3U2XA

Crystal structure of human glycogenin-1 (gyg1) complexed with manganese, udp and 1'-deoxyglucose
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
263
structure length
263
Chain Sequence
SMTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHPEFLILWWNIFTTNVLPLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycogenin-1
publication title Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP and 1'-deoxyglucose
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2011-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3u2xA00
1NWGB 3K8EA 4HO6A 3SXEA 3TQDA 4Y6UA 2P6WA 1V83A 4B2WA 3D5NA 1JYKA 2VS5A 3OH1A 4KXOA 3JTJA 2JCKA 4KPZA 1Z90A 1YP4A 3SX7A 4Y62A 2YESA 3I0CA 1G93A 3KIAA 4B5BA 4HO2A 3U2UA 1O7OA 2X5ZA 3FOQA 4Y7UA 4Y64A 4EVWA 3V8ZA 2W0WA 1ZJPA 2V0JA 4FRPA 1WT3A 4HOCA 2Y4MA 4Y9XA 5HS2A 4ASJA 2AE7A 2DPWA 3QVBA 4HG6A 3TZTA 2VXMA 3USQA 3PKQA 3T7MA 3DUVA 2X65A 1H5SB 1OMZA 4EE5A 1WSZA 2Z86A 1GQCA 1YP3A 1O0RA 1R82A 4K6RA 1H3MA 2OEFA 2RJ6A 1LL2A 2RJ7A 3Q4SA 4CJBA 4KRVA 2JCJA 2BO7A 4EE3A 1QGQA 2WE9A 2V0IA 4B2XA 3E25A 2VSHA 5C3DA 3BCVA 1QGSA 3NGWA 5CMGX 1VZTA 1ZCYA 3E26A 4B4GA 1ZI3A 2E3DA 3I0HA 1QWJA 3DK5A 5C4EA 5C48A 3RSBA 3PNNA 4M2AA 2D7IA 5AJPA 1W55A 3ZF8A 1G2VA 1YP2A 2ICXA 3SXDA 3OH4A 1R7TA 2RJ9A 4M2BA 1I52A 1VPAA 1S4NA 2WGZA 5DDTA 2AESA 4EEOA 5BXCA 2W0VA 1FR9A 2MZBA 2RITA 5C8RA 1WT1A 3ZLKA 1VM8A 2QGIA 3CKJA 4LW6A 2OEGA 4CVHA 4JISA 1G95A 1LVWA 4L41C 3OH0A 3SPTA 4HCQA 4IRQA 3U0XA 1LL0A 1TW1A 1WT2A 5CMIA 3EE5A 4AYJA 5C4CA 4BQHA 1JYLA 3FWWA 1H5SD 5EIYA 1H5RB 2YQCA 4G3SA 2Y7AA 2RJ1A 5IDTA 4YS8A 2WAWA 1GA8A 1K4VA 1WVCA 2ZU7A 1ON8A 3POLA 1O7QA 1OMXA 4M4KA 2O1HA 2X5SA 4EEAA 1HM9A 1H4DA 3N9WA 1VZXA 3OAMA 3OGZA 1TVYA 2AM4A 4DECA 3OC9A 2VFZA 3CU0A 1LZJA 5I1FA 2D7RA 3V0QA 1ZJOA 5IDSA 1FO8A 3V90A 5J49A 2YQSA 2AM5A 1HJJA 1LZ7A 3JUKA 1TW5A 1IIMA 1G3LA 3I0DA 1VZUA 4HO4A 1ZI4A 1XZ6A 3SXGA 1ZJ0A 3JUJA 4ZDQA 2RIXA 4FRAA 5C1HA 3SX8A 1IINA 1ZI5A 2A8WA 4MNDA 5JQQA 3CKNA 4KPXA 1HV9A 5FU8A 5C4DA 2Q4JA 1VH1A 2WEEA 2FFUA 1GWWA 3DJ4A 2RJ4A 4DDZA 5FTSA 2WVLA 3GUEA 2PGYA 4D11A 5CMHA 1FOAA 1G8OA 2ICYA 3I0JA 5C3AA 1ZDGA 5C1GA 2V0LA 1SS9A 2ZU8A 1FR8A 2XMHA 5CMFX 4B42A 4KC2A 2E8BA 5C38A 1EZIA 2A8UA 2OI5A 4MYBA 4EEGA 3RMWA 1LZIA 1H5SA 4CJCA 4ASYA 5AJOA 5FTVA 2AECA 2YQJA 2UX8A 4J18A 1FGGA 1G0RA 5EJ1A 5IFYA 1GWVA 5DDVA 3U2WA 1INIA 2YCMA 4UEGA 4BMAA 1KWSA 3I0LA 1H7TA 4HO5A 4G3QA 3D8VA 1ZDFA 3U2VA 3ZLLA 1FRWA 1H7EA 5C47A 1JVGA 2FYBA 4XWIA 3T7OA 1VGWA 2VSIA 4FQWA 1LZ0A 1PZYB 4D48A 3CGXA 1R80A 5C3BA 3HL3A 3SXCA 1INJA 1G1LA 2RIZA 3ZGFA 2YQHA 3I0FA 2FYAA 4B3UA 2VXLA 1GX4A 4FREA 3SX3A 1LL3A 3V0PA 4KQLA 4AC3A 3OH3A 1ZJ2A 1MC3A 2AGDA 2P73A 1FGXA 3U2TA 1H7GA 1H5TB 2FY7A 1EYRA 4KNXA 2I5EA 5FU0A 2BO8A 2O1GA 1E5KA 2GGOA 2PX7A 2P72A 2YC5A 3I0GA 5AJNA 2GGQA 2BO6A 3I0EA 1WT0A 2XWMA 1G23A 4HO3A 5CMJA 1R7UA 2RJ0A 1H5RA 4FRMA 4ECMA 3T7NA 2NXVA 5FV9A 2VS3A 1VGUA 2ZU9A 3LW6A 4Y7FA 1R81A 4Y63A 5EJZA 2RJ5A 1FZWA 1ZJ3A 2V0KA 1PZTA 3F1YA 3IOHA 4FCEA 2FYCB 1H4EA 3ZGGA 2AH9A 3Q7UA 1FG5N 5C36A 4C2SA 3IOIA 2FYDB 4E1KA 4IRPA 4LW3A 1ZJ1A 4D0ZA 4NAKA 4FRBA 1HM8A 1TZFA 1H7LA 4B4BA 5FUHA 4Y7VA 5CQPA 4P02A 2WVMA 3USRA 1S4OA 1VH3A 1XHBA 2WVKA 4Y6NA 4DE7A 3U0YA 3OKRA 1GQ9A 2I7BA 4FRLA 3Q80A 4AAWA 3OH2A 3PKPA 3BRKX 1R7XA 1YROB 2XWLA 2RIYA 1JVDA 3V8YA 1V82A 1ZCTA 2XWNA 1VGZA 4R7PA 1NQIB 3F1CA 1W77A 2PGVA 5FYEA 1MP5A 1R7VA 4HO0A 3SXAA 3V0NA 1QG8A 3R2WA 3U2XA 1ZCVA 4FCUA 4NALA 1NMMB 4FRHA 4B4MA 2Y4LA 4KNRA 4FRDA 1FXJA 4CJ8A 1H7FA 3RMVA 4KT7A 2BO4A 3O3PA 1H7QA 3V91A 1HM0A 4FRQA 