3USQA

Structure of d159s/y194f glycogenin mutant truncated at residue 270
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
266
structure length
256
Chain Sequence
MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTSRRLAVLTTPQVSDTMRKALEIVFDEVITVDILDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFEREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHVASEQGSFSGGDQGLLNTFFNSWATTDIRKHLPFIYNLSSISIFSYLPAFKAFGANAKVVHFLGQTKPWNYTYDTKTKSVRPQFLNVWWDIFTTSVVPLLQQFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycogenin-1
publication title Mechanisms of monomeric and dimeric glycogenin autoglucosylation.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transferase
total genus 84
structure length 256
sequence length 266
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3usqA00
3GUEA 4D48A 1FGGA 2QH5A 2AGDA 3I0LA 3ZLLA 4MYBA 5CQOA 1FOAA 3JUKA 2AESA 3V8ZA 3CU0A 2AM4A 1H7EA 2VS3A 2PGYA 2PX7A 2RJ7A 4HO0A 4ASYA 5L6VA 3SXEA 3USRA 5I1FA 4FRQA 2Y4LA 3I0GA 4HO5A 3U0XA 1G93A 3SX7A 1R7VA 1ZJ0A 3BRKX 5IFYA 4P02A 4HO2A 5EIYA 4CJBA 3DK5A 1H5TA 2D7RA 2FYAA 3CGXA 1JV3A 2YQSA 4Y7GA 4AC3A 1R7UA 5C1LA 2I5KA 1H4DA 1VZTA 2OI5A 2X5ZA 2ZU7A 2WAWA 3ZLKA 1G3LA 3E26A 1H7FA 1INJA 3SXAA 4CVHA 3V0PA 1H5SB 2FY7A 1FR8A 2ZU8A 1VZXA 3U2XA 2BO4A 2AM3A 4YS8A 2P72A 5EJ1A 1QG8A 4D11C 3V0MA 3I0JA 2Q4JA 2OI7A 4KPXA 1ZJ1A 3DUVA 5C1HA 2Y4KA 2QGIA 5IDSA 5CMGX 4Y64A 3ST8A 4DDZA 1SS9A 2XMHA 1VGWA 3I0IX 3SX3A 4EEMA 2OI6A 1G95A 1EYRA 2FFVA 3IOHA 2OEFA 2V0IA 3I0CA 4HCQA 1LL3A 4HG6A 3FWWA 3RMVA 5DDTA 3OH0A 3I0KA 4KNRA 5FUHA 4P00A 2BO7A 2YC5A 1V83A 4FRPA 2XMEA 3OC9A 5J49A 1ZIZA 4NANA 3F1YA 2FYBA 2WE9A 1GX0A 1HM9A 1IIMA 2RJ1A 4ASJA 4JISA 3HL3A 1WT3A 1E5KA 4LW6A 3U2UA 4C2SA 1O7QA 2NXVA 4B3UA 3I0DA 4B4MA 2ZU9A 1ZCUA 3IOJA 2Z86A 1R7YA 5FTVA 5CMIA 1GX4A 4KC2A 5C38A 4FRLA 4CJ8A 5BXCA 5CQMX 3CKNA 5C49A 1ZI4A 3T7NA 1NQIB 4XWIA 2YQCA 1LZ7A 1XZ6A 4B4GA 1VH1A 1HJLA 4Y63A 1INIA 2E8BA 1H7GA 1H4CA 3JUJA 1H5SD 3SXCA 3JTJA 4M28A 4NALA 3SX5A 3POLA 1Z90A 3V90A 1OMZA 1FO9A 3D98A 3TQDA 3SXGA 3OAMA 4Y7VA 1O0RA 5AJOA 5C4DA 3R3IA 1GA8A 5CMFX 3K8EA 1NWGB 1TW5A 2X65A 4LW3A 1R7TA 2I5EA 4IRQA 1HM8A 5JQQA 1VGUA 3ZGFA 5C4BA 1ZCVA 3D5NA 5AJPA 1FZWA 1W77A 3SXBA 2Y4JA 4E1KA 4FCEA 3U2TA 4NAIA 4FRBA 2Z87A 3CKOA 4EE3A 4KXOA 1MP3A 1JYKA 4EE4A 4EVWA 5EJZA 1NF5B 2XWNA 1R80A 4Y62A 1VPAA 1FXOA 1JYLA 4B42A 3I0EA 2JCLA 4KRVA 3V0NA 4HO3A 1MC3A 4L41C 1TZFA 5FV9A 2A8UA 2VS4A 1G97A 3D8VA 2GGOA 4G3SA 3CKJA 4AYJA 4G87A 2VXMA 1QGQA 4HOCA 4JD0A 3DJ4A 3SPTA 1ON8A 2GGQA 3LW6A 3OKRA 3CKVA 1WVCA 2JCOA 1ZJ2A 1KWSA 1H7QA 5DDVA 1GQCA 4FRAA 1ON6A 4KNXA 1WT1A 1LL2A 1OMXA 1LZ0A 4KT7A 2RJ8A 3CKQA 2FYCB 3ZGGA 1ZJPA 5C3BA 3OH3A 5C1GA 3N9WA 3Q4SA 2V0KA 2VSIA 3T7MA 1VM8A 1GWWA 3U0YA 2YCMA 3E25A 2AM5A 2WGZA 4KPZA 2Y6PA 5L6SA 1H5SC 4D0ZA 4FROA 3RMWA 2WEEA 3ZF8A 1FRWA 2RIXA 2VS5A 3U2VA 1FO8A 1VZUA 2P73A 1OQMB 1G23A 5CQPA 2E3DA 1H5RA 2PA4A 1G9RA 1H7HA 1G2VA 1S4NA 1HV9A 4KC1A 3T7OA 4G3PA 2Y4MA 2W0VA 1TW1A 4B2XA 1K4VA 4MNDA 5C4EA 1PZYB 1NHEB 1VICA 1I52A 1H7TA 1NKHB 2VD4A 5HS2A 2O1FA 1ZCTA 3R2WA 2AECA 1V82A 5C4FA 1MP4A 1LZIA 1EZIA 2BO6A 2JCJA 1WT2A 3F1CA 3FOQA 4G3QA 2RJ0A 4FQWA 2JCKA 5C8RA 5C3AA 2VFZA 1H7LA 4ZDQA 3QVBA 5FU0A 1FXJA 3RSBA 1NMMB 4FRMA 2X5SA 1ZHJA 2X60A 1YROB 1WT0A 5FU8A 1R82A 1JVDA 2O1GA 2V0JA 2RIZA 1YP3A 1VGZA 2APCA 2BO8A 3O3PA 1H5SA 5AJNA 5C4CA 4HO9A 1MP5A 1GQ9A 4J18A 2MZBA 4ECMA 4UEGA 5C47A 1IINA 3NGWA 3BCVA 2D7IA 1FR9A 4Y7FA 4EE5A 2O1HA 4HO6A 2YQJA 2Y7AA 4BQHA 1TVYA 2RITA 5FYEA 4M2BA 2YESA 1G0RA 2FFUA 4HO8A 1HJJA 2WVLA 1HM0A 2UX8A 5CMHA 