 3OH2A 4G3PA 5FTVA 2V0IA 5C1HA 1S4NA 2ZU7A 3TQDA 2YESA 3OH3A 1JYLA 3PNNA 3U2VA 5CQOA 2P6WA 5EJ1A 5C4EA 2VS4A 1FRWA 4EE5A 5C4CA 5C48A 4MNDA 3CU0A 4P00A 4B4GA 3OH0A 4EEMA 1G9RA 2D7IA 3T7OA 1QWJA 5C4DA 2APCA 4B2WA 1WSZA 1H5SC 4FRMA 1S4PA 5C3DA 5CQPA 1ZHJA 1I52A 4Y7TA 1WVCA 1G3LA 4D0TA 1GWWA 4HO9A 4G87A 1H7TA 3ST8A 3Q4SA 2A8WA 1OMXA 5C38A 3I0EA 3U0YA 1NWGB 4IRPA 2ZU9A 2OEGA 4FRDA 4D11C 3R3IA 2VFZA 3CGXA 1VZTA 2WE9A 1H5TB 4HO8A 4KC2A 4E1KA 1E5KA 1ZJ3A 3V0OA 5FU0A 4UEGA 1ZCVA 3I0IX 2X5SA 1ZI3A 1Z90A 4YS8A 2JCOA 2BO6A 2AECA 2VSHA 4HO3A 5CMHA 5CMIA 3CKNA 5CMGX 3N9WA 2YQCA 1LZ0A 2Y4JA 1ON8A 1ZJOA 4EEOA 1OMZA 1JV3A 1ZCUA 2OI7A 4HCQA 2QGIA 5C4FA 1G0RA 1H5SA 3Q80A 1ZI4A 1V83A 1VGTA 1H7GA 3V8YA 5IDSA 1QG8A 5C4BA 4HO0A 3V0LA 3V0QA 3ZGFA 2BO7A 4FRQA 2RJ7A 2RJ1A 3RMVA 4D11A 4L41C 4LW3A 1FO8A 1LL2A 1INJA 1V84A 4Y9XA 5CQMX 1SS9A 2AH9A 4B4MA 2QKXA 1LZJA 4EVWA 1FO9A 2Y4KA 3V0PA 3V91A 2RJ8A 4JISA 2RIYA 1G2VA 4ARWA 1ZDGA 1ZJ1A 2WVLA 1EYRA 1HM9A 4NAKA 1LVWA 1W57A 2JCKA 4HO2A 2WEEA 3QVBA 1ZJPA 1XHBA 5CMFX 1GX0A 1VH3A 4KPZA 2BO8A 4FRPA 4Y7VA 1G93A 1ZDFA 2YC3A 2D7RA 4FROA 1TVYA 1G23A 1IINA 4B5BA 1LZIA 4Y7UA 5IDTA 1O23B 4Y7FA 2E3DA 2W0WA 5FU8A 4KC4A 2Z86A 1G97A 2RJ0A 2VS3A 4Y6NA 1VGWA 3SXGA 5L6VA 3IOHA 1ZI5A 4KNRA 1S4OA 1MP4A 4EE4A 1FR8A 3I0KA 1VZUA 1VICA 4K6RA 2AM5A 3SX7A 2XMEA 2RJ5A 1PZTA 5I1FA 3SX8A 4FRHA 4ASJA 4CJCA 2DPWA 5C1GA 3K8EA 3TZTA 5C3AA 2YCMA 2FYAA 2W0VA 1V82A 1EZIA 1ZJ0A 3CKOA 3V8ZA 1K4VA 1PZYB 3U2WA 4XWIA 4KXOA 4Y64A 4FCUA 1ZCTA 3BRKX 3D8VA 2MZBA 2XMHA 4R7PA 2VD4A 1MP3A 4FCEA 1FGGA 1GWVA 1ZJ2A 3I0GA 3T7MA 3RMWA 4C2SA 2D0JA 2A8UA 2RJ9A 3ZLLA 1VM8A 4Y6UA 1ZCYA 3USRA 2Y4MA 5HS2A 3I0LA 4ASYA 1H5TA 4EE3A 5CQLX 4B42A 4ECMA 1ZIZA 3U2XA 5CMJA 3T7NA 1KWSA 2YQSA 1R82A 5EIYA 4KQLA 4JD0A 4FRAA 1LL3A 1VPAA 1FOAA 1ON6A 4AC3A 3OGZA 3CKVA 1WT3A 1H5RB 4HOCA 5C49A 1NKHB 4M4KA 3JUJA 3SXEA 3F1CA 2V0LA 4NALA 1MP5A 2Z87A 2Q4JA 2YQJA 4EEAA 1ZI1A 1R81A 4FQWA 5FTSA 1VGZA 4Y63A 4CJBA 1QGSA 3PKPA 1IIMA 2O1FA 3OC9A 2WGZA 1FGXA 1R7TA 3I0DA 3OH1A 5BXCA 2FY7A 2PA4A 2QH5A 2Y7AA 3JTJA 2YQHA 2O1GA 2WVMA 1LZ7A 2OI6A 1W77A 4Y7GA 4BQHA 1YP2A 2Y4LA
chains in the Genus database with same CATH superfamily
1FXJA 4M2BA 3SX5A 1YROB 1HV9A 1JYKA 1HM8A 5C36A 5FUHA 3F1YA 2JCLA 2XWNA 2UX8A 1GQ9A 1R7VA 1XZ6A 3IOIA 4MYBA 4P02A 2Y6PA 4KT7A 1H7HA 3IOJA 3DK5A 4MIXA 3Q7UA 3DJ4A 5AJPA 2RIXA 2RJ4A 1FWYA 2VXLA 3SXDA 4FRBA 2VXMA 1FXOA 1JV1A 2V0JA 4KPXA 3U2UA 1HJJA 1H7LA 2WVKA 1O7QA 1R80A 2JCJA 1FG5N 5C3BA 1FZWA 2PGVA 3FOQA 4M28A 2P72A 3LW6A 5FYEA 1O0RA 2ICYA 5DDTA 4G3SA 2FFUA 3HL3A 4FREA 2E8BA 2RJ6A 2FYDB 5C1LA 2FYCB 2AESA 4G3QA 4DDZA 4NANA 5FV9A 1MC3A 1NF5B 3I0JA 2I7BA 2X60A 4GBPA 4FRLA 1W55A 1TZFA 4KC1A 2GGOA 3EE5A 1WT2A 3GUEA 4KNXA 1R7UA 2V0KA 4AYLA 2RIZA 3O3PA 1H7EA 4AAWA 2X5ZA 3U2TA 1R7XA 1FR9A 2O1HA 3SX3A 1QGQA 1GX4A 2VSIA 3E25A 5C47A 1GA8A 4O6NA 2XWMA 2I5KA 3SXCA 4KRVA 1TW1A 1VGUA 3RSBA 4DE7A 5JQQA 4NAIA 3V0MA 1INIA 2I5EA 4D0ZA 2YC5A 2WAWA 2FYBA 2OEFA 2AE7A 1JVGA 4M2AA 3K8DA 1VZXA 1G1LA 1R7YA 2XWLA 3E26A 4B3UA 4HO4A 1G95A 4BMAA 1H5SB 4HO5A 1H7QA 3NGWA 3FWWA 3OAMA 3I0HA 1LL0A 1WT0A 2BO4A 2X65A 3D5NA 5AJNA 3U0XA 3SXAA 4DECA 1OQMB 2CU2A 2NXVA 1HM0A 5AJOA 1GQCA 1NHEB 1H5RA 1WT1A 3BCVA 2PX7A 2V0HA 4J18A 1H4CA 2AM3A 3USQA 1H3MA 1NQIB 3D98A 1G8OA 