2Y4KA 3I0KA 2VS4A 1VICA 2XMEA 1MP3A 1ZCUA 2V0HA 1W57A 2APCA 2JCOA 1FO9A 1ON6A 1V84A 1NKHB 5C49A 1GX0A 3CKVA 4GBPA 4KC1A 3V0LA 2X60A 3CKOA 2OI7A 2YC3A 4D11C 1NF5B 3CKQA 4Y7TA 5C1LA 1ZHJA 5CQLX 3D98A 2D0JA 4G87A 1ZI1A 4HO8A 1G97A 1OQMB 4FROA 3I0IX 3V0MA 3SXBA 2CU2A 1FXOA 4HO9A 4Y7GA 3ST8A 1R7YA 3SX5A 4NANA 3V0OA 4P00A 1H5SC 2Y6PA 5CQOA 4JD0A 1NHEB 5CQNX 1S4PA 1JV3A 4KC4A 1ZIZA 5CQMX 3K8DA 2PA4A 1H7HA 4ARWA 1G9RA 4G3PA 4EE4A 5C4FA 3IOJA 4AYLA 4EEMA 2RJ8A 5L6VA 4NAIA 3R3IA 4M28A 2Y4JA 2Z87A 2OI6A 1HJLA 5L6SA 1MP4A 1JV1A 1FWYA 5C4BA 2I5KA 2O1FA 2QH5A 2FFVA 2JCLA 2AM3A 1H5TA 2VD4A 1O23B 4D0TA 1VGTA 2QKXA 1H4CA
chains in the Genus database with same CATH superfamily
1NWGB 3K8EA 4HO6A 3SXEA 3TQDA 4Y6UA 2P6WA 1V83A 4B2WA 3D5NA 1JYKA 2VS5A 3OH1A 4KXOA 3JTJA 2JCKA 4KPZA 1Z90A 2J0BA 1YP4A 3SX7A 4Y62A 2YESA 3I0CA 1G93A 3KIAA 4B5BA 4HO2A 3U2UA 1O7OA 2X5ZA 3FOQA 4Y7UA 4Y64A 4EVWA 3V8ZA 2W0WA 1ZJPA 2V0JA 4FRPA 1WT3A 4HOCA 2Y4MA 4Y9XA 5HS2A 4ASJA 2AE7A 2DPWA 3QVBA 4HG6A 3TZTA 2VXMA 3USQA 3PKQA 3T7MA 3DUVA 2X65A 1H5SB 1OMZA 2VK9A 4EE5A 1WSZA 2Z86A 1GQCA 1YP3A 1O0RA 1R82A 4K6RA 1H3MA 2OEFA 2RJ6A 1LL2A 2RJ7A 3Q4SA 4CJBA 4KRVA 2JCJA 2BO7A 4EE3A 1QGQA 2WE9A 2V0IA 4B2XA 3E25A 2VSHA 5C3DA 3BCVA 1QGSA 3NGWA 5CMGX 1VZTA 1ZCYA 3E26A 4B4GA 4O6MA 1ZI3A 2E3DA 3I0HA 1QWJA 3DK5A 5C4EA 5C48A 3RSBA 3PNNA 4M2AA 2D7IA 5AJPA 1W55A 3ZF8A 1G2VA 1YP2A 2ICXA 3SXDA 3OH4A 1R7TA 2RJ9A 4M2BA 1I52A 1VPAA 1S4NA 2WGZA 5DDTA 2AESA 4EEOA 5BXCA 2W0VA 1FR9A 2MZBA 2RITA 5C8RA 1WT1A 3ZLKA 1VM8A 2QGIA 3CKJA 4LW6A 2OEGA 4CVHA 4JISA 2C0NA 1G95A 2J0AA 1LVWA 4L41C 3OH0A 3SPTA 4HCQA 4IRQA 3U0XA 1LL0A 1TW1A 1WT2A 5CMIA 5D92A 3EE5A 4AYJA 5C4CA 4BQHA 1JYLA 3FWWA 1H5SD 5EIYA 1H5RB 2YQCA 4G3SA 2Y7AA 2RJ1A 5IDTA 4YS8A 2WAWA 1GA8A 1K4VA 1WVCA 2ZU7A 1ON8A 3POLA 1O7QA 1OMXA 4M4KA 2O1HA 2X5SA 4EEAA 1HM9A 1H4DA 3N9WA 1VZXA 3OAMA 3OGZA 1TVYA 2AM4A 4DECA 3OC9A 2VFZA 3CU0A 1LZJA 5I1FA 2D7RA 4MIXA 3V0QA 1ZJOA 5IDSA 1FO8A 3V90A 5J49A 2YQSA 2AM5A 1HJJA 1LZ7A 3JUKA 1TW5A 1IIMA 1G3LA 3I0DA 1VZUA 4HO4A 1ZI4A 1XZ6A 3SXGA 1ZJ0A 3JUJA 4ZDQA 2RIXA 4FRAA 5C1HA 3SX8A 1IINA 1ZI5A 2A8WA 4MNDA 5JQQA 3CKNA 4KPXA 1HV9A 5FU8A 5C4DA 2Q4JA 1VH1A 2WEEA 2FFUA 1GWWA 3DJ4A 2RJ4A 4DDZA 5FTSA 2WVLA 3GUEA 2PGYA 4D11A 5CMHA 1FOAA 1G8OA 2ICYA 3I0JA 5C3AA 1ZDGA 5C1GA 2V0LA 1SS9A 2ZU8A 1FR8A 2XMHA 5CMFX 4B42A 4KC2A 2E8BA 5C38A 1EZIA 2A8UA 2OI5A 4MYBA 4EEGA 4O6NA 3RMWA 1LZIA 1H5SA 4CJCA 4ASYA 5AJOA 5FTVA 2AECA 2YQJA 2UX8A 4J18A 1FGGA 1G0RA 5EJ1A 5IFYA 1GWVA 5DDVA 3U2WA 1INIA 2YCMA 4UEGA 4BMAA 1KWSA 3I0LA 1H7TA 4HO5A 4G3QA 3D8VA 1ZDFA 3U2VA 3ZLLA 1FRWA 1H7EA 5C47A 1JVGA 2FYBA 4XWIA 3T7OA 1VGWA 2VSIA 4FQWA 1LZ0A 1PZYB 4D48A 3CGXA 1R80A 5C3BA 3HL3A 3SXCA 1INJA 1G1LA 2RIZA 3ZGFA 2YQHA 3I0FA 2FYAA 4B3UA 2VXLA 1GX4A 4FREA 3SX3A 1LL3A 3V0PA 4KQLA 4AC3A 3OH3A 1ZJ2A 1MC3A 2AGDA 2P73A 1FGXA 3U2TA 1H7GA 1H5TB 2FY7A 1EYRA 4KNXA 2I5EA 5FU0A 2BO8A 2O1GA 1E5KA 2GGOA 2PX7A 2P72A 2YC5A 3I0GA 5AJNA 2GGQA 2BO6A 3I0EA 1WT0A 2XWMA 1G23A 4HO3A 5CMJA 1R7UA 2RJ0A 1H5RA 4FRMA 4ECMA 4Q7CA 3T7NA 2NXVA 5FV9A 2VS3A 1VGUA 2ZU9A 3LW6A 4Y7FA 1R81A 4Y63A 5EJZA 2RJ5A 1FZWA 1ZJ3A 2V0KA 1PZTA 3F1YA 3IOHA 4FCEA 2FYCB 1H4EA 3ZGGA 2AH9A 3Q7UA 1FG5N 5C36A 4C2SA 3IOIA 2FYDB 4E1KA 4IRPA 4LW3A 1ZJ1A 4D0ZA 4NAKA 4FRBA 1HM8A 1TZFA 1H7LA 4B4BA 5FUHA 4Y7VA 5CQPA 4P02A 2WVMA 3USRA 1S4OA 1VH3A 1XHBA 2WVKA 5D91A 4Y6NA 4DE7A 3U0YA 3OKRA 1GQ9A 2I7BA 4FRLA 3Q80A 4AAWA 3OH2A 3PKPA 3BRKX 1R7XA 1YROB 2XWLA 2RIYA 1JVDA 3V8YA 1V82A 1ZCTA 2XWNA 1VGZA 4R7PA 1NQIB 3F1CA 1W77A 2PGVA 