2V0LA 2RJ4A 1VH3A 1O23B 2XWLA 5CQNX 4NAKA 4DE7A 4KC4A 3V0QA 3V8YA 2PGVA 3USQA 5C3DA 1H5TB 2AE7A 1G1LA 1FGXA 4Y7UA 3V91A 2I7BA 4EEOA 1FWYA 1ZDGA 4DECA 1S4OA 1QGSA 1S4PA 2RIYA 1R81A 1VGTA 2VXLA 3V0OA 2V0HA 1ZCYA 2CU2A 3PKQA 1LZJA 4GBPA 4CJCA 1ZI5A 5IDTA 1XHBA 3PNNA 3SXDA 1GWVA 3TZTA 1ZJ3A 1LVWA 1W57A 2WVMA 5CMJA 1YP2A 2AH9A 2DPWA 1O7OA 2RJ9A 1ZJOA 1YP4A 4EEAA 4FCUA 1FG5N 4BMAA 1LL0A 2YQHA 4D0TA 2ICYA 3OH4A 2A8WA 3Q7UA 3I0FA 2OEGA 4B4BA 3OH1A 3SX8A 1JV1A 4M4KA 4AAWA 1W55A 5C36A 3EE5A 3IOIA 2QKXA 1WSZA 2W0WA 3I0HA 1ZI1A 4M2AA 2P6WA 4Y6NA 5CQLX 1R7XA 2RJ6A 4K6RA 3PKPA 4R7PA 4KQLA 1ZDFA 5C48A 5FTSA 1PZTA 4FREA 4FRHA 4D11A 1H3MA 4IRPA 4Y7TA 4AYLA 3OGZA 2WVKA 2RJ5A 3U2WA 4EEGA 4B5BA 2YC3A 4Y6UA 2FYDB 2XWMA 2VSHA 1H5RB 3V0LA 1H4EA 1JVGA 4FRDA 2ICXA 3OH2A 1QWJA 1V84A 4ARWA 4B2WA 4Y9XA 4HO4A 1ZI3A 2D0JA 3KIAA 1G8OA 3K8DA 3Q80A
chains in the Genus database with same CATH superfamily
3GUEA 4D48A 1FGGA 2QH5A 2AGDA 3I0LA 3ZLLA 4MYBA 5CQOA 1FOAA 3JUKA 2AESA 3V8ZA 3CU0A 2AM4A 1H7EA 2VS3A 2PGYA 2PX7A 2RJ7A 4HO0A 4ASYA 5L6VA 3SXEA 3USRA 5I1FA 4FRQA 2Y4LA 3I0GA 4HO5A 3U0XA 1G93A 3SX7A 1R7VA 1ZJ0A 3BRKX 5IFYA 4P02A 4HO2A 5EIYA 4CJBA 3DK5A 1H5TA 2D7RA 2FYAA 3CGXA 1JV3A 5D92A 2YQSA 4Y7GA 4AC3A 1R7UA 5C1LA 2I5KA 1H4DA 1VZTA 2OI5A 2X5ZA 2ZU7A 2WAWA 3ZLKA 1G3LA 3E26A 1H7FA 1INJA 3SXAA 4CVHA 3V0PA 1H5SB 2FY7A 1FR8A 2ZU8A 1VZXA 3U2XA 2BO4A 2AM3A 4YS8A 2P72A 5EJ1A 1QG8A 4D11C 3V0MA 3I0JA 2Q4JA 2OI7A 4KPXA 1ZJ1A 3DUVA 5C1HA 2Y4KA 2QGIA 5IDSA 5CMGX 4Y64A 3ST8A 4DDZA 1SS9A 2XMHA 1VGWA 3I0IX 3SX3A 4EEMA 2OI6A 1G95A 1EYRA 2FFVA 3IOHA 2OEFA 2V0IA 3I0CA 4HCQA 1LL3A 4HG6A 3FWWA 3RMVA 5DDTA 3OH0A 3I0KA 4KNRA 5FUHA 4P00A 2BO7A 2YC5A 1V83A 4FRPA 2XMEA 3OC9A 5J49A 1ZIZA 4NANA 3F1YA 2FYBA 2WE9A 1GX0A 1HM9A 1IIMA 2RJ1A 4ASJA 4JISA 3HL3A 1WT3A 1E5KA 4LW6A 3U2UA 4C2SA 1O7QA 2NXVA 4B3UA 3I0DA 4B4MA 2ZU9A 1ZCUA 3IOJA 2Z86A 1R7YA 5FTVA 5CMIA 1GX4A 4KC2A 5C38A 4FRLA 4CJ8A 5BXCA 5CQMX 3CKNA 5C49A 1ZI4A 3T7NA 1NQIB 4XWIA 2YQCA 1LZ7A 1XZ6A 4B4GA 1VH1A 1HJLA 4Y63A 1INIA 2E8BA 1H7GA 1H4CA 3JUJA 1H5SD 3SXCA 3JTJA 4M28A 4NALA 3SX5A 3POLA 1Z90A 3V90A 1OMZA 1FO9A 2J0BA 3D98A 3TQDA 3SXGA 3OAMA 4Y7VA 1O0RA 5AJOA 5C4DA 3R3IA 1GA8A 5CMFX 3K8EA 1NWGB 1TW5A 2X65A 4LW3A 1R7TA 2I5EA 4IRQA 1HM8A 5JQQA 1VGUA 3ZGFA 5C4BA 1ZCVA 3D5NA 5AJPA 1FZWA 1W77A 3SXBA 2Y4JA 4E1KA 4FCEA 3U2TA 4NAIA 4FRBA 2Z87A 3CKOA 4EE3A 4KXOA 1MP3A 1JYKA 4EE4A 4EVWA 5EJZA 1NF5B 2XWNA 1R80A 4Y62A 1VPAA 1FXOA 1JYLA 4B42A 3I0EA 2JCLA 4KRVA 3V0NA 4HO3A 1MC3A 4L41C 1TZFA 5FV9A 2A8UA 2VS4A 1G97A 3D8VA 2GGOA 4G3SA 3CKJA 4AYJA 4G87A 2VXMA 1QGQA 4HOCA 4JD0A 3DJ4A 3SPTA 1ON8A 2GGQA 3LW6A 2VK9A 3OKRA 3CKVA 1WVCA 2JCOA 1ZJ2A 1KWSA 1H7QA 5DDVA 1GQCA 4FRAA 1ON6A 4KNXA 1WT1A 1LL2A 1OMXA 1LZ0A 4KT7A 2RJ8A 3CKQA 2FYCB 3ZGGA 1ZJPA 5C3BA 3OH3A 5C1GA 3N9WA 3Q4SA 2V0KA 2VSIA 3T7MA 1VM8A 1GWWA 3U0YA 2YCMA 3E25A 2AM5A 2WGZA 4KPZA 2Y6PA 5L6SA 1H5SC 4D0ZA 4FROA 5D91A 3RMWA 2WEEA 3ZF8A 1FRWA 2RIXA 2VS5A 3U2VA 1FO8A 1VZUA 2P73A 1OQMB 1G23A 5CQPA 2E3DA 1H5RA 2PA4A 1G9RA 1H7HA 1G2VA 1S4NA 1HV9A 4KC1A 3T7OA 4G3PA 2Y4MA 2W0VA 1TW1A 4B2XA 1K4VA 4MNDA 5C4EA 1PZYB 1NHEB 1VICA 1I52A 1H7TA 1NKHB 2VD4A 5HS2A 2O1FA 1ZCTA 3R2WA 2AECA 1V82A 5C4FA 1MP4A 1LZIA 1EZIA 2BO6A 2JCJA 1WT2A 3F1CA 3FOQA 4MIXA 4G3QA 2RJ0A 4FIYA 4FQWA 2JCKA 5C8RA 5C3AA 2VFZA 2C0NA 1H7LA 4ZDQA 3QVBA 5FU0A 1FXJA 3RSBA 1NMMB 4FRMA 2X5SA 1ZHJA 2X60A 1YROB 1WT0A 5FU8A 1R82A 1JVDA 2O1GA 2V0JA 2RIZA 1YP3A 1VGZA 2APCA 2BO8A 3O3PA 1H5SA 4O6MA 5AJNA 5C4CA 4HO9A 1MP5A 1GQ9A 4J18A 2MZBA 2J0AA 4ECMA 4UEGA 5C47A 4Q7CA 