3U2XA

Crystal structure of human glycogenin-1 (gyg1) complexed with manganese, udp and 1'-deoxyglucose
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
263
structure length
263
Chain Sequence
SMTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHPEFLILWWNIFTTNVLPLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycogenin-1
publication title Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP and 1'-deoxyglucose
rcsb
source organism Homo sapiens
total genus 93
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2011-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3u2xA00
2AECA 4MNDA 1S4PA 2V0LA 2OEFA 3OAMA 4EEAA 4HO2A 2RJ9A 2Q4JA 4HO8A 2FFUA 1H5TB 2V0HA 3RMWA 4DECA 1V83A 3U2TA 4JISA 4KQLA 5C47A 1TW5A 1NKHB 3DUVA 4MYBA 3RSBA 4Y62A 3ZGGA 1FGGA 3D5NA 4J18A 3SPTA 5FUHA 1HM9A 1H5SD 1QG8A 4G87A 2YC3A 3E25A 5CMFX 4EEOA 1LL0A 3KIAA 1ZI3A 1H4CA 4B4MA 4CJ8A 2RJ0A 2PGYA 2DPWA 1ZJOA 3I0JA 1H4EA 4FREA 3I0KA 3TZTA 3ZF8A 4Y64A 3BRKX 3IOHA 1HV9A 3SXAA 1IIMA 2RJ1A 4HO6A 5FTVA 3ZGFA 1VGWA 2AESA 4KXOA 3USRA 4B2WA 2AH9A 1VH3A 3SX7A 3K8DA 4CVHA 3OGZA 3V90A 5FU8A 1NHEB 1G9RA 1TW1A 1LZJA 1JVDA 4IRQA 2WEEA 4Y63A 3Q4SA 4K6RA 4Y7VA 2OI7A 1W57A 3U2XA 3T7NA 2ICYA 3I0LA 2VXLA 5HS2A 5C4FA 4C2SA 1NF5B 3U0XA 5C4BA 2I5EA 2AGDA 3PNNA 1WT0A 4M2AA 4Y9XA 1VGZA 3USQA 5J49A 1JYKA 4AAWA 5C48A 2Y6PA 3U0YA 3CKVA 2QH5A 4IRPA 5FV9A 5C1HA 1ZDGA 1FWYA 1R7VA 3V91A 2RIXA 2V0IA 1FZWA 1H5RA 2RJ5A 4E1KA 5C3DA 4ASYA 1HJJA 1G1LA 4L41C 2WAWA 4B4BA 1ON8A 1TVYA 1HM0A 1LL3A 4Y7FA 2YESA 1YP2A 2JCKA 4B5BA 2WVKA 3I0HA 2JCLA 1EZIA 1S4OA 1H7TA 3CU0A 3V8ZA 1FO9A 3V0PA 3D8VA 1VGUA 1ZI5A 1GX4A 3SX5A 2YQCA 3ZLLA 4KPXA 5IDSA 2Y4MA 2Z87A 3I0GA 3POLA 1MP4A 3JTJA 1H7FA 2MZBA 1LVWA 4KC2A 4FQWA 3V0OA 4D11C 3SXDA 1H5SA 4KNXA 4FRQA 1VH1A 5BXCA 4HO5A 1GX0A 4LW3A 4D0TA 1FXJA 3JUJA 2FYDB 4G3PA 4NALA 2AM4A 4GBPA 4NAKA 5AJPA 5CQMX 1O7QA 1G3LA 5C8RA 2W0VA 3IOJA 3OH4A 1G0RA 2P72A 1PZYB 4LW6A 1ZIZA 2XWNA 5AJNA 2ZU7A 2AM5A 4HO4A 1GQ9A 2QGIA 2BO7A 1VZUA 5C1GA 2Y4KA 3SXBA 1LZIA 3SX8A 2D7IA 1ZJ1A 4B2XA 1VGTA 2YCMA 4FRLA 