5FYEA 1MP5A 1R7VA 4HO0A 3SXAA 3V0NA 1QG8A 3R2WA 3U2XA 1ZCVA 4FCUA 4NALA 1NMMB 4FRHA 4B4MA 2Y4LA 4KNRA 4FRDA 1FXJA 4CJ8A 1H7FA 3RMVA 4KT7A 2BO4A 3O3PA 1H7QA 3V91A 1HM0A 4FRQA 2Y4KA 3I0KA 2VS4A 1VICA 2XMEA 1MP3A 1ZCUA 2V0HA 1W57A 2APCA 2JCOA 1FO9A 1ON6A 1V84A 1NKHB 5C49A 1GX0A 3CKVA 4GBPA 4KC1A 3V0LA 2X60A 3CKOA 2OI7A 2YC3A 4D11C 1NF5B 3CKQA 4Y7TA 5C1LA 1ZHJA 5CQLX 3D98A 2D0JA 4G87A 1ZI1A 4HO8A 1G97A 1OQMB 4FROA 3I0IX 3V0MA 3SXBA 2CU2A 1FXOA 4HO9A 4Y7GA 3ST8A 1R7YA 3SX5A 4NANA 3V0OA 4P00A 1H5SC 2Y6PA 5CQOA 4JD0A 1NHEB 5CQNX 1S4PA 1JV3A 4KC4A 1ZIZA 5CQMX 3K8DA 2PA4A 1H7HA 4FIXA 4ARWA 1G9RA 4G3PA 4EE4A 5C4FA 3IOJA 4AYLA 4EEMA 2RJ8A 5L6VA 4NAIA 3R3IA 4FIYA 4M28A 2Y4JA 2Z87A 2OI6A 1HJLA 5L6SA 1MP4A 1JV1A 1FWYA 5C4BA 2I5KA 2O1FA 2QH5A 2FFVA 2JCLA 2AM3A 1H5TA 2VD4A 1O23B 4D0TA 1VGTA 2QKXA 1H4CA
chains in the Genus database with same CATH topology
1NWGB 3K8EA 4HO6A 3SXEA 3TQDA 4Y6UA 2P6WA 1V83A 4B2WA 3D5NA 1JYKA 2VS5A 3OH1A 4KXOA 3JTJA 2JCKA 4KPZA 1Z90A 2J0BA 1YP4A 3SX7A 4Y62A 2YESA 3I0CA 1G93A 3KIAA 4B5BA 4HO2A 3U2UA 1O7OA 2X5ZA 3FOQA 4Y7UA 4Y64A 4EVWA 3V8ZA 2W0WA 1ZJPA 2V0JA 4FRPA 1WT3A 4HOCA 2Y4MA 4Y9XA 5HS2A 4ASJA 2AE7A 2DPWA 3QVBA 4HG6A 3TZTA 2VXMA 3USQA 3PKQA 3T7MA 3DUVA 2X65A 1H5SB 1OMZA 2VK9A 4EE5A 1WSZA 2Z86A 1GQCA 1YP3A 1O0RA 1R82A 4K6RA 1H3MA 2OEFA 2RJ6A 1LL2A 2RJ7A 3Q4SA 4CJBA 4KRVA 2JCJA 2BO7A 4EE3A 1QGQA 2WE9A 2V0IA 4B2XA 3E25A 2VSHA 5C3DA 3BCVA 1QGSA 3NGWA 5CMGX 1VZTA 1ZCYA 3E26A 4B4GA 4O6MA 1ZI3A 2E3DA 3I0HA 1QWJA 3DK5A 5C4EA 5C48A 3RSBA 3PNNA 4M2AA 2D7IA 5AJPA 1W55A 3ZF8A 1G2VA 1YP2A 2ICXA 3SXDA 3OH4A 1R7TA 2RJ9A 4M2BA 1I52A 1VPAA 1S4NA 2WGZA 5DDTA 2AESA 4EEOA 5BXCA 2W0VA 1FR9A 2MZBA 2RITA 5C8RA 1WT1A 3ZLKA 1VM8A 2QGIA 3CKJA 4LW6A 2OEGA 4CVHA 4JISA 2C0NA 1G95A 2J0AA 1LVWA 4L41C 3OH0A 3SPTA 4HCQA 4IRQA 3U0XA 1LL0A 1TW1A 1WT2A 5CMIA 5D92A 3EE5A 4AYJA 5C4CA 4BQHA 1JYLA 3FWWA 1H5SD 5EIYA 1H5RB 2YQCA 4G3SA 2Y7AA 2RJ1A 5IDTA 4YS8A 2WAWA 1GA8A 1K4VA 1WVCA 2ZU7A 1ON8A 3POLA 1O7QA 1OMXA 4M4KA 2O1HA 2X5SA 4EEAA 1HM9A 1H4DA 3N9WA 1VZXA 3OAMA 3OGZA 1TVYA 2AM4A 4DECA 3OC9A 2VFZA 3CU0A 1LZJA 5I1FA 2D7RA 4MIXA 3V0QA 1ZJOA 5IDSA 1FO8A 3V90A 5J49A 2YQSA 2AM5A 1HJJA 1LZ7A 3JUKA 1TW5A 1IIMA 1G3LA 3I0DA 1VZUA 4HO4A 1ZI4A 1XZ6A 3SXGA 1ZJ0A 3JUJA 4ZDQA 2RIXA 4FRAA 5C1HA 3SX8A 1IINA 1ZI5A 2A8WA 4MNDA 5JQQA 3CKNA 4KPXA 1HV9A 5FU8A 5C4DA 2Q4JA 1VH1A 2WEEA 2FFUA 1GWWA 3DJ4A 2RJ4A 4DDZA 5FTSA 2WVLA 3GUEA 2PGYA 4D11A 5CMHA 1FOAA 1G8OA 2ICYA 3I0JA 5C3AA 1ZDGA 5C1GA 2V0LA 1SS9A 2ZU8A 1FR8A 2XMHA 5CMFX 4B42A 4KC2A 2E8BA 5C38A 1EZIA 2A8UA 2OI5A 4MYBA 4EEGA 4O6NA 3RMWA 1LZIA 1H5SA 4CJCA 4ASYA 5AJOA 5FTVA 2AECA 2YQJA 2UX8A 4J18A 1FGGA 1G0RA 5EJ1A 5IFYA 1GWVA 5DDVA 3U2WA 1INIA 2YCMA 4UEGA 4BMAA 1KWSA 3I0LA 1H7TA 4HO5A 4G3QA 3D8VA 1ZDFA 3U2VA 3ZLLA 1FRWA 1H7EA 5C47A 1JVGA 2FYBA 4XWIA 3T7OA 1VGWA 2VSIA 4FQWA 1LZ0A 1PZYB 4D48A 3CGXA 1R80A 5C3BA 3HL3A 3SXCA 1INJA 1G1LA 2RIZA 3ZGFA 2YQHA 3I0FA 2FYAA 4B3UA 2VXLA 1GX4A 4FREA 3SX3A 1LL3A 3V0PA 4KQLA 4AC3A 3OH3A 1ZJ2A 1MC3A 2AGDA 2P73A 1FGXA 3U2TA 1H7GA 1H5TB 2FY7A 1EYRA 4KNXA 2I5EA 5FU0A 2BO8A 2O1GA 1E5KA 2GGOA 2PX7A 2P72A 2YC5A 3I0GA 5AJNA 2GGQA 2BO6A 3I0EA 1WT0A 2XWMA 1G23A 4HO3A 5CMJA 1R7UA 2RJ0A 1H5RA 4FRMA 4ECMA 4Q7CA 3T7NA 2NXVA 5FV9A 2VS3A 1VGUA 2ZU9A 3LW6A 4Y7FA 1R81A 4Y63A 5EJZA 2RJ5A 1FZWA 1ZJ3A 2V0KA 1PZTA 3F1YA 3IOHA 4FCEA 2FYCB 1H4EA 3ZGGA 2AH9A 3Q7UA 1FG5N 5C36A 4C2SA 3IOIA 2FYDB 4E1KA 4IRPA 4LW3A 1ZJ1A 4D0ZA 4NAKA 4FRBA 1HM8A 1TZFA 1H7LA 4B4BA 5FUHA 4Y7VA 5CQPA 4P02A 2WVMA 3USRA 1S4OA 