1IINA 3NGWA 3BCVA 2D7IA 1FR9A 4Y7FA 4EE5A 2O1HA 4HO6A 2YQJA 2Y7AA 4BQHA 1TVYA 2RITA 5FYEA 4M2BA 2YESA 1G0RA 2FFUA 4HO8A 1HJJA 2WVLA 1HM0A 2UX8A 5CMHA 2V0LA 2RJ4A 1VH3A 1O23B 2XWLA 5CQNX 4NAKA 4DE7A 4KC4A 3V0QA 3V8YA 2PGVA 3USQA 5C3DA 1H5TB 2AE7A 1G1LA 1FGXA 4Y7UA 3V91A 2I7BA 4EEOA 1FWYA 1ZDGA 4DECA 1S4OA 1QGSA 1S4PA 2RIYA 1R81A 1VGTA 2VXLA 3V0OA 2V0HA 1ZCYA 2CU2A 3PKQA 1LZJA 4GBPA 4CJCA 1ZI5A 5IDTA 1XHBA 3PNNA 3SXDA 1GWVA 3TZTA 1ZJ3A 1LVWA 1W57A 2WVMA 5CMJA 1YP2A 2AH9A 2DPWA 1O7OA 2RJ9A 1ZJOA 1YP4A 4EEAA 4FCUA 1FG5N 4BMAA 1LL0A 2YQHA 4D0TA 2ICYA 3OH4A 2A8WA 3Q7UA 3I0FA 2OEGA 4B4BA 3OH1A 3SX8A 1JV1A 4O6NA 4M4KA 4AAWA 1W55A 5C36A 3EE5A 3IOIA 2QKXA 1WSZA 2W0WA 3I0HA 1ZI1A 4M2AA 2P6WA 4Y6NA 5CQLX 1R7XA 2RJ6A 4K6RA 3PKPA 4R7PA 4KQLA 1ZDFA 5C48A 5FTSA 1PZTA 4FREA 4FRHA 4D11A 1H3MA 4IRPA 4Y7TA 4AYLA 3OGZA 2WVKA 2RJ5A 3U2WA 4EEGA 4B5BA 2YC3A 4Y6UA 2FYDB 2XWMA 4FIXA 2VSHA 1H5RB 3V0LA 1H4EA 1JVGA 4FRDA 2ICXA 3OH2A 1QWJA 1V84A 4ARWA 4B2WA 4Y9XA 4HO4A 1ZI3A 2D0JA 3KIAA 1G8OA 3K8DA 3Q80A
chains in the Genus database with same CATH topology
3GUEA 4D48A 1FGGA 2QH5A 2AGDA 3I0LA 3ZLLA 4MYBA 5CQOA 1FOAA 3JUKA 2AESA 3V8ZA 3CU0A 2AM4A 1H7EA 2VS3A 2PGYA 2PX7A 2RJ7A 4HO0A 4ASYA 5L6VA 3SXEA 3USRA 5I1FA 4FRQA 2Y4LA 3I0GA 4HO5A 3U0XA 1G93A 3SX7A 1R7VA 1ZJ0A 3BRKX 5IFYA 4P02A 4HO2A 5EIYA 4CJBA 3DK5A 1H5TA 2D7RA 2FYAA 3CGXA 1JV3A 5D92A 2YQSA 4Y7GA 4AC3A 1R7UA 5C1LA 2I5KA 1H4DA 1VZTA 2OI5A 2X5ZA 2ZU7A 2WAWA 3ZLKA 1G3LA 3E26A 1H7FA 1INJA 3SXAA 4CVHA 3V0PA 1H5SB 2FY7A 1FR8A 2ZU8A 1VZXA 3U2XA 2BO4A 2AM3A 4YS8A 2P72A 5EJ1A 1QG8A 4D11C 3V0MA 3I0JA 2Q4JA 2OI7A 4KPXA 1ZJ1A 3DUVA 5C1HA 2Y4KA 2QGIA 5IDSA 5CMGX 4Y64A 3ST8A 4DDZA 1SS9A 2XMHA 1VGWA 3I0IX 3SX3A 4EEMA 2OI6A 1G95A 1EYRA 2FFVA 3IOHA 2OEFA 2V0IA 3I0CA 4HCQA 1LL3A 4HG6A 3FWWA 3RMVA 5DDTA 3OH0A 3I0KA 4KNRA 5FUHA 4P00A 2BO7A 2YC5A 1V83A 4FRPA 2XMEA 3OC9A 5J49A 1ZIZA 4NANA 3F1YA 2FYBA 2WE9A 1GX0A 1HM9A 1IIMA 2RJ1A 4ASJA 4JISA 3HL3A 1WT3A 1E5KA 4LW6A 3U2UA 4C2SA 1O7QA 2NXVA 4B3UA 3I0DA 4B4MA 2ZU9A 1ZCUA 3IOJA 2Z86A 1R7YA 5FTVA 5CMIA 1GX4A 4KC2A 5C38A 4FRLA 4CJ8A 5BXCA 5CQMX 3CKNA 5C49A 1ZI4A 3T7NA 1NQIB 4XWIA 2YQCA 1LZ7A 1XZ6A 4B4GA 1VH1A 1HJLA 4Y63A 1INIA 2E8BA 1H7GA 1H4CA 3JUJA 1H5SD 3SXCA 3JTJA 4M28A 4NALA 3SX5A 3POLA 1Z90A 3V90A 1OMZA 1FO9A 2J0BA 3D98A 3TQDA 3SXGA 3OAMA 4Y7VA 1O0RA 5AJOA 5C4DA 3R3IA 1GA8A 5CMFX 3K8EA 1NWGB 1TW5A 2X65A 4LW3A 1R7TA 2I5EA 4IRQA 1HM8A 5JQQA 1VGUA 3ZGFA 5C4BA 1ZCVA 3D5NA 5AJPA 1FZWA 1W77A 3SXBA 2Y4JA 4E1KA 4FCEA 3U2TA 4NAIA 4FRBA 2Z87A 3CKOA 4EE3A 4KXOA 1MP3A 1JYKA 4EE4A 4EVWA 5EJZA 1NF5B 2XWNA 1R80A 4Y62A 1VPAA 1FXOA 1JYLA 4B42A 3I0EA 2JCLA 4KRVA 3V0NA 4HO3A 1MC3A 4L41C 1TZFA 5FV9A 2A8UA 2VS4A 1G97A 3D8VA 2GGOA 4G3SA 3CKJA 4AYJA 4G87A 2VXMA 1QGQA 4HOCA 4JD0A 3DJ4A 3SPTA 1ON8A 2GGQA 3LW6A 2VK9A 3OKRA 3CKVA 1WVCA 2JCOA 1ZJ2A 1KWSA 1H7QA 5DDVA 1GQCA 4FRAA 1ON6A 4KNXA 1WT1A 1LL2A 1OMXA 1LZ0A 4KT7A 2RJ8A 3CKQA 2FYCB 3ZGGA 1ZJPA 5C3BA 3OH3A 5C1GA 3N9WA 3Q4SA 2V0KA 2VSIA 3T7MA 1VM8A 1GWWA 3U0YA 2YCMA 3E25A 2AM5A 2WGZA 4KPZA 2Y6PA 5L6SA 1H5SC 4D0ZA 4FROA 5D91A 3RMWA 2WEEA 3ZF8A 1FRWA 2RIXA 2VS5A 3U2VA 1FO8A 1VZUA 2P73A 1OQMB 1G23A 5CQPA 2E3DA 1H5RA 2PA4A 1G9RA 1H7HA 1G2VA 1S4NA 1HV9A 4KC1A 3T7OA 4G3PA 2Y4MA 2W0VA 1TW1A 4B2XA 1K4VA 4MNDA 5C4EA 1PZYB 1NHEB 1VICA 1I52A 1H7TA 1NKHB 2VD4A 5HS2A 2O1FA 1ZCTA 3R2WA 2AECA 1V82A 5C4FA 1MP4A 1LZIA 1EZIA 2BO6A 2JCJA 1WT2A 3F1CA 3FOQA 4MIXA 4G3QA 2RJ0A 4FIYA 4FQWA 2JCKA 5C8RA 5C3AA 2VFZA 2C0NA 1H7LA 4ZDQA 3QVBA 5FU0A 1FXJA 3RSBA 1NMMB 4FRMA 2X5SA 1ZHJA 2X60A 1YROB 