1TW5A 3R2WA 2RITA 3PKQA 2J0BA 3CKJA 4HG6A 3ZGGA 5DDVA 2AM4A 3OKRA 3ZLKA 2ICXA 1O7OA 3CKQA 3V0NA 5J49A 3I0CA 1YP4A 4ZDQA 5IFYA 3DUVA 3KIAA 2VS5A 5CQNX 3SXBA 1H4EA 1HJLA 1VH1A 2PGYA 2FFVA 4D48A 3I0FA 2ZU8A 4LW6A 3JUKA 5EJZA 2P73A 4AYJA 1H4DA 4EEGA 5L6SA 3ZF8A 4Y62A 3OH4A 2OI5A 4B4BA 4CJ8A 2AGDA 3V90A 1NMMB 4HO6A 1H5SD 4CVHA 3SPTA 2GGQA 1H7FA 1YP3A 3POLA 4IRQA 4B2XA 5C8RA 1JVDA 3OH2A 4G3PA 5FTVA 2V0IA 5C1HA 1S4NA 2ZU7A 3TQDA 2YESA 3OH3A 1JYLA 3PNNA 3U2VA 5CQOA 2P6WA 5EJ1A 5C4EA 2VS4A 1FRWA 4EE5A 5C4CA 5C48A 4MNDA 3CU0A 4P00A 4B4GA 3OH0A 4EEMA 1G9RA 2D7IA 4Q7CA 1QWJA 3T7OA 5C4DA 2APCA 4B2WA 1WSZA 1H5SC 4FRMA 1S4PA 5C3DA 5CQPA 1ZHJA 1I52A 4Y7TA 1WVCA 1G3LA 4FIYA 4D0TA 1GWWA 4HO9A 4G87A 1H7TA 3ST8A 3Q4SA 2A8WA 1OMXA 5C38A 3I0EA 3U0YA 1NWGB 4IRPA 2ZU9A 2OEGA 4FRDA 4D11C 3R3IA 2VFZA 3CGXA 1VZTA 2WE9A 1H5TB 4HO8A 4KC2A 4E1KA 1E5KA 1ZJ3A 3V0OA 5FU0A 4UEGA 1ZCVA 4O6MA 3I0IX 2X5SA 1ZI3A 1Z90A 4YS8A 2JCOA 2BO6A 2AECA 2VSHA 4HO3A 5CMHA 5CMIA 3CKNA 5CMGX 3N9WA 2YQCA 1LZ0A 2Y4JA 1ON8A 1ZJOA 4EEOA 1OMZA 1JV3A 1ZCUA 2OI7A 4HCQA 2QGIA 5C4FA 1G0RA 1H5SA 3Q80A 1ZI4A 1V83A 1VGTA 1H7GA 3V8YA 5IDSA 1QG8A 5C4BA 4HO0A 3V0LA 3V0QA 3ZGFA 2BO7A 4FRQA 2RJ7A 2RJ1A 3RMVA 4D11A 4L41C 4LW3A 1FO8A 1LL2A 1INJA 1V84A 4Y9XA 5CQMX 1SS9A 2AH9A 4B4MA 2QKXA 1LZJA 4EVWA 1FO9A 2Y4KA 3V0PA 3V91A 2RJ8A 4JISA 2RIYA 1G2VA 4ARWA 1ZDGA 1ZJ1A 2WVLA 1EYRA 1HM9A 4NAKA 1LVWA 1W57A 2JCKA 4HO2A 2WEEA 3QVBA 1ZJPA 1XHBA 5CMFX 1GX0A 1VH3A 4KPZA 2BO8A 4FRPA 4Y7VA 1G93A 1ZDFA 2YC3A 2D7RA 4FROA 1TVYA 1G23A 1IINA 2J0AA 4B5BA 1LZIA 4Y7UA 5IDTA 1O23B 4Y7FA 2E3DA 2W0WA 5FU8A 4KC4A 2Z86A 1G97A 2RJ0A 2VS3A 4Y6NA 1VGWA 3SXGA 5L6VA 3IOHA 1ZI5A 4KNRA 1S4OA 1MP4A 4EE4A 1FR8A 3I0KA 1VZUA 1VICA 4K6RA 2AM5A 3SX7A 2XMEA 2RJ5A 1PZTA 5I1FA 3SX8A 4FRHA 4ASJA 4CJCA 2DPWA 5C1GA 3K8EA 3TZTA 5C3AA 2YCMA 2FYAA 2W0VA 1V82A 1EZIA 1ZJ0A 3CKOA 3V8ZA 1K4VA 1PZYB 3U2WA 4XWIA 4KXOA 4Y64A 4FCUA 1ZCTA 3BRKX 3D8VA 4FIXA 2MZBA 2XMHA 2C0NA 4R7PA 2VD4A 1MP3A 4FCEA 1FGGA 1GWVA 1ZJ2A 3I0GA 3T7MA 2VK9A 3RMWA 4C2SA 2D0JA 2A8UA 2RJ9A 3ZLLA 1VM8A 4Y6UA 1ZCYA 3USRA 2Y4MA 5HS2A 3I0LA 4ASYA 1H5TA 4EE3A 5CQLX 4B42A 4ECMA 1ZIZA 3U2XA 5CMJA 3T7NA 1KWSA 2YQSA 1R82A 5EIYA 4KQLA 4JD0A 4FRAA 1LL3A 1VPAA 1FOAA 1ON6A 4AC3A 3OGZA 3CKVA 5D92A 1WT3A 1H5RB 4HOCA 5C49A 1NKHB 4M4KA 3JUJA 3SXEA 3F1CA 2V0LA 4NALA 1MP5A 2Z87A 2Q4JA 2YQJA 4EEAA 1ZI1A 1R81A 4FQWA 5FTSA 1VGZA 4Y63A 4CJBA 5D91A 1QGSA 3PKPA 1IIMA 2O1FA 3OC9A 2WGZA 1FGXA 1R7TA 3I0DA 3OH1A 5BXCA 2FY7A 2PA4A 2QH5A 2Y7AA 3JTJA 2YQHA 2O1GA 2WVMA 1LZ7A 2OI6A 1W77A 4Y7GA 4BQHA 1YP2A 2Y4LA
chains in the Genus database with same CATH topology
1FXJA 4M2BA 3SX5A 1YROB 1HV9A 1JYKA 1HM8A 5C36A 5FUHA 3F1YA 2JCLA 2XWNA 2UX8A 1GQ9A 1R7VA 1XZ6A 3IOIA 4MYBA 4P02A 2Y6PA 4KT7A 1H7HA 3IOJA 3DK5A 4MIXA 3Q7UA 3DJ4A 5AJPA 2RIXA 2RJ4A 1FWYA 2VXLA 3SXDA 4FRBA 2VXMA 1FXOA 1JV1A 2V0JA 4KPXA 3U2UA 1HJJA 1H7LA 2WVKA 1O7QA 1R80A 2JCJA 1FG5N 5C3BA 1FZWA 2PGVA 3FOQA 4M28A 2P72A 3LW6A 5FYEA 1O0RA 2ICYA 5DDTA 4G3SA 2FFUA 3HL3A 4FREA 2E8BA 2RJ6A 2FYDB 5C1LA 2FYCB 2AESA 4G3QA 4DDZA 4NANA 5FV9A 1MC3A 1NF5B 3I0JA 2I7BA 2X60A 4GBPA 4FRLA 1W55A 1TZFA 4KC1A 2GGOA 3EE5A 1WT2A 3GUEA 4KNXA 1R7UA 2V0KA 4AYLA 2RIZA 3O3PA 1H7EA 4AAWA 2X5ZA 3U2TA 1R7XA 1FR9A 2O1HA 3SX3A 1QGQA 1GX4A 