1VH3A 1XHBA 2WVKA 5D91A 4Y6NA 4DE7A 3U0YA 3OKRA 1GQ9A 2I7BA 4FRLA 3Q80A 4AAWA 3OH2A 3PKPA 3BRKX 1R7XA 1YROB 2XWLA 2RIYA 1JVDA 3V8YA 1V82A 1ZCTA 2XWNA 1VGZA 4R7PA 1NQIB 3F1CA 1W77A 2PGVA 5FYEA 1MP5A 1R7VA 4HO0A 3SXAA 3V0NA 1QG8A 3R2WA 3U2XA 1ZCVA 4FCUA 4NALA 1NMMB 4FRHA 4B4MA 2Y4LA 4KNRA 4FRDA 1FXJA 4CJ8A 1H7FA 3RMVA 4KT7A 2BO4A 3O3PA 1H7QA 3V91A 1HM0A 4FRQA 2Y4KA 3I0KA 2VS4A 1VICA 2XMEA 1MP3A 1ZCUA 2V0HA 1W57A 2APCA 2JCOA 1FO9A 1ON6A 1V84A 1NKHB 5C49A 1GX0A 3CKVA 4GBPA 4KC1A 3V0LA 2X60A 3CKOA 2OI7A 2YC3A 4D11C 1NF5B 3CKQA 4Y7TA 5C1LA 1ZHJA 5CQLX 3D98A 2D0JA 4G87A 1ZI1A 4HO8A 1G97A 1OQMB 4FROA 3I0IX 3V0MA 3SXBA 2CU2A 1FXOA 4HO9A 4Y7GA 3ST8A 1R7YA 3SX5A 4NANA 3V0OA 4P00A 1H5SC 2Y6PA 5CQOA 4JD0A 1NHEB 5CQNX 1S4PA 1JV3A 4KC4A 1ZIZA 5CQMX 3K8DA 2PA4A 1H7HA 4FIXA 4ARWA 1G9RA 4G3PA 4EE4A 5C4FA 3IOJA 4AYLA 4EEMA 2RJ8A 5L6VA 4NAIA 3R3IA 4FIYA 4M28A 2Y4JA 2Z87A 2OI6A 1HJLA 5L6SA 1MP4A 1JV1A 1FWYA 5C4BA 2I5KA 2O1FA 2QH5A 2FFVA 2JCLA 2AM3A 1H5TA 2VD4A 1O23B 4D0TA 1VGTA 2QKXA 1H4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NWG B;  3K8E A;  4HO6 A;  3SXE A;  3TQD A;  4Y6U A;  2P6W A;  1V83 A;  4B2W A;  3D5N A;  1JYK A;  2VS5 A;  3OH1 A;  4KXO A;  3JTJ A;  2JCK A;  4KPZ A;  1Z90 A;  1YP4 A;  3SX7 A;  4Y62 A;  2YES A;  3I0C A;  1G93 A;  3KIA A;  4B5B A;  4HO2 A;  3U2U A;  1O7O A;  2X5Z A;  3FOQ A;  4Y7U A;  4Y64 A;  4EVW A;  3V8Z A;  2W0W A;  1ZJP A;  2V0J A;  4FRP A;  1WT3 A;  4HOC A;  2Y4M A;  4Y9X A;  5HS2 A;  4ASJ A;  2AE7 A;  2DPW A;  3QVB A;  4HG6 A;  3TZT A;  2VXM A;  3USQ A;  3PKQ A;  3T7M A;  3DUV A;  2X65 A;  1H5S B;  1OMZ A;  4EE5 A;  1WSZ A;  2Z86 A;  1GQC A;  1YP3 A;  1O0R A;  1R82 A;  4K6R A;  1H3M A;  2OEF A;  2RJ6 A;  1LL2 A;  2RJ7 A;  3Q4S A;  4CJB A;  4KRV A;  2JCJ A;  2BO7 A;  4EE3 A;  1QGQ A;  2WE9 A;  2V0I A;  4B2X A;  3E25 A;  2VSH A;  5C3D A;  3BCV A;  1QGS A;  3NGW A;  5CMG X;  1VZT A;  1ZCY A;  3E26 A;  4B4G A;  1ZI3 A;  2E3D A;  3I0H A;  1QWJ A;  3DK5 A;  5C4E A;  5C48 A;  3RSB A;  3PNN A;  4M2A A;  2D7I A;  5AJP A;  1W55 A;  3ZF8 A;  1G2V A;  1YP2 A;  2ICX A;  3SXD A;  3OH4 A;  1R7T A;  2RJ9 A;  4M2B A;  1I52 A;  1VPA A;  1S4N A;  2WGZ A;  5DDT A;  2AES A;  4EEO A;  5BXC A;  2W0V A;  1FR9 A;  2MZB A;  2RIT A;  5C8R A;  1WT1 A;  3ZLK A;  1VM8 A;  2QGI A;  3CKJ A;  4LW6 A;  2OEG A;  4CVH A;  4JIS A;  1G95 A;  1LVW A;  4L41 C;  3OH0 A;  3SPT A;  4HCQ A;  4IRQ A;  3U0X A;  1LL0 A;  1TW1 A;  1WT2 A;  5CMI A;  3EE5 A;  4AYJ A;  5C4C A;  4BQH A;  1JYL A;  3FWW A;  1H5S D;  5EIY A;  1H5R B;  2YQC A;  4G3S A;  2Y7A A;  2RJ1 A;  5IDT A;  4YS8 A;  2WAW A;  1GA8 A;  1K4V A;  1WVC A;  2ZU7 A;  1ON8 A;  3POL A;  1O7Q A;  1OMX A;  4M4K A;  2O1H A;  2X5S A;  4EEA A;  1HM9 A;  1H4D A;  3N9W A;  1VZX A;  3OAM A;  3OGZ A;  1TVY A;  2AM4 A;  4DEC A;  3OC9 A;  2VFZ A;  3CU0 A;  1LZJ A;  5I1F A;  2D7R A;  3V0Q A;  1ZJO A;  5IDS A;  1FO8 A;  3V90 A;  5J49 A;  2YQS A;  2AM5 A;  1HJJ A;  1LZ7 A;  3JUK A;  1TW5 A;  1IIM A;  1G3L A;  3I0D A;  1VZU A;  4HO4 A;  1ZI4 A;  1XZ6 A;  3SXG A;  1ZJ0 A;  3JUJ A;  4ZDQ A;  2RIX A;  4FRA A;  5C1H A;  3SX8 A;  1IIN A;  1ZI5 A;  2A8W A;  4MND A;  5JQQ A;  3CKN A;  4KPX A;  1HV9 A;  5FU8 A;  5C4D A;  2Q4J A;  1VH1 A;  2WEE A;  2FFU A;  1GWW A;  3DJ4 A;  2RJ4 A;  4DDZ A;  5FTS A;  2WVL A;  3GUE A;  2PGY A;  4D11 A;  5CMH A;  1FOA A;  1G8O A;  2ICY A;  3I0J A;  5C3A A;  1ZDG A;  5C1G A;  2V0L A;  1SS9 A;  2ZU8 A;  1FR8 A;  2XMH A;  5CMF X;  4B42 A;  4KC2 A;  2E8B A;  5C38 A;  1EZI A;  