1WT0A 5FU8A 1R82A 1JVDA 2O1GA 2V0JA 2RIZA 1YP3A 1VGZA 2APCA 2BO8A 3O3PA 1H5SA 4O6MA 5AJNA 5C4CA 4HO9A 1MP5A 1GQ9A 4J18A 2MZBA 2J0AA 4ECMA 4UEGA 5C47A 4Q7CA 1IINA 3NGWA 3BCVA 2D7IA 1FR9A 4Y7FA 4EE5A 2O1HA 4HO6A 2YQJA 2Y7AA 4BQHA 1TVYA 2RITA 5FYEA 4M2BA 2YESA 1G0RA 2FFUA 4HO8A 1HJJA 2WVLA 1HM0A 2UX8A 5CMHA 2V0LA 2RJ4A 1VH3A 1O23B 2XWLA 5CQNX 4NAKA 4DE7A 4KC4A 3V0QA 3V8YA 2PGVA 3USQA 5C3DA 1H5TB 2AE7A 1G1LA 1FGXA 4Y7UA 3V91A 2I7BA 4EEOA 1FWYA 1ZDGA 4DECA 1S4OA 1QGSA 1S4PA 2RIYA 1R81A 1VGTA 2VXLA 3V0OA 2V0HA 1ZCYA 2CU2A 3PKQA 1LZJA 4GBPA 4CJCA 1ZI5A 5IDTA 1XHBA 3PNNA 3SXDA 1GWVA 3TZTA 1ZJ3A 1LVWA 1W57A 2WVMA 5CMJA 1YP2A 2AH9A 2DPWA 1O7OA 2RJ9A 1ZJOA 1YP4A 4EEAA 4FCUA 1FG5N 4BMAA 1LL0A 2YQHA 4D0TA 2ICYA 3OH4A 2A8WA 3Q7UA 3I0FA 2OEGA 4B4BA 3OH1A 3SX8A 1JV1A 4O6NA 4M4KA 4AAWA 1W55A 5C36A 3EE5A 3IOIA 2QKXA 1WSZA 2W0WA 3I0HA 1ZI1A 4M2AA 2P6WA 4Y6NA 5CQLX 1R7XA 2RJ6A 4K6RA 3PKPA 4R7PA 4KQLA 1ZDFA 5C48A 5FTSA 1PZTA 4FREA 4FRHA 4D11A 1H3MA 4IRPA 4Y7TA 4AYLA 3OGZA 2WVKA 2RJ5A 3U2WA 4EEGA 4B5BA 2YC3A 4Y6UA 2FYDB 2XWMA 4FIXA 2VSHA 1H5RB 3V0LA 1H4EA 1JVGA 4FRDA 2ICXA 3OH2A 1QWJA 1V84A 4ARWA 4B2WA 4Y9XA 4HO4A 1ZI3A 2D0JA 3KIAA 1G8OA 3K8DA 3Q80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GUE A;  4D48 A;  1FGG A;  2QH5 A;  2AGD A;  3I0L A;  3ZLL A;  4MYB A;  5CQO A;  1FOA A;  3JUK A;  2AES A;  3V8Z A;  3CU0 A;  2AM4 A;  1H7E A;  2VS3 A;  2PGY A;  2PX7 A;  2RJ7 A;  4HO0 A;  4ASY A;  5L6V A;  3SXE A;  3USR A;  5I1F A;  4FRQ A;  2Y4L A;  3I0G A;  4HO5 A;  3U0X A;  1G93 A;  3SX7 A;  1R7V A;  1ZJ0 A;  3BRK X;  5IFY A;  4P02 A;  4HO2 A;  5EIY A;  4CJB A;  3DK5 A;  1H5T A;  2D7R A;  2FYA A;  3CGX A;  1JV3 A;  2YQS A;  4Y7G A;  4AC3 A;  1R7U A;  5C1L A;  2I5K A;  1H4D A;  1VZT A;  2OI5 A;  2X5Z A;  2ZU7 A;  2WAW A;  3ZLK A;  1G3L A;  3E26 A;  1H7F A;  1INJ A;  3SXA A;  4CVH A;  3V0P A;  1H5S B;  2FY7 A;  1FR8 A;  2ZU8 A;  1VZX A;  3U2X A;  2BO4 A;  2AM3 A;  4YS8 A;  2P72 A;  5EJ1 A;  1QG8 A;  4D11 C;  3V0M A;  3I0J A;  2Q4J A;  2OI7 A;  4KPX A;  1ZJ1 A;  3DUV A;  5C1H A;  2Y4K A;  2QGI A;  5IDS A;  5CMG X;  4Y64 A;  3ST8 A;  4DDZ A;  1SS9 A;  2XMH A;  1VGW A;  3I0I X;  3SX3 A;  4EEM A;  2OI6 A;  1G95 A;  1EYR A;  2FFV A;  3IOH A;  2OEF A;  2V0I A;  3I0C A;  4HCQ A;  1LL3 A;  4HG6 A;  3FWW A;  3RMV A;  5DDT A;  3OH0 A;  3I0K A;  4KNR A;  5FUH A;  4P00 A;  2BO7 A;  2YC5 A;  1V83 A;  4FRP A;  2XME A;  3OC9 A;  5J49 A;  1ZIZ A;  4NAN A;  3F1Y A;  2FYB A;  2WE9 A;  1GX0 A;  1HM9 A;  1IIM A;  2RJ1 A;  4ASJ A;  4JIS A;  3HL3 A;  1WT3 A;  1E5K A;  4LW6 A;  3U2U A;  4C2S A;  1O7Q A;  2NXV A;  4B3U A;  3I0D A;  4B4M A;  2ZU9 A;  1ZCU A;  3IOJ A;  2Z86 A;  1R7Y A;  5FTV A;  5CMI A;  1GX4 A;  4KC2 A;  5C38 A;  4FRL A;  4CJ8 A;  5BXC A;  5CQM X;  3CKN A;  5C49 A;  1ZI4 A;  3T7N A;  1NQI B;  4XWI A;  2YQC A;  1LZ7 A;  1XZ6 A;  4B4G A;  1VH1 A;  1HJL A;  4Y63 A;  1INI A;  2E8B A;  1H7G A;  1H4C A;  3JUJ A;  1H5S D;  3SXC A;  3JTJ A;  4M28 A;  4NAL A;  3SX5 A;  3POL A;  1Z90 A;  3V90 A;  1OMZ A;  1FO9 A;  3D98 A;  3TQD A;  3SXG A;  3OAM A;  4Y7V A;  1O0R A;  5AJO A;  5C4D A;  3R3I A;  1GA8 A;  5CMF X;  3K8E A;  1NWG B;  1TW5 A;  2X65 A;  4LW3 A;  1R7T A;  2I5E A;  4IRQ A;  1HM8 A;  5JQQ A;  1VGU A;  3ZGF A;  5C4B A;  1ZCV A;  3D5N A;  5AJP A;  1FZW A;  1W77 A;  3SXB A;  2Y4J A;  4E1K A;  4FCE A;  3U2T A;  4NAI A;  4FRB A;  2Z87 A;  3CKO A;  4EE3 A;  4KXO A;  1MP3 A;  1JYK A;  4EE4 A;  4EVW A;  5EJZ A;  1NF5 B;  2XWN A;  1R80 A;  4Y62 A;  1VPA A;  1FXO A;  1JYL A;  4B42 A;  3I0E A;  