2VSIA 3E25A 5C47A 1GA8A 4O6NA 2XWMA 2I5KA 3SXCA 4KRVA 1TW1A 1VGUA 3RSBA 4DE7A 5JQQA 4NAIA 3V0MA 1INIA 2I5EA 4D0ZA 2YC5A 2WAWA 2FYBA 2OEFA 2AE7A 1JVGA 4M2AA 3K8DA 1VZXA 1G1LA 1R7YA 2XWLA 3E26A 4B3UA 4HO4A 1G95A 4BMAA 1H5SB 4HO5A 1H7QA 3NGWA 3FWWA 3OAMA 3I0HA 1LL0A 1WT0A 2BO4A 2X65A 3D5NA 5AJNA 3U0XA 3SXAA 4DECA 1OQMB 2CU2A 2NXVA 1HM0A 5AJOA 1GQCA 1NHEB 1H5RA 1WT1A 3BCVA 2PX7A 2V0HA 4J18A 1H4CA 2AM3A 3USQA 1H3MA 1NQIB 3D98A 1G8OA 1TW5A 3R2WA 2RITA 3PKQA 2J0BA 3CKJA 4HG6A 3ZGGA 5DDVA 2AM4A 3OKRA 3ZLKA 2ICXA 1O7OA 3CKQA 3V0NA 5J49A 3I0CA 1YP4A 4ZDQA 5IFYA 3DUVA 3KIAA 2VS5A 5CQNX 3SXBA 1H4EA 1HJLA 1VH1A 2PGYA 2FFVA 4D48A 3I0FA 2ZU8A 4LW6A 3JUKA 5EJZA 2P73A 4AYJA 1H4DA 4EEGA 5L6SA 3ZF8A 4Y62A 3OH4A 2OI5A 4B4BA 4CJ8A 2AGDA 3V90A 1NMMB 4HO6A 1H5SD 4CVHA 3SPTA 2GGQA 1H7FA 1YP3A 3POLA 4IRQA 4B2XA 5C8RA 1JVDA 3OH2A 4G3PA 5FTVA 2V0IA 5C1HA 1S4NA 2ZU7A 3TQDA 2YESA 3OH3A 1JYLA 3PNNA 3U2VA 5CQOA 2P6WA 5EJ1A 5C4EA 2VS4A 1FRWA 4EE5A 5C4CA 5C48A 4MNDA 3CU0A 4P00A 4B4GA 3OH0A 4EEMA 1G9RA 2D7IA 4Q7CA 1QWJA 3T7OA 5C4DA 2APCA 4B2WA 1WSZA 1H5SC 4FRMA 1S4PA 5C3DA 5CQPA 1ZHJA 1I52A 4Y7TA 1WVCA 1G3LA 4FIYA 4D0TA 1GWWA 4HO9A 4G87A 1H7TA 3ST8A 3Q4SA 2A8WA 1OMXA 5C38A 3I0EA 3U0YA 1NWGB 4IRPA 2ZU9A 2OEGA 4FRDA 4D11C 3R3IA 2VFZA 3CGXA 1VZTA 2WE9A 1H5TB 4HO8A 4KC2A 4E1KA 1E5KA 1ZJ3A 3V0OA 5FU0A 4UEGA 1ZCVA 4O6MA 3I0IX 2X5SA 1ZI3A 1Z90A 4YS8A 2JCOA 2BO6A 2AECA 2VSHA 4HO3A 5CMHA 5CMIA 3CKNA 5CMGX 3N9WA 2YQCA 1LZ0A 2Y4JA 1ON8A 1ZJOA 4EEOA 1OMZA 1JV3A 1ZCUA 2OI7A 4HCQA 2QGIA 5C4FA 1G0RA 1H5SA 3Q80A 1ZI4A 1V83A 1VGTA 1H7GA 3V8YA 5IDSA 1QG8A 5C4BA 4HO0A 3V0LA 3V0QA 3ZGFA 2BO7A 4FRQA 2RJ7A 2RJ1A 3RMVA 4D11A 4L41C 4LW3A 1FO8A 1LL2A 1INJA 1V84A 4Y9XA 5CQMX 1SS9A 2AH9A 4B4MA 2QKXA 1LZJA 4EVWA 1FO9A 2Y4KA 3V0PA 3V91A 2RJ8A 4JISA 2RIYA 1G2VA 4ARWA 1ZDGA 1ZJ1A 2WVLA 1EYRA 1HM9A 4NAKA 1LVWA 1W57A 2JCKA 4HO2A 2WEEA 3QVBA 1ZJPA 1XHBA 5CMFX 1GX0A 1VH3A 4KPZA 2BO8A 4FRPA 4Y7VA 1G93A 1ZDFA 2YC3A 2D7RA 4FROA 1TVYA 1G23A 1IINA 2J0AA 4B5BA 1LZIA 4Y7UA 5IDTA 1O23B 4Y7FA 2E3DA 2W0WA 5FU8A 4KC4A 2Z86A 1G97A 2RJ0A 2VS3A 4Y6NA 1VGWA 3SXGA 5L6VA 3IOHA 1ZI5A 4KNRA 1S4OA 1MP4A 4EE4A 1FR8A 3I0KA 1VZUA 1VICA 4K6RA 2AM5A 3SX7A 2XMEA 2RJ5A 1PZTA 5I1FA 3SX8A 4FRHA 4ASJA 4CJCA 2DPWA 5C1GA 3K8EA 3TZTA 5C3AA 2YCMA 2FYAA 2W0VA 1V82A 1EZIA 1ZJ0A 3CKOA 3V8ZA 1K4VA 1PZYB 3U2WA 4XWIA 4KXOA 4Y64A 4FCUA 1ZCTA 3BRKX 3D8VA 4FIXA 2MZBA 2XMHA 2C0NA 4R7PA 2VD4A 1MP3A 4FCEA 1FGGA 1GWVA 1ZJ2A 3I0GA 3T7MA 2VK9A 3RMWA 4C2SA 2D0JA 2A8UA 2RJ9A 3ZLLA 1VM8A 4Y6UA 1ZCYA 3USRA 2Y4MA 5HS2A 3I0LA 4ASYA 1H5TA 4EE3A 5CQLX 4B42A 4ECMA 1ZIZA 3U2XA 5CMJA 3T7NA 1KWSA 2YQSA 1R82A 5EIYA 4KQLA 4JD0A 4FRAA 1LL3A 1VPAA 1FOAA 1ON6A 4AC3A 3OGZA 3CKVA 5D92A 1WT3A 1H5RB 4HOCA 5C49A 1NKHB 4M4KA 3JUJA 3SXEA 3F1CA 2V0LA 4NALA 1MP5A 2Z87A 2Q4JA 2YQJA 4EEAA 1ZI1A 1R81A 4FQWA 5FTSA 1VGZA 4Y63A 4CJBA 5D91A 1QGSA 3PKPA 1IIMA 2O1FA 3OC9A 2WGZA 1FGXA 1R7TA 3I0DA 3OH1A 5BXCA 2FY7A 2PA4A 2QH5A 2Y7AA 3JTJA 2YQHA 2O1GA 2WVMA 1LZ7A 2OI6A 1W77A 4Y7GA 4BQHA 1YP2A 2Y4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FXJ A;  4M2B A;  3SX5 A;  1YRO B;  1HV9 A;  1JYK A;  1HM8 A;  5C36 A;  5FUH A;  3F1Y A;  2JCL A;  2XWN A;  2UX8 A;  1GQ9 A;  1R7V A;  1XZ6 A;  3IOI A;  4MYB A;  4P02 A;  2Y6P A;  4KT7 