2A8U A;  2OI5 A;  4MYB A;  4EEG A;  3RMW A;  1LZI A;  1H5S A;  4CJC A;  4ASY A;  5AJO A;  5FTV A;  2AEC A;  2YQJ A;  2UX8 A;  4J18 A;  1FGG A;  1G0R A;  5EJ1 A;  5IFY A;  1GWV A;  5DDV A;  3U2W A;  1INI A;  2YCM A;  4UEG A;  4BMA A;  1KWS A;  3I0L A;  1H7T A;  4HO5 A;  4G3Q A;  3D8V A;  1ZDF A;  3U2V A;  3ZLL A;  1FRW A;  1H7E A;  5C47 A;  1JVG A;  2FYB A;  4XWI A;  3T7O A;  1VGW A;  2VSI A;  4FQW A;  1LZ0 A;  1PZY B;  4D48 A;  3CGX A;  1R80 A;  5C3B A;  3HL3 A;  3SXC A;  1INJ A;  1G1L A;  2RIZ A;  3ZGF A;  2YQH A;  3I0F A;  2FYA A;  4B3U A;  2VXL A;  1GX4 A;  4FRE A;  3SX3 A;  1LL3 A;  3V0P A;  4KQL A;  4AC3 A;  3OH3 A;  1ZJ2 A;  1MC3 A;  2AGD A;  2P73 A;  1FGX A;  3U2T A;  1H7G A;  1H5T B;  2FY7 A;  1EYR A;  4KNX A;  2I5E A;  5FU0 A;  2BO8 A;  2O1G A;  1E5K A;  2GGO A;  2PX7 A;  2P72 A;  2YC5 A;  3I0G A;  5AJN A;  2GGQ A;  2BO6 A;  3I0E A;  1WT0 A;  2XWM A;  1G23 A;  4HO3 A;  5CMJ A;  1R7U A;  2RJ0 A;  1H5R A;  4FRM A;  4ECM A;  3T7N A;  2NXV A;  5FV9 A;  2VS3 A;  1VGU A;  2ZU9 A;  3LW6 A;  4Y7F A;  1R81 A;  4Y63 A;  5EJZ A;  2RJ5 A;  1FZW A;  1ZJ3 A;  2V0K A;  1PZT A;  3F1Y A;  3IOH A;  4FCE A;  2FYC B;  1H4E A;  3ZGG A;  2AH9 A;  3Q7U A;  1FG5 N;  5C36 A;  4C2S A;  3IOI A;  2FYD B;  4E1K A;  4IRP A;  4LW3 A;  1ZJ1 A;  4D0Z A;  4NAK A;  4FRB A;  1HM8 A;  1TZF A;  1H7L A;  4B4B A;  5FUH A;  4Y7V A;  5CQP A;  4P02 A;  2WVM A;  3USR A;  1S4O A;  1VH3 A;  1XHB A;  2WVK A;  4Y6N A;  4DE7 A;  3U0Y A;  3OKR A;  1GQ9 A;  2I7B A;  4FRL A;  3Q80 A;  4AAW A;  3OH2 A;  3PKP A;  3BRK X;  1R7X A;  1YRO B;  2XWL A;  2RIY A;  1JVD A;  3V8Y A;  1V82 A;  1ZCT A;  2XWN A;  1VGZ A;  4R7P A;  1NQI B;  3F1C A;  1W77 A;  2PGV A;  5FYE A;  1MP5 A;  1R7V A;  4HO0 A;  3SXA A;  3V0N A;  1QG8 A;  3R2W A;  3U2X A;  1ZCV A;  4FCU A;  4NAL A;  1NMM B;  4FRH A;  4B4M A;  2Y4L A;  4KNR A;  4FRD A;  1FXJ A;  4CJ8 A;  1H7F A;  3RMV A;  4KT7 A;  2BO4 A;  3O3P A;  1H7Q A;  3V91 A;  1HM0 A;  4FRQ A;  2Y4K A;  3I0K A;  2VS4 A;  1VIC A;  2XME A;  1MP3 A;  1ZCU A;  2V0H A;  1W57 A;  2APC A;  2JCO A;  1FO9 A;  1ON6 A;  1V84 A;  1NKH B;  5C49 A;  1GX0 A;  3CKV A;  4GBP A;  4KC1 A;  3V0L A;  2X60 A;  3CKO A;  2OI7 A;  2YC3 A;  4D11 C;  1NF5 B;  3CKQ A;  4Y7T A;  5C1L A;  1ZHJ A;  5CQL X;  3D98 A;  2D0J A;  4G87 A;  1ZI1 A;  4HO8 A;  1G97 A;  1OQM B;  4FRO A;  3I0I X;  3V0M A;  3SXB A;  2CU2 A;  1FXO A;  4HO9 A;  4Y7G A;  3ST8 A;  1R7Y A;  3SX5 A;  4NAN A;  3V0O A;  4P00 A;  1H5S C;  2Y6P A;  5CQO A;  4JD0 A;  1NHE B;  5CQN X;  1S4P A;  1JV3 A;  4KC4 A;  1ZIZ A;  5CQM X;  3K8D A;  2PA4 A;  1H7H A;  4ARW A;  1G9R A;  4G3P A;  4EE4 A;  5C4F A;  3IOJ A;  4AYL A;  4EEM A;  2RJ8 A;  5L6V A;  4NAI A;  3R3I A;  4M28 A;  2Y4J A;  2Z87 A;  2OI6 A;  1HJL A;  5L6S A;  1MP4 A;  1JV1 A;  1FWY A;  5C4B A;  2I5K A;  2O1F A;  2QH5 A;  2FFV A;  2JCL A;  2AM3 A;  1H5T A;  2VD4 A;  1O23 B;  4D0T A;  1VGT A;  2QKX A;  1H4C A; 
#chains in the Genus database with same CATH topology
 1NWG B;  3K8E A;  4HO6 A;  3SXE A;  3TQD A;  4Y6U A;  2P6W A;  1V83 A;  4B2W A;  3D5N A;  1JYK A;  2VS5 A;  3OH1 A;  4KXO A;  3JTJ A;  2JCK A;  4KPZ A;  1Z90 A;  2J0B A;  1YP4 A;  3SX7 A;  4Y62 A;  2YES A;  3I0C A;  1G93 A;  3KIA A;  4B5B A;  4HO2 A;  3U2U A;  1O7O A;  2X5Z A;  3FOQ A;  4Y7U A;  4Y64 A;  4EVW A;  3V8Z A;  2W0W A;  1ZJP A;  2V0J A;  4FRP A;  1WT3 A;  4HOC A;  2Y4M A;  4Y9X A;  5HS2 A;  4ASJ A;  2AE7 A;  2DPW A;  3QVB A;  4HG6 A;  3TZT A;  2VXM A;  3USQ A;  3PKQ A;  3T7M A;  3DUV A;  