2JCL A;  4KRV A;  3V0N A;  4HO3 A;  1MC3 A;  4L41 C;  1TZF A;  5FV9 A;  2A8U A;  2VS4 A;  1G97 A;  3D8V A;  2GGO A;  4G3S A;  3CKJ A;  4AYJ A;  4G87 A;  2VXM A;  1QGQ A;  4HOC A;  4JD0 A;  3DJ4 A;  3SPT A;  1ON8 A;  2GGQ A;  3LW6 A;  3OKR A;  3CKV A;  1WVC A;  2JCO A;  1ZJ2 A;  1KWS A;  1H7Q A;  5DDV A;  1GQC A;  4FRA A;  1ON6 A;  4KNX A;  1WT1 A;  1LL2 A;  1OMX A;  1LZ0 A;  4KT7 A;  2RJ8 A;  3CKQ A;  2FYC B;  3ZGG A;  1ZJP A;  5C3B A;  3OH3 A;  5C1G A;  3N9W A;  3Q4S A;  2V0K A;  2VSI A;  3T7M A;  1VM8 A;  1GWW A;  3U0Y A;  2YCM A;  3E25 A;  2AM5 A;  2WGZ A;  4KPZ A;  2Y6P A;  5L6S A;  1H5S C;  4D0Z A;  4FRO A;  3RMW A;  2WEE A;  3ZF8 A;  1FRW A;  2RIX A;  2VS5 A;  3U2V A;  1FO8 A;  1VZU A;  2P73 A;  1OQM B;  1G23 A;  5CQP A;  2E3D A;  1H5R A;  2PA4 A;  1G9R A;  1H7H A;  1G2V A;  1S4N A;  1HV9 A;  4KC1 A;  3T7O A;  4G3P A;  2Y4M A;  2W0V A;  1TW1 A;  4B2X A;  1K4V A;  4MND A;  5C4E A;  1PZY B;  1NHE B;  1VIC A;  1I52 A;  1H7T A;  1NKH B;  2VD4 A;  5HS2 A;  2O1F A;  1ZCT A;  3R2W A;  2AEC A;  1V82 A;  5C4F A;  1MP4 A;  1LZI A;  1EZI A;  2BO6 A;  2JCJ A;  1WT2 A;  3F1C A;  3FOQ A;  4G3Q A;  2RJ0 A;  4FQW A;  2JCK A;  5C8R A;  5C3A A;  2VFZ A;  1H7L A;  4ZDQ A;  3QVB A;  5FU0 A;  1FXJ A;  3RSB A;  1NMM B;  4FRM A;  2X5S A;  1ZHJ A;  2X60 A;  1YRO B;  1WT0 A;  5FU8 A;  1R82 A;  1JVD A;  2O1G A;  2V0J A;  2RIZ A;  1YP3 A;  1VGZ A;  2APC A;  2BO8 A;  3O3P A;  1H5S A;  5AJN A;  5C4C A;  4HO9 A;  1MP5 A;  1GQ9 A;  4J18 A;  2MZB A;  4ECM A;  4UEG A;  5C47 A;  1IIN A;  3NGW A;  3BCV A;  2D7I A;  1FR9 A;  4Y7F A;  4EE5 A;  2O1H A;  4HO6 A;  2YQJ A;  2Y7A A;  4BQH A;  1TVY A;  2RIT A;  5FYE A;  4M2B A;  2YES A;  1G0R A;  2FFU A;  4HO8 A;  1HJJ A;  2WVL A;  1HM0 A;  2UX8 A;  5CMH A;  2V0L A;  2RJ4 A;  1VH3 A;  1O23 B;  2XWL A;  5CQN X;  4NAK A;  4DE7 A;  4KC4 A;  3V0Q A;  3V8Y A;  2PGV A;  3USQ A;  5C3D A;  1H5T B;  2AE7 A;  1G1L A;  1FGX A;  4Y7U A;  3V91 A;  2I7B A;  4EEO A;  1FWY A;  1ZDG A;  4DEC A;  1S4O A;  1QGS A;  1S4P A;  2RIY A;  1R81 A;  1VGT A;  2VXL A;  3V0O A;  2V0H A;  1ZCY A;  2CU2 A;  3PKQ A;  1LZJ A;  4GBP A;  4CJC A;  1ZI5 A;  5IDT A;  1XHB A;  3PNN A;  3SXD A;  1GWV A;  3TZT A;  1ZJ3 A;  1LVW A;  1W57 A;  2WVM A;  5CMJ A;  1YP2 A;  2AH9 A;  2DPW A;  1O7O A;  2RJ9 A;  1ZJO A;  1YP4 A;  4EEA A;  4FCU A;  1FG5 N;  4BMA A;  1LL0 A;  2YQH A;  4D0T A;  2ICY A;  3OH4 A;  2A8W A;  3Q7U A;  3I0F A;  2OEG A;  4B4B A;  3OH1 A;  3SX8 A;  1JV1 A;  4M4K A;  4AAW A;  1W55 A;  5C36 A;  3EE5 A;  3IOI A;  2QKX A;  1WSZ A;  2W0W A;  3I0H A;  1ZI1 A;  4M2A A;  2P6W A;  4Y6N A;  5CQL X;  1R7X A;  2RJ6 A;  4K6R A;  3PKP A;  4R7P A;  4KQL A;  1ZDF A;  5C48 A;  5FTS A;  1PZT A;  4FRE A;  4FRH A;  4D11 A;  1H3M A;  4IRP A;  4Y7T A;  4AYL A;  3OGZ A;  2WVK A;  2RJ5 A;  3U2W A;  4EEG A;  4B5B A;  2YC3 A;  4Y6U A;  2FYD B;  2XWM A;  2VSH A;  1H5R B;  3V0L A;  1H4E A;  1JVG A;  4FRD A;  2ICX A;  3OH2 A;  1QWJ A;  1V84 A;  4ARW A;  4B2W A;  4Y9X A;  4HO4 A;  1ZI3 A;  2D0J A;  3KIA A;  1G8O A;  3K8D A;  3Q80 A; 
#chains in the Genus database with same CATH topology