A;  1H7H A;  3IOJ A;  3DK5 A;  3Q7U A;  3DJ4 A;  5AJP A;  2RIX A;  2RJ4 A;  1FWY A;  2VXL A;  3SXD A;  4FRB A;  2VXM A;  1FXO A;  1JV1 A;  2V0J A;  4KPX A;  3U2U A;  1HJJ A;  1H7L A;  2WVK A;  1O7Q A;  1R80 A;  2JCJ A;  1FG5 N;  5C3B A;  1FZW A;  2PGV A;  3FOQ A;  4M28 A;  2P72 A;  3LW6 A;  5FYE A;  1O0R A;  2ICY A;  5DDT A;  4G3S A;  2FFU A;  3HL3 A;  4FRE A;  2E8B A;  2RJ6 A;  2FYD B;  5C1L A;  2FYC B;  2AES A;  4G3Q A;  4DDZ A;  4NAN A;  5FV9 A;  1MC3 A;  1NF5 B;  3I0J A;  2I7B A;  2X60 A;  4GBP A;  4FRL A;  1W55 A;  1TZF A;  4KC1 A;  2GGO A;  3EE5 A;  1WT2 A;  3GUE A;  4KNX A;  1R7U A;  2V0K A;  4AYL A;  2RIZ A;  3O3P A;  1H7E A;  4AAW A;  2X5Z A;  3U2T A;  1R7X A;  1FR9 A;  2O1H A;  3SX3 A;  1QGQ A;  1GX4 A;  2VSI A;  3E25 A;  5C47 A;  1GA8 A;  2XWM A;  2I5K A;  3SXC A;  4KRV A;  1TW1 A;  1VGU A;  3RSB A;  4DE7 A;  5JQQ A;  4NAI A;  3V0M A;  1INI A;  2I5E A;  4D0Z A;  2YC5 A;  2WAW A;  2FYB A;  2OEF A;  2AE7 A;  1JVG A;  4M2A A;  3K8D A;  1VZX A;  1G1L A;  1R7Y A;  2XWL A;  3E26 A;  4B3U A;  4HO4 A;  1G95 A;  4BMA A;  1H5S B;  4HO5 A;  1H7Q A;  3NGW A;  3FWW A;  3OAM A;  3I0H A;  1LL0 A;  1WT0 A;  2BO4 A;  2X65 A;  3D5N A;  5AJN A;  3U0X A;  3SXA A;  4DEC A;  1OQM B;  2CU2 A;  2NXV A;  1HM0 A;  5AJO A;  1GQC A;  1NHE B;  1H5R A;  1WT1 A;  3BCV A;  2PX7 A;  2V0H A;  4J18 A;  1H4C A;  2AM3 A;  3USQ A;  1H3M A;  1NQI B;  3D98 A;  1G8O A;  1TW5 A;  3R2W A;  2RIT A;  3PKQ A;  3CKJ A;  4HG6 A;  3ZGG A;  5DDV A;  2AM4 A;  3OKR A;  3ZLK A;  2ICX A;  1O7O A;  3CKQ A;  3V0N A;  5J49 A;  3I0C A;  1YP4 A;  4ZDQ A;  5IFY A;  3DUV A;  3KIA A;  2VS5 A;  5CQN X;  3SXB A;  1H4E A;  1HJL A;  1VH1 A;  2PGY A;  2FFV A;  4D48 A;  3I0F A;  2ZU8 A;  4LW6 A;  3JUK A;  5EJZ A;  2P73 A;  4AYJ A;  1H4D A;  4EEG A;  5L6S A;  3ZF8 A;  4Y62 A;  3OH4 A;  2OI5 A;  4B4B A;  4CJ8 A;  2AGD A;  3V90 A;  1NMM B;  4HO6 A;  1H5S D;  4CVH A;  3SPT A;  2GGQ A;  1H7F A;  1YP3 A;  3POL A;  4IRQ A;  4B2X A;  5C8R A;  1JVD A;  3OH2 A;  4G3P A;  5FTV A;  2V0I A;  5C1H A;  1S4N A;  2ZU7 A;  3TQD A;  2YES A;  3OH3 A;  1JYL A;  3PNN A;  3U2V A;  5CQO A;  2P6W A;  5EJ1 A;  5C4E A;  2VS4 A;  1FRW A;  4EE5 A;  5C4C A;  5C48 A;  4MND A;  3CU0 A;  4P00 A;  4B4G A;  3OH0 A;  4EEM A;  1G9R A;  2D7I A;  3T7O A;  1QWJ A;  5C4D A;  2APC A;  4B2W A;  1WSZ A;  1H5S C;  4FRM A;  1S4P A;  5C3D A;  5CQP A;  1ZHJ A;  1I52 A;  4Y7T A;  1WVC A;  1G3L A;  4D0T A;  1GWW A;  4HO9 A;  4G87 A;  1H7T A;  3ST8 A;  3Q4S A;  2A8W A;  1OMX A;  5C38 A;  3I0E A;  3U0Y A;  1NWG B;  4IRP A;  2ZU9 A;  2OEG A;  4FRD A;  4D11 C;  3R3I A;  2VFZ A;  3CGX A;  1VZT A;  2WE9 A;  1H5T B;  4HO8 A;  4KC2 A;  4E1K A;  1E5K A;  1ZJ3 A;  3V0O A;  5FU0 A;  4UEG A;  1ZCV A;  3I0I X;  2X5S A;  1ZI3 A;  1Z90 A;  4YS8 A;  2JCO A;  2BO6 A;  2AEC A;  2VSH A;  4HO3 A;  5CMH A;  5CMI A;  3CKN A;  5CMG X;  3N9W A;  2YQC A;  1LZ0 A;  2Y4J A;  1ON8 A;  1ZJO A;  4EEO A;  1OMZ A;  1JV3 A;  1ZCU A;  2OI7 A;  4HCQ A;  2QGI A;  5C4F A;  1G0R A;  1H5S A;  3Q80 A;  1ZI4 A;  1V83 A;  1VGT A;  1H7G A;  3V8Y A;  5IDS A;  1QG8 A;  5C4B A;  4HO0 A;  3V0L A;  3V0Q A;  3ZGF A;  2BO7 A;  4FRQ A;  2RJ7 A;  2RJ1 A;  3RMV A;  4D11 A;  4L41 C;  4LW3 A;  1FO8 A;  1LL2 A;  1INJ A;  1V84 A;  4Y9X