2X65 A;  1H5S B;  1OMZ A;  2VK9 A;  4EE5 A;  1WSZ A;  2Z86 A;  1GQC A;  1YP3 A;  1O0R A;  1R82 A;  4K6R A;  1H3M A;  2OEF A;  2RJ6 A;  1LL2 A;  2RJ7 A;  3Q4S A;  4CJB A;  4KRV A;  2JCJ A;  2BO7 A;  4EE3 A;  1QGQ A;  2WE9 A;  2V0I A;  4B2X A;  3E25 A;  2VSH A;  5C3D A;  3BCV A;  1QGS A;  3NGW A;  5CMG X;  1VZT A;  1ZCY A;  3E26 A;  4B4G A;  4O6M A;  1ZI3 A;  2E3D A;  3I0H A;  1QWJ A;  3DK5 A;  5C4E A;  5C48 A;  3RSB A;  3PNN A;  4M2A A;  2D7I A;  5AJP A;  1W55 A;  3ZF8 A;  1G2V A;  1YP2 A;  2ICX A;  3SXD A;  3OH4 A;  1R7T A;  2RJ9 A;  4M2B A;  1I52 A;  1VPA A;  1S4N A;  2WGZ A;  5DDT A;  2AES A;  4EEO A;  5BXC A;  2W0V A;  1FR9 A;  2MZB A;  2RIT A;  5C8R A;  1WT1 A;  3ZLK A;  1VM8 A;  2QGI A;  3CKJ A;  4LW6 A;  2OEG A;  4CVH A;  4JIS A;  2C0N A;  1G95 A;  2J0A A;  1LVW A;  4L41 C;  3OH0 A;  3SPT A;  4HCQ A;  4IRQ A;  3U0X A;  1LL0 A;  1TW1 A;  1WT2 A;  5CMI A;  5D92 A;  3EE5 A;  4AYJ A;  5C4C A;  4BQH A;  1JYL A;  3FWW A;  1H5S D;  5EIY A;  1H5R B;  2YQC A;  4G3S A;  2Y7A A;  2RJ1 A;  5IDT A;  4YS8 A;  2WAW A;  1GA8 A;  1K4V A;  1WVC A;  2ZU7 A;  1ON8 A;  3POL A;  1O7Q A;  1OMX A;  4M4K A;  2O1H A;  2X5S A;  4EEA A;  1HM9 A;  1H4D A;  3N9W A;  1VZX A;  3OAM A;  3OGZ A;  1TVY A;  2AM4 A;  4DEC A;  3OC9 A;  2VFZ A;  3CU0 A;  1LZJ A;  5I1F A;  2D7R A;  4MIX A;  3V0Q A;  1ZJO A;  5IDS A;  1FO8 A;  3V90 A;  5J49 A;  2YQS A;  2AM5 A;  1HJJ A;  1LZ7 A;  3JUK A;  1TW5 A;  1IIM A;  1G3L A;  3I0D A;  1VZU A;  4HO4 A;  1ZI4 A;  1XZ6 A;  3SXG A;  1ZJ0 A;  3JUJ A;  4ZDQ A;  2RIX A;  4FRA A;  5C1H A;  3SX8 A;  1IIN A;  1ZI5 A;  2A8W A;  4MND A;  5JQQ A;  3CKN A;  4KPX A;  1HV9 A;  5FU8 A;  5C4D A;  2Q4J A;  1VH1 A;  2WEE A;  2FFU A;  1GWW A;  3DJ4 A;  2RJ4 A;  4DDZ A;  5FTS A;  2WVL A;  3GUE A;  2PGY A;  4D11 A;  5CMH A;  1FOA A;  1G8O A;  2ICY A;  3I0J A;  5C3A A;  1ZDG A;  5C1G A;  2V0L A;  1SS9 A;  2ZU8 A;  1FR8 A;  2XMH A;  5CMF X;  4B42 A;  4KC2 A;  2E8B A;  5C38 A;  1EZI A;  2A8U A;  2OI5 A;  4MYB A;  4EEG A;  4O6N A;  3RMW A;  1LZI A;  1H5S A;  4CJC A;  4ASY A;  5AJO A;  5FTV A;  2AEC A;  2YQJ A;  2UX8 A;  4J18 A;  1FGG A;  1G0R A;  5EJ1 A;  5IFY A;  1GWV A;  5DDV A;  3U2W A;  1INI A;  2YCM A;  4UEG A;  4BMA A;  1KWS A;  3I0L A;  1H7T A;  4HO5 A;  4G3Q A;  3D8V A;  1ZDF A;  3U2V A;  3ZLL A;  1FRW A;  1H7E A;  5C47 A;  1JVG A;  2FYB A;  4XWI A;  3T7O A;  1VGW A;  2VSI A;  4FQW A;  1LZ0 A;  1PZY B;  4D48 A;  3CGX A;  1R80 A;  5C3B A;  3HL3 A;  3SXC A;  1INJ A;  1G1L A;  2RIZ A;  3ZGF A;  2YQH A;  3I0F A;  2FYA A;  4B3U A;  2VXL A;  1GX4 A;  4FRE A;  3SX3 A;  1LL3 A;  3V0P A;  4KQL A;  4AC3 A;  3OH3 A;  1ZJ2 A;  1MC3 A;  2AGD A;  2P73 A;  1FGX A;  3U2T A;  1H7G A;  1H5T B;  2FY7 A;  1EYR A;  4KNX A;  2I5E A;  5FU0 A;  2BO8 A;  2O1G A;  1E5K A;  2GGO A;  2PX7 A;  2P72 A;  2YC5 A;  3I0G A;  5AJN A;  2GGQ A;  2BO6 A;  3I0E A;  1WT0 A;  2XWM A;  1G23 A;  4HO3 A;  5CMJ A;  1R7U A;  2RJ0 A;  1H5R A;  4FRM A;  4ECM A;  4Q7C A;  3T7N A;  2NXV A;  5FV9 A;  2VS3 A;  1VGU A;  2ZU9 A;  3LW6 A;  4Y7F A;  1R81 A;  4Y63 A;  5EJZ A;  2RJ5 A;  1FZW A;  1ZJ3 A;  2V0K A;  1PZT A;  3F1Y A;  3IOH A;  4FCE A;  2FYC B;  1H4E A;  3ZGG A;  2AH9 A;  3Q7U A;  1FG5 N;  5C36 A;  4C2S A;  3IOI A;  2FYD B;  4E1K A;  4IRP A;  4LW3 A;  1ZJ1 A;  4D0Z A;  4NAK A;  4FRB A;  1HM8 A;  1TZF A;  1H7L A;  4B4B A;  5FUH A;  4Y7V A;  5CQP A;  4P02 A;  2WVM A;  3USR A;  1S4O A;  1VH3 A;  1XHB A;  2WVK A;  5D91 A;  4Y6N A;  4DE7 A;  3U0Y A;  3OKR A;  1GQ9 A;  2I7B A;  4FRL