 3GUE A;  4D48 A;  1FGG A;  2QH5 A;  2AGD A;  3I0L A;  3ZLL A;  4MYB A;  5CQO A;  1FOA A;  3JUK A;  2AES A;  3V8Z A;  3CU0 A;  2AM4 A;  1H7E A;  2VS3 A;  2PGY A;  2PX7 A;  2RJ7 A;  4HO0 A;  4ASY A;  5L6V A;  3SXE A;  3USR A;  5I1F A;  4FRQ A;  2Y4L A;  3I0G A;  4HO5 A;  3U0X A;  1G93 A;  3SX7 A;  1R7V A;  1ZJ0 A;  3BRK X;  5IFY A;  4P02 A;  4HO2 A;  5EIY A;  4CJB A;  3DK5 A;  1H5T A;  2D7R A;  2FYA A;  3CGX A;  1JV3 A;  5D92 A;  2YQS A;  4Y7G A;  4AC3 A;  1R7U A;  5C1L A;  2I5K A;  1H4D A;  1VZT A;  2OI5 A;  2X5Z A;  2ZU7 A;  2WAW A;  3ZLK A;  1G3L A;  3E26 A;  1H7F A;  1INJ A;  3SXA A;  4CVH A;  3V0P A;  1H5S B;  2FY7 A;  1FR8 A;  2ZU8 A;  1VZX A;  3U2X A;  2BO4 A;  2AM3 A;  4YS8 A;  2P72 A;  5EJ1 A;  1QG8 A;  4D11 C;  3V0M A;  3I0J A;  2Q4J A;  2OI7 A;  4KPX A;  1ZJ1 A;  3DUV A;  5C1H A;  2Y4K A;  2QGI A;  5IDS A;  5CMG X;  4Y64 A;  3ST8 A;  4DDZ A;  1SS9 A;  2XMH A;  1VGW A;  3I0I X;  3SX3 A;  4EEM A;  2OI6 A;  1G95 A;  1EYR A;  2FFV A;  3IOH A;  2OEF A;  2V0I A;  3I0C A;  4HCQ A;  1LL3 A;  4HG6 A;  3FWW A;  3RMV A;  5DDT A;  3OH0 A;  3I0K A;  4KNR A;  5FUH A;  4P00 A;  2BO7 A;  2YC5 A;  1V83 A;  4FRP A;  2XME A;  3OC9 A;  5J49 A;  1ZIZ A;  4NAN A;  3F1Y A;  2FYB A;  2WE9 A;  1GX0 A;  1HM9 A;  1IIM A;  2RJ1 A;  4ASJ A;  4JIS A;  3HL3 A;  1WT3 A;  1E5K A;  4LW6 A;  3U2U A;  4C2S A;  1O7Q A;  2NXV A;  4B3U A;  3I0D A;  4B4M A;  2ZU9 A;  1ZCU A;  3IOJ A;  2Z86 A;  1R7Y A;  5FTV A;  5CMI A;  1GX4 A;  4KC2 A;  5C38 A;  4FRL A;  4CJ8 A;  5BXC A;  5CQM X;  3CKN A;  5C49 A;  1ZI4 A;  3T7N A;  1NQI B;  4XWI A;  2YQC A;  1LZ7 A;  1XZ6 A;  4B4G A;  1VH1 A;  1HJL A;  4Y63 A;  1INI A;  2E8B A;  1H7G A;  1H4C A;  3JUJ A;  1H5S D;  3SXC A;  3JTJ A;  4M28 A;  4NAL A;  3SX5 A;  3POL A;  1Z90 A;  3V90 A;  1OMZ A;  1FO9 A;  2J0B A;  3D98 A;  3TQD A;  3SXG A;  3OAM A;  4Y7V A;  1O0R A;  5AJO A;  5C4D A;  3R3I A;  1GA8 A;  5CMF X;  3K8E A;  1NWG B;  1TW5 A;  2X65 A;  4LW3 A;  1R7T A;  2I5E A;  4IRQ A;  1HM8 A;  5JQQ A;  1VGU A;  3ZGF A;  5C4B A;  1ZCV A;  3D5N A;  5AJP A;  1FZW A;  1W77 A;  3SXB A;  2Y4J A;  4E1K A;  4FCE A;  3U2T A;  4NAI A;  4FRB A;  2Z87 A;  3CKO A;  4EE3 A;  4KXO A;  1MP3 A;  1JYK A;  4EE4 A;  4EVW A;  5EJZ A;  1NF5 B;  2XWN A;  1R80 A;  4Y62 A;  1VPA A;  1FXO A;  1JYL A;  4B42 A;  3I0E A;  2JCL A;  4KRV A;  3V0N A;  4HO3 A;  1MC3 A;  4L41 C;  1TZF A;  5FV9 A;  2A8U A;  2VS4 A;  1G97 A;  3D8V A;  2GGO A;  4G3S A;  3CKJ A;  4AYJ A;  4G87 A;  2VXM A;  1QGQ A;  4HOC A;  4JD0 A;  3DJ4 A;  3SPT A;  1ON8 A;  2GGQ A;  3LW6 A;  2VK9 A;  3OKR A;  3CKV A;  1WVC A;  2JCO A;  1ZJ2 A;  1KWS A;  1H7Q A;  5DDV A;  1GQC A;  4FRA A;  1ON6 A;  4KNX A;  1WT1 A;  1LL2 A;  1OMX A;  1LZ0 A;  4KT7 A;  2RJ8 A;  3CKQ A;  2FYC B;  3ZGG A;  1ZJP A;  5C3B A;  3OH3 A;  5C1G A;  3N9W A;  3Q4S A;  2V0K A;  2VSI A;  3T7M A;  1VM8 A;  1GWW A;  3U0Y A;  2YCM A;  3E25 A;  2AM5 A;  2WGZ A;  4KPZ A;  2Y6P A;  5L6S A;  1H5S C;  4D0Z A;  4FRO A;  5D91 A;  3RMW A;  2WEE A;  3ZF8 A;  1FRW A;  2RIX A;  2VS5 A;  3U2V A;  1FO8 A;  1VZU A;  2P73 A;  1OQM B;  1G23 A;  5CQP A;  2E3D A;  1H5R A;  2PA4 A;  1G9R A;  1H7H A;  1G2V A;  1S4N A;  1HV9 A;  4KC1 A;  3T7O A;  4G3P A;  2Y4M A;  2W0V A;  1TW1 A;  4B2X A;  1K4V A;  4MND A;  5C4E A;  1PZY B;  1NHE B;  1VIC A;  1I52 A;  1H7T A;  1NKH B;  2VD4 A;  5HS2 A;  2O1F A;  1ZCT A;  3R2W A;  2AEC A;  1V82 A;  5C4F A;  1MP4 A;  1LZI A;  1EZI A;  2BO6 A;  2JCJ A;  1WT2 A;  3F1C A;  3FOQ A;  4MIX A;  4G3Q A;  2RJ0 A;  4FIY A;  4FQW A;  2JCK A;  5C8R A;  5C3A A;  2VFZ A;  2C0N A;  1H7L A;  4ZDQ A;  3QVB A;  5FU0 A;  1FXJ A;  3RSB A;  1NMM B;  4FRM A;  2X5S A;  1ZHJ A;  2X60 A;  1YRO B;  1WT0 A;  5FU8 A;  1R82 A;  1JVD A;  2O1G A;  2V0J A;  2RIZ A;  1YP3 A;  1VGZ A;  2APC A;  2BO8 A;  3O3P A;  1H5S A;  4O6M A;  5AJN A;  5C4C A;  4HO9 A;  1MP5 A;  1GQ9 A;  4J18 A;  2MZB A;  2J0A A;  4ECM A;  4UEG A;  5C47 A;  4Q7C A;  1IIN A;  3NGW A;  3BCV A;  2D7I A;  1FR9 