A;  5CQM X;  1SS9 A;  2AH9 A;  4B4M A;  2QKX A;  1LZJ A;  4EVW A;  1FO9 A;  2Y4K A;  3V0P A;  3V91 A;  2RJ8 A;  4JIS A;  2RIY A;  1G2V A;  4ARW A;  1ZDG A;  1ZJ1 A;  2WVL A;  1EYR A;  1HM9 A;  4NAK A;  1LVW A;  1W57 A;  2JCK A;  4HO2 A;  2WEE A;  3QVB A;  1ZJP A;  1XHB A;  5CMF X;  1GX0 A;  1VH3 A;  4KPZ A;  2BO8 A;  4FRP A;  4Y7V A;  1G93 A;  1ZDF A;  2YC3 A;  2D7R A;  4FRO A;  1TVY A;  1G23 A;  1IIN A;  4B5B A;  1LZI A;  4Y7U A;  5IDT A;  1O23 B;  4Y7F A;  2E3D A;  2W0W A;  5FU8 A;  4KC4 A;  2Z86 A;  1G97 A;  2RJ0 A;  2VS3 A;  4Y6N A;  1VGW A;  3SXG A;  5L6V A;  3IOH A;  1ZI5 A;  4KNR A;  1S4O A;  1MP4 A;  4EE4 A;  1FR8 A;  3I0K A;  1VZU A;  1VIC A;  4K6R A;  2AM5 A;  3SX7 A;  2XME A;  2RJ5 A;  1PZT A;  5I1F A;  3SX8 A;  4FRH A;  4ASJ A;  4CJC A;  2DPW A;  5C1G A;  3K8E A;  3TZT A;  5C3A A;  2YCM A;  2FYA A;  2W0V A;  1V82 A;  1EZI A;  1ZJ0 A;  3CKO A;  3V8Z A;  1K4V A;  1PZY B;  3U2W A;  4XWI A;  4KXO A;  4Y64 A;  4FCU A;  1ZCT A;  3BRK X;  3D8V A;  2MZB A;  2XMH A;  4R7P A;  2VD4 A;  1MP3 A;  4FCE A;  1FGG A;  1GWV A;  1ZJ2 A;  3I0G A;  3T7M A;  3RMW A;  4C2S A;  2D0J A;  2A8U A;  2RJ9 A;  3ZLL A;  1VM8 A;  4Y6U A;  1ZCY A;  3USR A;  2Y4M A;  5HS2 A;  3I0L A;  4ASY A;  1H5T A;  4EE3 A;  5CQL X;  4B42 A;  4ECM A;  1ZIZ A;  3U2X A;  5CMJ A;  3T7N A;  1KWS A;  2YQS A;  1R82 A;  5EIY A;  4KQL A;  4JD0 A;  4FRA A;  1LL3 A;  1VPA A;  1FOA A;  1ON6 A;  4AC3 A;  3OGZ A;  3CKV A;  1WT3 A;  1H5R B;  4HOC A;  5C49 A;  1NKH B;  4M4K A;  3JUJ A;  3SXE A;  3F1C A;  2V0L A;  4NAL A;  1MP5 A;  2Z87 A;  2Q4J A;  2YQJ A;  4EEA A;  1ZI1 A;  1R81 A;  4FQW A;  5FTS A;  1VGZ A;  4Y63 A;  4CJB A;  1QGS A;  3PKP A;  1IIM A;  2O1F A;  3OC9 A;  2WGZ A;  1FGX A;  1R7T A;  3I0D A;  3OH1 A;  5BXC A;  2FY7 A;  2PA4 A;  2QH5 A;  2Y7A A;  3JTJ A;  2YQH A;  2O1G A;  2WVM A;  1LZ7 A;  2OI6 A;  1W77 A;  4Y7G A;  4BQH A;  1YP2 A;  2Y4L A; 
#chains in the Genus database with same CATH topology
 1FXJ A;  4M2B A;  3SX5 A;  1YRO B;  1HV9 A;  1JYK A;  1HM8 A;  5C36 A;  5FUH A;  3F1Y A;  2JCL A;  2XWN A;  2UX8 A;  1GQ9 A;  1R7V A;  1XZ6 A;  3IOI A;  4MYB A;  4P02 A;  2Y6P A;  4KT7 A;  1H7H A;  3IOJ A;  3DK5 A;  4MIX A;  3Q7U A;  3DJ4 A;  5AJP A;  2RIX A;  2RJ4 A;  1FWY A;  2VXL A;  3SXD A;  4FRB A;  2VXM A;  1FXO A;  1JV1 A;  2V0J A;  4KPX A;  3U2U A;  1HJJ A;  1H7L A;  2WVK A;  1O7Q A;  1R80 A;  2JCJ A;  1FG5 N;  5C3B A;  1FZW A;  2PGV A;  3FOQ A;  4M28 A;  2P72 A;  3LW6 A;  5FYE A;  1O0R A;  2ICY A;  5DDT A;  4G3S A;  2FFU A;  3HL3 A;  4FRE A;  2E8B A;  2RJ6 A;  2FYD B;  5C1L A;  2FYC B;  2AES A;  4G3Q A;  4DDZ A;  4NAN A;  5FV9 A;  1MC3 A;  1NF5 B;  3I0J A;  2I7B A;  2X60 A;  4GBP A;  4FRL A;  1W55 A;  1TZF A;  4KC1 A;  2GGO A;  3EE5 A;  1WT2 A;  3GUE A;  4KNX A;  1R7U A;  2V0K A;  4AYL A;  2RIZ A;  3O3P A;  1H7E A;  4AAW A;  2X5Z A;  3U2T A;  1R7X A;  1FR9 A;  2O1H A;  3SX3 A;  1QGQ A;  1GX4 A;  2VSI A;  3E25 A;  5C47 A;  1GA8 A;  4O6N A;  2XWM A;  2I5K A;  3SXC A;  4KRV A;  1TW1 A;  1VGU A;  3RSB A;  4DE7 A;  5JQQ A;  4NAI A;  3V0M A;  1INI A;  2I5E A;  4D0Z A;  2YC5 A;  2WAW A;  2FYB A;  2OEF A;  2AE7 A;  1JVG A;  4M2A A;  3K8D A;  1VZX A;  1G1L A;  1R7Y A;  2XWL A;  3E26 A;  4B3U A;  4HO4 A;  1G95 A;  4BMA