A;  3Q80 A;  4AAW A;  3OH2 A;  3PKP A;  3BRK X;  1R7X A;  1YRO B;  2XWL A;  2RIY A;  1JVD A;  3V8Y A;  1V82 A;  1ZCT A;  2XWN A;  1VGZ A;  4R7P A;  1NQI B;  3F1C A;  1W77 A;  2PGV A;  5FYE A;  1MP5 A;  1R7V A;  4HO0 A;  3SXA A;  3V0N A;  1QG8 A;  3R2W A;  3U2X A;  1ZCV A;  4FCU A;  4NAL A;  1NMM B;  4FRH A;  4B4M A;  2Y4L A;  4KNR A;  4FRD A;  1FXJ A;  4CJ8 A;  1H7F A;  3RMV A;  4KT7 A;  2BO4 A;  3O3P A;  1H7Q A;  3V91 A;  1HM0 A;  4FRQ A;  2Y4K A;  3I0K A;  2VS4 A;  1VIC A;  2XME A;  1MP3 A;  1ZCU A;  2V0H A;  1W57 A;  2APC A;  2JCO A;  1FO9 A;  1ON6 A;  1V84 A;  1NKH B;  5C49 A;  1GX0 A;  3CKV A;  4GBP A;  4KC1 A;  3V0L A;  2X60 A;  3CKO A;  2OI7 A;  2YC3 A;  4D11 C;  1NF5 B;  3CKQ A;  4Y7T A;  5C1L A;  1ZHJ A;  5CQL X;  3D98 A;  2D0J A;  4G87 A;  1ZI1 A;  4HO8 A;  1G97 A;  1OQM B;  4FRO A;  3I0I X;  3V0M A;  3SXB A;  2CU2 A;  1FXO A;  4HO9 A;  4Y7G A;  3ST8 A;  1R7Y A;  3SX5 A;  4NAN A;  3V0O A;  4P00 A;  1H5S C;  2Y6P A;  5CQO A;  4JD0 A;  1NHE B;  5CQN X;  1S4P A;  1JV3 A;  4KC4 A;  1ZIZ A;  5CQM X;  3K8D A;  2PA4 A;  1H7H A;  4FIX A;  4ARW A;  1G9R A;  4G3P A;  4EE4 A;  5C4F A;  3IOJ A;  4AYL A;  4EEM A;  2RJ8 A;  5L6V A;  4NAI A;  3R3I A;  4FIY A;  4M28 A;  2Y4J A;  2Z87 A;  2OI6 A;  1HJL A;  5L6S A;  1MP4 A;  1JV1 A;  1FWY A;  5C4B A;  2I5K A;  2O1F A;  2QH5 A;  2FFV A;  2JCL A;  2AM3 A;  1H5T A;  2VD4 A;  1O23 B;  4D0T A;  1VGT A;  2QKX A;  1H4C A; 
#chains in the Genus database with same CATH homology
 1NWG B;  3K8E A;  4HO6 A;  3SXE A;  3TQD A;  4Y6U A;  2P6W A;  1V83 A;  4B2W A;  3D5N A;  1JYK A;  2VS5 A;  3OH1 A;  4KXO A;  3JTJ A;  2JCK A;  4KPZ A;  1Z90 A;  2J0B A;  1YP4 A;  3SX7 A;  4Y62 A;  2YES A;  3I0C A;  1G93 A;  3KIA A;  4B5B A;  4HO2 A;  3U2U A;  1O7O A;  2X5Z A;  3FOQ A;  4Y7U A;  4Y64 A;  4EVW A;  3V8Z A;  2W0W A;  1ZJP A;  2V0J A;  4FRP A;  1WT3 A;  4HOC A;  2Y4M A;  4Y9X A;  5HS2 A;  4ASJ A;  2AE7 A;  2DPW A;  3QVB A;  4HG6 A;  3TZT A;  2VXM A;  3USQ A;  3PKQ A;  3T7M A;  3DUV A;  2X65 A;  1H5S B;  1OMZ A;  2VK9 A;  4EE5 A;  1WSZ A;  2Z86 A;  1GQC A;  1YP3 A;  1O0R A;  1R82 A;  4K6R A;  1H3M A;  2OEF A;  2RJ6 A;  1LL2 A;  2RJ7 A;  3Q4S A;  4CJB A;  4KRV A;  2JCJ A;  2BO7 A;  4EE3 A;  1QGQ A;  2WE9 A;  2V0I A;  4B2X A;  3E25 A;  2VSH A;  5C3D A;  3BCV A;  1QGS A;  3NGW A;  5CMG X;  1VZT A;  1ZCY A;  3E26 A;  4B4G A;  4O6M A;  1ZI3 A;  2E3D A;  3I0H A;  1QWJ A;  3DK5 A;  5C4E A;  5C48 A;  3RSB A;  3PNN A;  4M2A A;  2D7I A;  5AJP A;  1W55 A;  3ZF8 A;  1G2V A;  1YP2 A;  2ICX A;  3SXD A;  3OH4 A;  1R7T A;  2RJ9 A;  4M2B A;  1I52 A;  1VPA A;  1S4N A;  2WGZ A;  5DDT A;  2AES A;  4EEO A;  5BXC A;  2W0V A;  1FR9 A;  2MZB A;  2RIT A;  5C8R A;  1WT1 A;  3ZLK A;  1VM8 A;  2QGI A;  3CKJ A;  4LW6 A;  2OEG A;  4CVH A;  4JIS A;  2C0N A;  1G95 A;  2J0A A;  1LVW A;  4L41 C;  3OH0 A;  3SPT A;  4HCQ A;  4IRQ A;  3U0X A;  1LL0 A;  1TW1 A;  1WT2 A;  5CMI A;  5D92 A;  3EE5 A;  4AYJ A;  5C4C A;  4BQH A;  1JYL A;  3FWW A;  1H5S D;  5EIY A;  1H5R B;  2YQC A;  4G3S A;  2Y7A A;  2RJ1 A;  5IDT A;  4YS8 A;  2WAW A;  1GA8 A;  1K4V A;  1WVC A;  2ZU7 A;  1ON8 A;  3POL A;  1O7Q A;  1OMX A;  4M4K A;  2O1H A;  2X5S A;  4EEA A;  1HM9 A;  1H4D A;  3N9W A;  1VZX A;  3OAM A;  3OGZ A;  1TVY A;  2AM4 A;  4DEC A;  3OC9 A;  2VFZ A;  3CU0 A;  1LZJ A;  5I1F A;  2D7R A;  4MIX A;  3V0Q A;  1ZJO A;  5IDS A;  1FO8 A;  3V90 A;  5J49 A;  2YQS A;  2AM5 A;  1HJJ A;  1LZ7 A;  3JUK A;  1TW5 A;  1IIM A;  1G3L A;  3I0D A;  1VZU A;  4HO4 A;  1ZI4 