A;  4Y7F A;  4EE5 A;  2O1H A;  4HO6 A;  2YQJ A;  2Y7A A;  4BQH A;  1TVY A;  2RIT A;  5FYE A;  4M2B A;  2YES A;  1G0R A;  2FFU A;  4HO8 A;  1HJJ A;  2WVL A;  1HM0 A;  2UX8 A;  5CMH A;  2V0L A;  2RJ4 A;  1VH3 A;  1O23 B;  2XWL A;  5CQN X;  4NAK A;  4DE7 A;  4KC4 A;  3V0Q A;  3V8Y A;  2PGV A;  3USQ A;  5C3D A;  1H5T B;  2AE7 A;  1G1L A;  1FGX A;  4Y7U A;  3V91 A;  2I7B A;  4EEO A;  1FWY A;  1ZDG A;  4DEC A;  1S4O A;  1QGS A;  1S4P A;  2RIY A;  1R81 A;  1VGT A;  2VXL A;  3V0O A;  2V0H A;  1ZCY A;  2CU2 A;  3PKQ A;  1LZJ A;  4GBP A;  4CJC A;  1ZI5 A;  5IDT A;  1XHB A;  3PNN A;  3SXD A;  1GWV A;  3TZT A;  1ZJ3 A;  1LVW A;  1W57 A;  2WVM A;  5CMJ A;  1YP2 A;  2AH9 A;  2DPW A;  1O7O A;  2RJ9 A;  1ZJO A;  1YP4 A;  4EEA A;  4FCU A;  1FG5 N;  4BMA A;  1LL0 A;  2YQH A;  4D0T A;  2ICY A;  3OH4 A;  2A8W A;  3Q7U A;  3I0F A;  2OEG A;  4B4B A;  3OH1 A;  3SX8 A;  1JV1 A;  4O6N A;  4M4K A;  4AAW A;  1W55 A;  5C36 A;  3EE5 A;  3IOI A;  2QKX A;  1WSZ A;  2W0W A;  3I0H A;  1ZI1 A;  4M2A A;  2P6W A;  4Y6N A;  5CQL X;  1R7X A;  2RJ6 A;  4K6R A;  3PKP A;  4R7P A;  4KQL A;  1ZDF A;  5C48 A;  5FTS A;  1PZT A;  4FRE A;  4FRH A;  4D11 A;  1H3M A;  4IRP A;  4Y7T A;  4AYL A;  3OGZ A;  2WVK A;  2RJ5 A;  3U2W A;  4EEG A;  4B5B A;  2YC3 A;  4Y6U A;  2FYD B;  2XWM A;  4FIX A;  2VSH A;  1H5R B;  3V0L A;  1H4E A;  1JVG A;  4FRD A;  2ICX A;  3OH2 A;  1QWJ A;  1V84 A;  4ARW A;  4B2W A;  4Y9X A;  4HO4 A;  1ZI3 A;  2D0J A;  3KIA A;  1G8O A;  3K8D A;  3Q80 A; 
#chains in the Genus database with same CATH homology
 3GUE A;  4D48 A;  1FGG A;  2QH5 A;  2AGD A;  3I0L A;  3ZLL A;  4MYB A;  5CQO A;  1FOA A;  3JUK A;  2AES A;  3V8Z A;  3CU0 A;  2AM4 A;  1H7E A;  2VS3 A;  2PGY A;  2PX7 A;  2RJ7 A;  4HO0 A;  4ASY A;  5L6V A;  3SXE A;  3USR A;  5I1F A;  4FRQ A;  2Y4L A;  3I0G A;  4HO5 A;  3U0X A;  1G93 A;  3SX7 A;  1R7V A;  1ZJ0 A;  3BRK X;  5IFY A;  4P02 A;  4HO2 A;  5EIY A;  4CJB A;  3DK5 A;  1H5T A;  2D7R A;  2FYA A;  3CGX A;  1JV3 A;  5D92 A;  2YQS A;  4Y7G A;  4AC3 A;  1R7U A;  5C1L A;  2I5K A;  1H4D A;  1VZT A;  2OI5 A;  2X5Z A;  2ZU7 A;  2WAW A;  3ZLK A;  1G3L A;  3E26 A;  1H7F A;  1INJ A;  3SXA A;  4CVH A;  3V0P A;  1H5S B;  2FY7 A;  1FR8 A;  2ZU8 A;  1VZX A;  3U2X A;  2BO4 A;  2AM3 A;  4YS8 A;  2P72 A;  5EJ1 A;  1QG8 A;  4D11 C;  3V0M A;  3I0J A;  2Q4J A;  2OI7 A;  4KPX A;  1ZJ1 A;  3DUV A;  5C1H A;  2Y4K A;  2QGI A;  5IDS A;  5CMG X;  4Y64 A;  3ST8 A;  4DDZ A;  1SS9 A;  2XMH A;  1VGW A;  3I0I X;  3SX3 A;  4EEM A;  2OI6 A;  1G95 A;  1EYR A;  2FFV A;  3IOH A;  2OEF A;  2V0I A;  3I0C A;  4HCQ A;  1LL3 A;  4HG6 A;  3FWW A;  3RMV A;  5DDT A;  3OH0 A;  3I0K A;  4KNR A;  5FUH A;  4P00 A;  2BO7 A;  2YC5 A;  1V83 A;  4FRP A;  2XME A;  3OC9 A;  5J49 A;  1ZIZ A;  4NAN A;  3F1Y A;  2FYB A;  2WE9 A;  1GX0 A;  1HM9 A;  1IIM A;  2RJ1 A;  4ASJ A;  4JIS A;  3HL3 A;  1WT3 A;  1E5K A;  4LW6 A;  3U2U A;  4C2S A;  1O7Q A;  2NXV A;  4B3U A;  3I0D A;  4B4M A;  2ZU9 A;  1ZCU A;  3IOJ A;  2Z86 A;  1R7Y A;  5FTV A;  5CMI A;  1GX4 A;  4KC2 A;  5C38 A;  4FRL A;  4CJ8 A;  5BXC A;  5CQM X;  3CKN A;  5C49 A;  1ZI4 A;  3T7N A;  1NQI B;  4XWI A;  2YQC A;  1LZ7 A;  1XZ6 A;  4B4G A;  1VH1 A;  1HJL A;  4Y63 A;  1INI A;  2E8B A;  1H7G A;  1H4C A;  3JUJ A;  1H5S D;  3SXC A;  3JTJ A;  4M28 A;  4NAL A;  3SX5 A;  3POL A;  1Z90 A;  3V90 A;  1OMZ A;  1FO9 A;  2J0B A;  3D98 A;  3TQD A;  3SXG A;  3OAM A;  4Y7V A;  1O0R A;  5AJO A;  5C4D A;  3R3I A;  1GA8 A;  5CMF X;  3K8E A;  1NWG B;  1TW5 A;  2X65 A;  4LW3 A;  1R7T A;  2I5E A;  