4EEMA 1HM8A 2RIYA 2BO6A 4M28A 1O23B 5IFYA 5CQPA 4HO3A 1NMMB 3BCVA 1K4VA 1WT2A 2OI6A 4DE7A 1FG5N 1VM8A 1E5KA 5C1LA 5CQLX 2VFZA 2V0KA 2VSHA 2ZU9A 2OEGA 1GWWA 4ASJA 5C4DA 5EJZA 2VD4A 1FRWA 3OH1A 3LW6A 2YC5A 4CJCA 5JQQA 2YQSA 3SXEA 1VZXA 2UX8A 3T7MA 4XWIA 4G3QA 3Q7UA 3U2WA 1ZJ2A 1H7EA 3I0IX 2E3DA 2AM3A 1JYLA 1H5RB 1YP3A 3I0CA 1R81A 5I1FA 2D0JA 1TZFA 2XWLA 3V0MA 2RJ6A 1W77A 1H7LA 2PGVA 3PKPA 1I52A 5C38A 4JD0A 2RJ8A 5C4EA 2BO4A 4FRMA 1OMZA 1VPAA 3OKRA 1ZI4A 2YQJA 3V0NA 2V0JA 1XHBA 4Y6UA 1WSZA 1S4NA 2VSIA 3CGXA 3SXGA 3V0LA 5C49A 1IINA 4HG6A 1YP4A 2WE9A 2CU2A 2I7BA 4KRVA 1LZ7A 2JCOA 4D48A 1G2VA 4EE4A 1ZI1A 3TQDA 1V84A 1SS9A 4AYLA 4KC4A 1WT1A 4B42A 5CMHA 4FRHA 4HO0A 1MC3A 2WVMA 3DJ4A 1R82A 3R3IA 3IOIA 4KC1A 3Q80A 3V8YA 3U2VA 5L6SA 4KPZA 5CMIA 4P02A 2BO8A 3T7OA 1H5SB 4YS8A 2XMHA 3K8EA 4ECMA 1FR9A 4KT7A 1H7QA 4NAIA 4Y7GA 1XZ6A 2X60A 4FCUA 1JVGA 3ZLKA 1G95A 4P00A 3JUKA 2A8UA 2W0WA 2ICXA 2O1HA 2O1GA 4CJBA 1MP3A 5DDTA 4DDZA 1G93A 3SXCA 2VS3A 3OH2A 2X5SA 4Y7UA 5FU0A 4HOCA 5C36A 1V82A 3RMVA 2JCJA 1R7TA 2A8WA 2RIZA 3OC9A 1ON6A 2GGOA 5L6VA 3NGWA 1ZJ3A 2FYBA 4UEGA 2Y4LA 3FOQA 2P6WA 5EJ1A 4FROA 2E8BA 2NXVA 3CKQA 3U2UA 3F1YA 3F1CA 1INIA 2PA4A 5DDVA 3I0DA 1QGQA 3V0QA 4G3SA 1G97A 5EIYA 2APCA 1ZJ0A 2Y7AA 2RJ7A 4BMAA 5C3BA 4D11A 1VICA 4FRBA 3ST8A 2QKXA 1H5TA 3HL3A 2PX7A 2WGZA 2XWMA 4FCEA 1LL2A 1JV1A 1H7HA 1WVCA 1H3MA 1ZCTA 2RITA 2VXMA 3D98A 1LZ0A 3N9WA 5FYEA 1FXOA 1ZJPA 2VS5A 2GGQA 3CKOA 4KNRA 2I5KA 5C3AA 5IDTA 4AC3A 1H4DA 2YQHA 4FRAA 1O0RA 3CKJA 3I0EA 1H7GA 2P73A 5FTSA 1FGXA 2Z86A 3O3PA 2VS4A 4EEGA 1VZTA 1FR8A 1ZCVA 1ZCYA 1EYRA 2ZU8A 1NWGB 4EVWA 1MP5A 1KWSA 3R2WA 1JV3A 1INJA 1NQIB 4ZDQA 5CQNX 2OI5A 2FYCB 2D7RA 4Y6NA 4NANA 1ZDFA 2FY7A 3I0FA 5CQOA 4AYJA 3EE5A 4HO9A 2X5ZA 3QVBA 1QGSA 3DK5A 4EE5A 4FRPA 1YROB 1ZHJA 1R80A 1G8OA 2FYAA 5CMJA 1PZTA 3OH0A 2X65A 1G23A 1FO8A 5AJOA 1GQCA 1WT3A 2FFVA 1FOAA 4B4GA 3CKNA 1R7YA 1Z90A 3E26A 1OMXA 3SX3A 4M4KA 4R7PA 1GA8A 1GWVA 2Y4JA 4D0ZA 3OH3A 4FRDA 1OQMB 1H5SC 3FWWA 1QWJA 1ZCUA 4Y7TA 1O7OA 2AE7A 4ARWA 4B3UA 5C4CA 3GUEA 2XMEA 5CMGX 4HCQA 1HJLA 1R7UA 2O1FA 1R7XA 3PKQA 1W55A 4BQHA 2RJ4A 4M2BA 4EE3A 2WVLA