A;  1H5S B;  4HO5 A;  1H7Q A;  3NGW A;  3FWW A;  3OAM A;  3I0H A;  1LL0 A;  1WT0 A;  2BO4 A;  2X65 A;  3D5N A;  5AJN A;  3U0X A;  3SXA A;  4DEC A;  1OQM B;  2CU2 A;  2NXV A;  1HM0 A;  5AJO A;  1GQC A;  1NHE B;  1H5R A;  1WT1 A;  3BCV A;  2PX7 A;  2V0H A;  4J18 A;  1H4C A;  2AM3 A;  3USQ A;  1H3M A;  1NQI B;  3D98 A;  1G8O A;  1TW5 A;  3R2W A;  2RIT A;  3PKQ A;  2J0B A;  3CKJ A;  4HG6 A;  3ZGG A;  5DDV A;  2AM4 A;  3OKR A;  3ZLK A;  2ICX A;  1O7O A;  3CKQ A;  3V0N A;  5J49 A;  3I0C A;  1YP4 A;  4ZDQ A;  5IFY A;  3DUV A;  3KIA A;  2VS5 A;  5CQN X;  3SXB A;  1H4E A;  1HJL A;  1VH1 A;  2PGY A;  2FFV A;  4D48 A;  3I0F A;  2ZU8 A;  4LW6 A;  3JUK A;  5EJZ A;  2P73 A;  4AYJ A;  1H4D A;  4EEG A;  5L6S A;  3ZF8 A;  4Y62 A;  3OH4 A;  2OI5 A;  4B4B A;  4CJ8 A;  2AGD A;  3V90 A;  1NMM B;  4HO6 A;  1H5S D;  4CVH A;  3SPT A;  2GGQ A;  1H7F A;  1YP3 A;  3POL A;  4IRQ A;  4B2X A;  5C8R A;  1JVD A;  3OH2 A;  4G3P A;  5FTV A;  2V0I A;  5C1H A;  1S4N A;  2ZU7 A;  3TQD A;  2YES A;  3OH3 A;  1JYL A;  3PNN A;  3U2V A;  5CQO A;  2P6W A;  5EJ1 A;  5C4E A;  2VS4 A;  1FRW A;  4EE5 A;  5C4C A;  5C48 A;  4MND A;  3CU0 A;  4P00 A;  4B4G A;  3OH0 A;  4EEM A;  1G9R A;  2D7I A;  4Q7C A;  1QWJ A;  3T7O A;  5C4D A;  2APC A;  4B2W A;  1WSZ A;  1H5S C;  4FRM A;  1S4P A;  5C3D A;  5CQP A;  1ZHJ A;  1I52 A;  4Y7T A;  1WVC A;  1G3L A;  4FIY A;  4D0T A;  1GWW A;  4HO9 A;  4G87 A;  1H7T A;  3ST8 A;  3Q4S A;  2A8W A;  1OMX A;  5C38 A;  3I0E A;  3U0Y A;  1NWG B;  4IRP A;  2ZU9 A;  2OEG A;  4FRD A;  4D11 C;  3R3I A;  2VFZ A;  3CGX A;  1VZT A;  2WE9 A;  1H5T B;  4HO8 A;  4KC2 A;  4E1K A;  1E5K A;  1ZJ3 A;  3V0O A;  5FU0 A;  4UEG A;  1ZCV A;  4O6M A;  3I0I X;  2X5S A;  1ZI3 A;  1Z90 A;  4YS8 A;  2JCO A;  2BO6 A;  2AEC A;  2VSH A;  4HO3 A;  5CMH A;  5CMI A;  3CKN A;  5CMG X;  3N9W A;  2YQC A;  1LZ0 A;  2Y4J A;  1ON8 A;  1ZJO A;  4EEO A;  1OMZ A;  1JV3 A;  1ZCU A;  2OI7 A;  4HCQ A;  2QGI A;  5C4F A;  1G0R A;  1H5S A;  3Q80 A;  1ZI4 A;  1V83 A;  1VGT A;  1H7G A;  3V8Y A;  5IDS A;  1QG8 A;  5C4B A;  4HO0 A;  3V0L A;  3V0Q A;  3ZGF A;  2BO7 A;  4FRQ A;  2RJ7 A;  2RJ1 A;  3RMV A;  4D11 A;  4L41 C;  4LW3 A;  1FO8 A;  1LL2 A;  1INJ A;  1V84 A;  4Y9X A;  5CQM X;  1SS9 A;  2AH9 A;  4B4M A;  2QKX A;  1LZJ A;  4EVW A;  1FO9 A;  2Y4K A;  3V0P A;  3V91 A;  2RJ8 A;  4JIS A;  2RIY A;  1G2V A;  4ARW A;  1ZDG A;  1ZJ1 A;  2WVL A;  1EYR A;  1HM9 A;  4NAK A;  1LVW A;  1W57 A;  2JCK A;  4HO2 A;  2WEE A;  3QVB A;  1ZJP A;  1XHB A;  5CMF X;  1GX0 A;  1VH3 A;  4KPZ A;  2BO8 A;  4FRP A;  4Y7V A;  1G93 A;  1ZDF A;  2YC3 A;  2D7R A;  4FRO A;  1TVY A;  1G23 A;  1IIN A;  2J0A A;  4B5B A;  1LZI A;  4Y7U A;  5IDT A;  1O23 B;  4Y7F A;  2E3D A;  2W0W A;  5FU8 A;  4KC4 A;  2Z86 A;  1G97 A;  2RJ0 A;  2VS3 A;  4Y6N A;  1VGW A;  3SXG A;  5L6V A;  3IOH A;  1ZI5 A;  4KNR A;  1S4O A;  1MP4 A;  4EE4 A;  1FR8 A;  3I0K A;  1VZU A;  1VIC A;  4K6R A;  2AM5 A;  3SX7 A;  2XME A;  2RJ5 A;  1PZT A;  5I1F A;  3SX8 A;  4FRH A;  4ASJ A;  4CJC A;  2DPW A;  5C1G A;  3K8E A;  3TZT A;  5C3A A;  2YCM A;  2FYA A;  2W0V A;  1V82 A;  1EZI A;  1ZJ0 A;  3CKO A;  3V8Z A;  1K4V A;  1PZY B;  3U2W A;  4XWI A;  4KXO A;  4Y64 A;  4FCU A;  1ZCT A;  3BRK X;  3D8V A;  4FIX A;  2MZB A;  2XMH