A;  1XZ6 A;  3SXG A;  1ZJ0 A;  3JUJ A;  4ZDQ A;  2RIX A;  4FRA A;  5C1H A;  3SX8 A;  1IIN A;  1ZI5 A;  2A8W A;  4MND A;  5JQQ A;  3CKN A;  4KPX A;  1HV9 A;  5FU8 A;  5C4D A;  2Q4J A;  1VH1 A;  2WEE A;  2FFU A;  1GWW A;  3DJ4 A;  2RJ4 A;  4DDZ A;  5FTS A;  2WVL A;  3GUE A;  2PGY A;  4D11 A;  5CMH A;  1FOA A;  1G8O A;  2ICY A;  3I0J A;  5C3A A;  1ZDG A;  5C1G A;  2V0L A;  1SS9 A;  2ZU8 A;  1FR8 A;  2XMH A;  5CMF X;  4B42 A;  4KC2 A;  2E8B A;  5C38 A;  1EZI A;  2A8U A;  2OI5 A;  4MYB A;  4EEG A;  4O6N A;  3RMW A;  1LZI A;  1H5S A;  4CJC A;  4ASY A;  5AJO A;  5FTV A;  2AEC A;  2YQJ A;  2UX8 A;  4J18 A;  1FGG A;  1G0R A;  5EJ1 A;  5IFY A;  1GWV A;  5DDV A;  3U2W A;  1INI A;  2YCM A;  4UEG A;  4BMA A;  1KWS A;  3I0L A;  1H7T A;  4HO5 A;  4G3Q A;  3D8V A;  1ZDF A;  3U2V A;  3ZLL A;  1FRW A;  1H7E A;  5C47 A;  1JVG A;  2FYB A;  4XWI A;  3T7O A;  1VGW A;  2VSI A;  4FQW A;  1LZ0 A;  1PZY B;  4D48 A;  3CGX A;  1R80 A;  5C3B A;  3HL3 A;  3SXC A;  1INJ A;  1G1L A;  2RIZ A;  3ZGF A;  2YQH A;  3I0F A;  2FYA A;  4B3U A;  2VXL A;  1GX4 A;  4FRE A;  3SX3 A;  1LL3 A;  3V0P A;  4KQL A;  4AC3 A;  3OH3 A;  1ZJ2 A;  1MC3 A;  2AGD A;  2P73 A;  1FGX A;  3U2T A;  1H7G A;  1H5T B;  2FY7 A;  1EYR A;  4KNX A;  2I5E A;  5FU0 A;  2BO8 A;  2O1G A;  1E5K A;  2GGO A;  2PX7 A;  2P72 A;  2YC5 A;  3I0G A;  5AJN A;  2GGQ A;  2BO6 A;  3I0E A;  1WT0 A;  2XWM A;  1G23 A;  4HO3 A;  5CMJ A;  1R7U A;  2RJ0 A;  1H5R A;  4FRM A;  4ECM A;  4Q7C A;  3T7N A;  2NXV A;  5FV9 A;  2VS3 A;  1VGU A;  2ZU9 A;  3LW6 A;  4Y7F A;  1R81 A;  4Y63 A;  5EJZ A;  2RJ5 A;  1FZW A;  1ZJ3 A;  2V0K A;  1PZT A;  3F1Y A;  3IOH A;  4FCE A;  2FYC B;  1H4E A;  3ZGG A;  2AH9 A;  3Q7U A;  1FG5 N;  5C36 A;  4C2S A;  3IOI A;  2FYD B;  4E1K A;  4IRP A;  4LW3 A;  1ZJ1 A;  4D0Z A;  4NAK A;  4FRB A;  1HM8 A;  1TZF A;  1H7L A;  4B4B A;  5FUH A;  4Y7V A;  5CQP A;  4P02 A;  2WVM A;  3USR A;  1S4O A;  1VH3 A;  1XHB A;  2WVK A;  5D91 A;  4Y6N A;  4DE7 A;  3U0Y A;  3OKR A;  1GQ9 A;  2I7B A;  4FRL A;  3Q80 A;  4AAW A;  3OH2 A;  3PKP A;  3BRK X;  1R7X A;  1YRO B;  2XWL A;  2RIY A;  1JVD A;  3V8Y A;  1V82 A;  1ZCT A;  2XWN A;  1VGZ A;  4R7P A;  1NQI B;  3F1C A;  1W77 A;  2PGV A;  5FYE A;  1MP5 A;  1R7V A;  4HO0 A;  3SXA A;  3V0N A;  1QG8 A;  3R2W A;  3U2X A;  1ZCV A;  4FCU A;  4NAL A;  1NMM B;  4FRH A;  4B4M A;  2Y4L A;  4KNR A;  4FRD A;  1FXJ A;  4CJ8 A;  1H7F A;  3RMV A;  4KT7 A;  2BO4 A;  3O3P A;  1H7Q A;  3V91 A;  1HM0 A;  4FRQ A;  2Y4K A;  3I0K A;  2VS4 A;  1VIC A;  2XME A;  1MP3 A;  1ZCU A;  2V0H A;  1W57 A;  2APC A;  2JCO A;  1FO9 A;  1ON6 A;  1V84 A;  1NKH B;  5C49 A;  1GX0 A;  3CKV A;  4GBP A;  4KC1 A;  3V0L A;  2X60 A;  3CKO A;  2OI7 A;  2YC3 A;  4D11 C;  1NF5 B;  3CKQ A;  4Y7T A;  5C1L A;  1ZHJ A;  5CQL X;  3D98 A;  2D0J A;  4G87 A;  1ZI1 A;  4HO8 A;  1G97 A;  1OQM B;  4FRO A;  3I0I X;  3V0M A;  3SXB A;  2CU2 A;  1FXO A;  4HO9 A;  4Y7G A;  3ST8 A;  1R7Y A;  3SX5 A;  4NAN A;  3V0O A;  4P00 A;  1H5S C;  2Y6P A;  5CQO A;  4JD0 A;  1NHE B;  5CQN X;  1S4P A;  1JV3 A;  4KC4 A;  1ZIZ A;  5CQM X;  3K8D A;  2PA4 A;  1H7H A;  4FIX A;  4ARW A;  1G9R A;  4G3P A;  4EE4 A;  5C4F A;  3IOJ A;  4AYL A;  4EEM A;  2RJ8 A;  5L6V A;  4NAI A;  3R3I A;  4FIY A;  4M28 A;  2Y4J A;  2Z87 A;  2OI6 A;  1HJL A;  5L6S A;  1MP4 A;  1JV1 A;  1FWY A;  5C4B A;  2I5K A;  2O1F A;  2QH5 A;  2FFV A;  2JCL A;  2AM3 A;  1H5T A;  2VD4 A;  1O23 B;  4D0T A;  1VGT A;  2QKX A;  1H4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...