chains in the Genus database with same CATH superfamily
2AECA 4MNDA 1S4PA 2V0LA 2OEFA 3OAMA 4EEAA 4HO2A 2RJ9A 2Q4JA 4HO8A 2FFUA 1H5TB 2V0HA 3RMWA 4DECA 1V83A 3U2TA 4JISA 4KQLA 5C47A 1TW5A 1NKHB 3DUVA 4MYBA 3RSBA 4Y62A 3ZGGA 1FGGA 3D5NA 4J18A 3SPTA 5FUHA 1HM9A 1H5SD 1QG8A 4G87A 2YC3A 3E25A 5CMFX 4FIXA 4EEOA 1LL0A 3KIAA 1ZI3A 1H4CA 4B4MA 4CJ8A 2RJ0A 2PGYA 2DPWA 1ZJOA 3I0JA 1H4EA 4FREA 3I0KA 3TZTA 3ZF8A 4Y64A 3BRKX 3IOHA 1HV9A 3SXAA 1IIMA 2RJ1A 4HO6A 5FTVA 3ZGFA 1VGWA 2AESA 4KXOA 3USRA 4B2WA 2AH9A 1VH3A 3SX7A 3K8DA 4CVHA 3OGZA 3V90A 5FU8A 1NHEB 1G9RA 1TW1A 1LZJA 1JVDA 4IRQA 2WEEA 4Y63A 3Q4SA 4K6RA 4Y7VA 2OI7A 1W57A 3U2XA 3T7NA 2ICYA 3I0LA 2VXLA 5HS2A 5C4FA 4C2SA 1NF5B 3U0XA 5C4BA 2I5EA 2AGDA 3PNNA 1WT0A 4M2AA 4Y9XA 1VGZA 3USQA 5J49A 1JYKA 4AAWA 5C48A 2Y6PA 3U0YA 3CKVA 2QH5A 4FIYA 4IRPA 5FV9A 5C1HA 1ZDGA 1FWYA 1R7VA 3V91A 2RIXA 2V0IA 1FZWA 1H5RA 2RJ5A 4E1KA 5C3DA 4ASYA 1HJJA 1G1LA 4L41C 2WAWA 4B4BA 1ON8A 1TVYA 1HM0A 1LL3A 2C0NA 4Y7FA 2YESA 1YP2A 2JCKA 4B5BA 2WVKA 3I0HA 2JCLA 5D92A 1EZIA 1S4OA 1H7TA 3CU0A 3V8ZA 1FO9A 3V0PA 3D8VA 1VGUA 1ZI5A 1GX4A 3SX5A 2YQCA 3ZLLA 4KPXA 5IDSA 2Y4MA 2Z87A 3I0GA 3POLA 1MP4A 3JTJA 1H7FA 2MZBA 1LVWA 4KC2A 4FQWA 3V0OA 4D11C 3SXDA 1H5SA 4KNXA 4FRQA 1VH1A 5BXCA 4HO5A 1GX0A 4LW3A 4D0TA 1FXJA 3JUJA 2FYDB 4G3PA 4NALA 2AM4A 4GBPA 4NAKA 5AJPA 5CQMX 1O7QA 1G3LA 5C8RA 2W0VA 3IOJA 3OH4A 1G0RA 2P72A 1PZYB 4LW6A 4O6NA 1ZIZA 2XWNA 5AJNA 2ZU7A 2AM5A 4HO4A 1GQ9A 2QGIA 2BO7A 1VZUA 5C1GA 2Y4KA 3SXBA 1LZIA 3SX8A 2D7IA 1ZJ1A 4B2XA 1VGTA 2YCMA 4FRLA 4EEMA 1HM8A 2RIYA 2BO6A 4M28A 1O23B 5IFYA 5CQPA 4HO3A 1NMMB 3BCVA 5D91A 1K4VA 1WT2A 2OI6A 4DE7A 1FG5N 1VM8A 1E5KA 5C1LA 4Q7CA 5CQLX 2VFZA 2V0KA 2VSHA 2ZU9A 2OEGA 1GWWA 4ASJA 5C4DA 5EJZA 2VD4A 1FRWA 3OH1A 3LW6A 2YC5A 4CJCA 5JQQA 2YQSA 3SXEA 1VZXA 2UX8A 3T7MA 4XWIA 4G3QA 3Q7UA 3U2WA 1ZJ2A 1H7EA 3I0IX 4MIXA 2E3DA 2AM3A 1JYLA 1H5RB 1YP3A 3I0CA 1R81A 5I1FA 2D0JA 1TZFA 2XWLA 3V0MA 2RJ6A 1W77A 1H7LA 2PGVA 3PKPA 1I52A 5C38A 4JD0A 2RJ8A 5C4EA 2BO4A 4FRMA 1OMZA 