A;  2C0N A;  4R7P A;  2VD4 A;  1MP3 A;  4FCE A;  1FGG A;  1GWV A;  1ZJ2 A;  3I0G A;  3T7M A;  2VK9 A;  3RMW A;  4C2S A;  2D0J A;  2A8U A;  2RJ9 A;  3ZLL A;  1VM8 A;  4Y6U A;  1ZCY A;  3USR A;  2Y4M A;  5HS2 A;  3I0L A;  4ASY A;  1H5T A;  4EE3 A;  5CQL X;  4B42 A;  4ECM A;  1ZIZ A;  3U2X A;  5CMJ A;  3T7N A;  1KWS A;  2YQS A;  1R82 A;  5EIY A;  4KQL A;  4JD0 A;  4FRA A;  1LL3 A;  1VPA A;  1FOA A;  1ON6 A;  4AC3 A;  3OGZ A;  3CKV A;  5D92 A;  1WT3 A;  1H5R B;  4HOC A;  5C49 A;  1NKH B;  4M4K A;  3JUJ A;  3SXE A;  3F1C A;  2V0L A;  4NAL A;  1MP5 A;  2Z87 A;  2Q4J A;  2YQJ A;  4EEA A;  1ZI1 A;  1R81 A;  4FQW A;  5FTS A;  1VGZ A;  4Y63 A;  4CJB A;  5D91 A;  1QGS A;  3PKP A;  1IIM A;  2O1F A;  3OC9 A;  2WGZ A;  1FGX A;  1R7T A;  3I0D A;  3OH1 A;  5BXC A;  2FY7 A;  2PA4 A;  2QH5 A;  2Y7A A;  3JTJ A;  2YQH A;  2O1G A;  2WVM A;  1LZ7 A;  2OI6 A;  1W77 A;  4Y7G A;  4BQH A;  1YP2 A;  2Y4L A; 
#chains in the Genus database with same CATH homology
 1FXJ A;  4M2B A;  3SX5 A;  1YRO B;  1HV9 A;  1JYK A;  1HM8 A;  5C36 A;  5FUH A;  3F1Y A;  2JCL A;  2XWN A;  2UX8 A;  1GQ9 A;  1R7V A;  1XZ6 A;  3IOI A;  4MYB A;  4P02 A;  2Y6P A;  4KT7 A;  1H7H A;  3IOJ A;  3DK5 A;  4MIX A;  3Q7U A;  3DJ4 A;  5AJP A;  2RIX A;  2RJ4 A;  1FWY A;  2VXL A;  3SXD A;  4FRB A;  2VXM A;  1FXO A;  1JV1 A;  2V0J A;  4KPX A;  3U2U A;  1HJJ A;  1H7L A;  2WVK A;  1O7Q A;  1R80 A;  2JCJ A;  1FG5 N;  5C3B A;  1FZW A;  2PGV A;  3FOQ A;  4M28 A;  2P72 A;  3LW6 A;  5FYE A;  1O0R A;  2ICY A;  5DDT A;  4G3S A;  2FFU A;  3HL3 A;  4FRE A;  2E8B A;  2RJ6 A;  2FYD B;  5C1L A;  2FYC B;  2AES A;  4G3Q A;  4DDZ A;  4NAN A;  5FV9 A;  1MC3 A;  1NF5 B;  3I0J A;  2I7B A;  2X60 A;  4GBP A;  4FRL A;  1W55 A;  1TZF A;  4KC1 A;  2GGO A;  3EE5 A;  1WT2 A;  3GUE A;  4KNX A;  1R7U A;  2V0K A;  4AYL A;  2RIZ A;  3O3P A;  1H7E A;  4AAW A;  2X5Z A;  3U2T A;  1R7X A;  1FR9 A;  2O1H A;  3SX3 A;  1QGQ A;  1GX4 A;  2VSI A;  3E25 A;  5C47 A;  1GA8 A;  4O6N A;  2XWM A;  2I5K A;  3SXC A;  4KRV A;  1TW1 A;  1VGU A;  3RSB A;  4DE7 A;  5JQQ A;  4NAI A;  3V0M A;  1INI A;  2I5E A;  4D0Z A;  2YC5 A;  2WAW A;  2FYB A;  2OEF A;  2AE7 A;  1JVG A;  4M2A A;  3K8D A;  1VZX A;  1G1L A;  1R7Y A;  2XWL A;  3E26 A;  4B3U A;  4HO4 A;  1G95 A;  4BMA A;  1H5S B;  4HO5 A;  1H7Q A;  3NGW A;  3FWW A;  3OAM A;  3I0H A;  1LL0 A;  1WT0 A;  2BO4 A;  2X65 A;  3D5N A;  5AJN A;  3U0X A;  3SXA A;  4DEC A;  1OQM B;  2CU2 A;  2NXV A;  1HM0 A;  5AJO A;  1GQC A;  1NHE B;  1H5R A;  1WT1 A;  3BCV A;  2PX7 A;  2V0H A;  4J18 A;  1H4C A;  2AM3 A;  3USQ A;  1H3M A;  1NQI B;  3D98 A;  1G8O A;  1TW5 A;  3R2W A;  2RIT A;  3PKQ A;  2J0B A;  3CKJ A;  4HG6 A;  3ZGG A;  5DDV A;  2AM4 A;  3OKR A;  3ZLK A;  2ICX A;  1O7O A;  3CKQ A;  3V0N A;  5J49 A;  3I0C A;  1YP4 A;  4ZDQ A;  5IFY A;  3DUV A;  3KIA A;  2VS5 A;  5CQN X;  3SXB A;  1H4E A;  1HJL A;  1VH1 A;  2PGY A;  2FFV A;  4D48 A;  3I0F A;  2ZU8 A;  4LW6 A;  3JUK A;  5EJZ A;  2P73 A;  4AYJ A;  1H4D A;  4EEG A;  5L6S A;  3ZF8 A;  4Y62 A;  3OH4 A;  2OI5 A;  4B4B A;  4CJ8 A;  2AGD A;  3V90 A;  1NMM B;  4HO6 A;  1H5S D;  4CVH A;  3SPT A;  2GGQ A;  1H7F A;  1YP3 A;  3POL A;  4IRQ A;  4B2X A;  5C8R A;  1JVD A;  3OH2 A;  4G3P A;  5FTV A;  2V0I A;  5C1H A;  1S4N