4IRQ A;  1HM8 A;  5JQQ A;  1VGU A;  3ZGF A;  5C4B A;  1ZCV A;  3D5N A;  5AJP A;  1FZW A;  1W77 A;  3SXB A;  2Y4J A;  4E1K A;  4FCE A;  3U2T A;  4NAI A;  4FRB A;  2Z87 A;  3CKO A;  4EE3 A;  4KXO A;  1MP3 A;  1JYK A;  4EE4 A;  4EVW A;  5EJZ A;  1NF5 B;  2XWN A;  1R80 A;  4Y62 A;  1VPA A;  1FXO A;  1JYL A;  4B42 A;  3I0E A;  2JCL A;  4KRV A;  3V0N A;  4HO3 A;  1MC3 A;  4L41 C;  1TZF A;  5FV9 A;  2A8U A;  2VS4 A;  1G97 A;  3D8V A;  2GGO A;  4G3S A;  3CKJ A;  4AYJ A;  4G87 A;  2VXM A;  1QGQ A;  4HOC A;  4JD0 A;  3DJ4 A;  3SPT A;  1ON8 A;  2GGQ A;  3LW6 A;  2VK9 A;  3OKR A;  3CKV A;  1WVC A;  2JCO A;  1ZJ2 A;  1KWS A;  1H7Q A;  5DDV A;  1GQC A;  4FRA A;  1ON6 A;  4KNX A;  1WT1 A;  1LL2 A;  1OMX A;  1LZ0 A;  4KT7 A;  2RJ8 A;  3CKQ A;  2FYC B;  3ZGG A;  1ZJP A;  5C3B A;  3OH3 A;  5C1G A;  3N9W A;  3Q4S A;  2V0K A;  2VSI A;  3T7M A;  1VM8 A;  1GWW A;  3U0Y A;  2YCM A;  3E25 A;  2AM5 A;  2WGZ A;  4KPZ A;  2Y6P A;  5L6S A;  1H5S C;  4D0Z A;  4FRO A;  5D91 A;  3RMW A;  2WEE A;  3ZF8 A;  1FRW A;  2RIX A;  2VS5 A;  3U2V A;  1FO8 A;  1VZU A;  2P73 A;  1OQM B;  1G23 A;  5CQP A;  2E3D A;  1H5R A;  2PA4 A;  1G9R A;  1H7H A;  1G2V A;  1S4N A;  1HV9 A;  4KC1 A;  3T7O A;  4G3P A;  2Y4M A;  2W0V A;  1TW1 A;  4B2X A;  1K4V A;  4MND A;  5C4E A;  1PZY B;  1NHE B;  1VIC A;  1I52 A;  1H7T A;  1NKH B;  2VD4 A;  5HS2 A;  2O1F A;  1ZCT A;  3R2W A;  2AEC A;  1V82 A;  5C4F A;  1MP4 A;  1LZI A;  1EZI A;  2BO6 A;  2JCJ A;  1WT2 A;  3F1C A;  3FOQ A;  4MIX A;  4G3Q A;  2RJ0 A;  4FIY A;  4FQW A;  2JCK A;  5C8R A;  5C3A A;  2VFZ A;  2C0N A;  1H7L A;  4ZDQ A;  3QVB A;  5FU0 A;  1FXJ A;  3RSB A;  1NMM B;  4FRM A;  2X5S A;  1ZHJ A;  2X60 A;  1YRO B;  1WT0 A;  5FU8 A;  1R82 A;  1JVD A;  2O1G A;  2V0J A;  2RIZ A;  1YP3 A;  1VGZ A;  2APC A;  2BO8 A;  3O3P A;  1H5S A;  4O6M A;  5AJN A;  5C4C A;  4HO9 A;  1MP5 A;  1GQ9 A;  4J18 A;  2MZB A;  2J0A A;  4ECM A;  4UEG A;  5C47 A;  4Q7C A;  1IIN A;  3NGW A;  3BCV A;  2D7I A;  1FR9 A;  4Y7F A;  4EE5 A;  2O1H A;  4HO6 A;  2YQJ A;  2Y7A A;  4BQH A;  1TVY A;  2RIT A;  5FYE A;  4M2B A;  2YES A;  1G0R A;  2FFU A;  4HO8 A;  1HJJ A;  2WVL A;  1HM0 A;  2UX8 A;  5CMH A;  2V0L A;  2RJ4 A;  1VH3 A;  1O23 B;  2XWL A;  5CQN X;  4NAK A;  4DE7 A;  4KC4 A;  3V0Q A;  3V8Y A;  2PGV A;  3USQ A;  5C3D A;  1H5T B;  2AE7 A;  1G1L A;  1FGX A;  4Y7U A;  3V91 A;  2I7B A;  4EEO A;  1FWY A;  1ZDG A;  4DEC A;  1S4O A;  1QGS A;  1S4P A;  2RIY A;  1R81 A;  1VGT A;  2VXL A;  3V0O A;  2V0H A;  1ZCY A;  2CU2 A;  3PKQ A;  1LZJ A;  4GBP A;  4CJC A;  1ZI5 A;  5IDT A;  1XHB A;  3PNN A;  3SXD A;  1GWV A;  3TZT A;  1ZJ3 A;  1LVW A;  1W57 A;  2WVM A;  5CMJ A;  1YP2 A;  2AH9 A;  2DPW A;  1O7O A;  2RJ9 A;  1ZJO A;  1YP4 A;  4EEA A;  4FCU A;  1FG5 N;  4BMA A;  1LL0 A;  2YQH A;  4D0T A;  2ICY A;  3OH4 A;  2A8W A;  3Q7U A;  3I0F A;  2OEG A;  4B4B A;  3OH1 A;  3SX8 A;  1JV1 A;  4O6N A;  4M4K A;  4AAW A;  1W55 A;  5C36 A;  3EE5 A;  3IOI A;  2QKX A;  1WSZ A;  2W0W A;  3I0H A;  1ZI1 A;  4M2A A;  2P6W A;  4Y6N A;  5CQL X;  1R7X A;  2RJ6 A;  4K6R A;  3PKP A;  4R7P A;  4KQL A;  1ZDF A;  5C48 A;  5FTS A;  1PZT A;  4FRE A;  4FRH A;  4D11 A;  1H3M A;  4IRP A;  4Y7T A;  4AYL A;  3OGZ A;  2WVK A;  2RJ5 A;  3U2W A;  4EEG A;  4B5B A;  2YC3 A;  4Y6U A;  2FYD B;  2XWM A;  4FIX A;  2VSH A;  1H5R B;  3V0L A;  1H4E A;  1JVG A;  4FRD A;  2ICX A;  3OH2 A;  1QWJ A;  1V84 A;  4ARW A;  4B2W A;  4Y9X A;  4HO4 A;  1ZI3 A;  2D0J A;  3KIA A;  1G8O A;  3K8D A;  3Q80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...