A;  2ZU7 A;  3TQD A;  2YES A;  3OH3 A;  1JYL A;  3PNN A;  3U2V A;  5CQO A;  2P6W A;  5EJ1 A;  5C4E A;  2VS4 A;  1FRW A;  4EE5 A;  5C4C A;  5C48 A;  4MND A;  3CU0 A;  4P00 A;  4B4G A;  3OH0 A;  4EEM A;  1G9R A;  2D7I A;  4Q7C A;  1QWJ A;  3T7O A;  5C4D A;  2APC A;  4B2W A;  1WSZ A;  1H5S C;  4FRM A;  1S4P A;  5C3D A;  5CQP A;  1ZHJ A;  1I52 A;  4Y7T A;  1WVC A;  1G3L A;  4FIY A;  4D0T A;  1GWW A;  4HO9 A;  4G87 A;  1H7T A;  3ST8 A;  3Q4S A;  2A8W A;  1OMX A;  5C38 A;  3I0E A;  3U0Y A;  1NWG B;  4IRP A;  2ZU9 A;  2OEG A;  4FRD A;  4D11 C;  3R3I A;  2VFZ A;  3CGX A;  1VZT A;  2WE9 A;  1H5T B;  4HO8 A;  4KC2 A;  4E1K A;  1E5K A;  1ZJ3 A;  3V0O A;  5FU0 A;  4UEG A;  1ZCV A;  4O6M A;  3I0I X;  2X5S A;  1ZI3 A;  1Z90 A;  4YS8 A;  2JCO A;  2BO6 A;  2AEC A;  2VSH A;  4HO3 A;  5CMH A;  5CMI A;  3CKN A;  5CMG X;  3N9W A;  2YQC A;  1LZ0 A;  2Y4J A;  1ON8 A;  1ZJO A;  4EEO A;  1OMZ A;  1JV3 A;  1ZCU A;  2OI7 A;  4HCQ A;  2QGI A;  5C4F A;  1G0R A;  1H5S A;  3Q80 A;  1ZI4 A;  1V83 A;  1VGT A;  1H7G A;  3V8Y A;  5IDS A;  1QG8 A;  5C4B A;  4HO0 A;  3V0L A;  3V0Q A;  3ZGF A;  2BO7 A;  4FRQ A;  2RJ7 A;  2RJ1 A;  3RMV A;  4D11 A;  4L41 C;  4LW3 A;  1FO8 A;  1LL2 A;  1INJ A;  1V84 A;  4Y9X A;  5CQM X;  1SS9 A;  2AH9 A;  4B4M A;  2QKX A;  1LZJ A;  4EVW A;  1FO9 A;  2Y4K A;  3V0P A;  3V91 A;  2RJ8 A;  4JIS A;  2RIY A;  1G2V A;  4ARW A;  1ZDG A;  1ZJ1 A;  2WVL A;  1EYR A;  1HM9 A;  4NAK A;  1LVW A;  1W57 A;  2JCK A;  4HO2 A;  2WEE A;  3QVB A;  1ZJP A;  1XHB A;  5CMF X;  1GX0 A;  1VH3 A;  4KPZ A;  2BO8 A;  4FRP A;  4Y7V A;  1G93 A;  1ZDF A;  2YC3 A;  2D7R A;  4FRO A;  1TVY A;  1G23 A;  1IIN A;  2J0A A;  4B5B A;  1LZI A;  4Y7U A;  5IDT A;  1O23 B;  4Y7F A;  2E3D A;  2W0W A;  5FU8 A;  4KC4 A;  2Z86 A;  1G97 A;  2RJ0 A;  2VS3 A;  4Y6N A;  1VGW A;  3SXG A;  5L6V A;  3IOH A;  1ZI5 A;  4KNR A;  1S4O A;  1MP4 A;  4EE4 A;  1FR8 A;  3I0K A;  1VZU A;  1VIC A;  4K6R A;  2AM5 A;  3SX7 A;  2XME A;  2RJ5 A;  1PZT A;  5I1F A;  3SX8 A;  4FRH A;  4ASJ A;  4CJC A;  2DPW A;  5C1G A;  3K8E A;  3TZT A;  5C3A A;  2YCM A;  2FYA A;  2W0V A;  1V82 A;  1EZI A;  1ZJ0 A;  3CKO A;  3V8Z A;  1K4V A;  1PZY B;  3U2W A;  4XWI A;  4KXO A;  4Y64 A;  4FCU A;  1ZCT A;  3BRK X;  3D8V A;  4FIX A;  2MZB A;  2XMH A;  2C0N A;  4R7P A;  2VD4 A;  1MP3 A;  4FCE A;  1FGG A;  1GWV A;  1ZJ2 A;  3I0G A;  3T7M A;  2VK9 A;  3RMW A;  4C2S A;  2D0J A;  2A8U A;  2RJ9 A;  3ZLL A;  1VM8 A;  4Y6U A;  1ZCY A;  3USR A;  2Y4M A;  5HS2 A;  3I0L A;  4ASY A;  1H5T A;  4EE3 A;  5CQL X;  4B42 A;  4ECM A;  1ZIZ A;  3U2X A;  5CMJ A;  3T7N A;  1KWS A;  2YQS A;  1R82 A;  5EIY A;  4KQL A;  4JD0 A;  4FRA A;  1LL3 A;  1VPA A;  1FOA A;  1ON6 A;  4AC3 A;  3OGZ A;  3CKV A;  5D92 A;  1WT3 A;  1H5R B;  4HOC A;  5C49 A;  1NKH B;  4M4K A;  3JUJ A;  3SXE A;  3F1C A;  2V0L A;  4NAL A;  1MP5 A;  2Z87 A;  2Q4J A;  2YQJ A;  4EEA A;  1ZI1 A;  1R81 A;  4FQW A;  5FTS A;  1VGZ A;  4Y63 A;  4CJB A;  5D91 A;  1QGS A;  3PKP A;  1IIM A;  2O1F A;  3OC9 A;  2WGZ A;  1FGX A;  1R7T A;  3I0D A;  3OH1 A;  5BXC A;  2FY7 A;  2PA4 A;  2QH5 A;  2Y7A A;  3JTJ A;  2YQH A;  2O1G A;  2WVM A;  1LZ7 A;  2OI6 A;  1W77 A;  4Y7G A;  4BQH A;  1YP2 A;  2Y4L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...