1VPAA 3OKRA 1ZI4A 2YQJA 3V0NA 2V0JA 2VK9A 1XHBA 4Y6UA 1WSZA 1S4NA 2VSIA 3CGXA 3SXGA 3V0LA 5C49A 1IINA 4HG6A 1YP4A 2WE9A 2CU2A 2I7BA 4KRVA 1LZ7A 2JCOA 4D48A 1G2VA 4EE4A 1ZI1A 3TQDA 1V84A 1SS9A 4AYLA 4KC4A 1WT1A 4B42A 5CMHA 4FRHA 4HO0A 1MC3A 2WVMA 3DJ4A 1R82A 3R3IA 3IOIA 4KC1A 2J0BA 3Q80A 3V8YA 3U2VA 5L6SA 4KPZA 5CMIA 4P02A 2BO8A 3T7OA 1H5SB 4YS8A 2XMHA 3K8EA 4ECMA 1FR9A 4KT7A 1H7QA 2J0AA 4NAIA 4Y7GA 1XZ6A 2X60A 4FCUA 1JVGA 3ZLKA 1G95A 4P00A 3JUKA 2A8UA 2W0WA 2ICXA 2O1HA 2O1GA 4CJBA 1MP3A 5DDTA 4DDZA 1G93A 3SXCA 2VS3A 3OH2A 2X5SA 4Y7UA 5FU0A 4HOCA 5C36A 1V82A 3RMVA 2JCJA 4O6MA 1R7TA 2A8WA 2RIZA 3OC9A 1ON6A 2GGOA 5L6VA 3NGWA 1ZJ3A 2FYBA 4UEGA 2Y4LA 3FOQA 2P6WA 5EJ1A 4FROA 2E8BA 2NXVA 3CKQA 3U2UA 3F1YA 3F1CA 1INIA 2PA4A 5DDVA 3I0DA 1QGQA 3V0QA 4G3SA 1G97A 5EIYA 2APCA 1ZJ0A 2Y7AA 2RJ7A 4BMAA 5C3BA 4D11A 1VICA 4FRBA 3ST8A 2QKXA 1H5TA 3HL3A 2PX7A 2WGZA 2XWMA 4FCEA 1LL2A 1JV1A 1H7HA 1WVCA 1H3MA 1ZCTA 2RITA 2VXMA 3D98A 1LZ0A 3N9WA 5FYEA 1FXOA 1ZJPA 2VS5A 2GGQA 3CKOA 4KNRA 2I5KA 5C3AA 5IDTA 4AC3A 1H4DA 2YQHA 4FRAA 1O0RA 3CKJA 3I0EA 1H7GA 2P73A 5FTSA 1FGXA 2Z86A 3O3PA 2VS4A 4EEGA 1VZTA 1FR8A 1ZCVA 1ZCYA 1EYRA 2ZU8A 1NWGB 4EVWA 1MP5A 1KWSA 3R2WA 1JV3A 1INJA 1NQIB 4ZDQA 5CQNX 2OI5A 2FYCB 2D7RA 4Y6NA 4NANA 1ZDFA 2FY7A 3I0FA 5CQOA 4AYJA 3EE5A 4HO9A 2X5ZA 3QVBA 1QGSA 3DK5A 4EE5A 4FRPA 1YROB 1ZHJA 1R80A 1G8OA 2FYAA 5CMJA 1PZTA 3OH0A 2X65A 1G23A 1FO8A 5AJOA 1GQCA 1WT3A 2FFVA 1FOAA 4B4GA 3CKNA 1R7YA 1Z90A 3E26A 1OMXA 3SX3A 4M4KA 4R7PA 1GA8A 1GWVA 2Y4JA 4D0ZA 3OH3A 4FRDA 1OQMB 1H5SC 3FWWA 1QWJA 1ZCUA 4Y7TA 1O7OA 2AE7A 4ARWA 4B3UA 5C4CA 3GUEA 2XMEA 5CMGX 4HCQA 1HJLA 1R7UA 2O1FA 1R7XA 3PKQA 1W55A 4BQHA 2RJ4A 4M2BA 4EE3A 2WVLA
chains in the Genus database with same CATH topology
2AECA 4MNDA 1S4PA 2V0LA 2OEFA 3OAMA 4EEAA 4HO2A 2RJ9A 2Q4JA 4HO8A 2FFUA 1H5TB 2V0HA 3RMWA 4DECA 1V83A 3U2TA 4JISA 4KQLA 5C47A 1TW5A 1NKHB 3DUVA 4MYBA 3RSBA 4Y62A 3ZGGA 1FGGA 3D5NA 4J18A 3SPTA 5FUHA 1HM9A 1H5SD 1QG8A 4G87A 2YC3A 3E25A 5CMFX 4FIXA 4EEOA 1LL0A 3KIAA 1ZI3A 1H4CA 4B4MA 4CJ8A 2RJ0A 2PGYA 2DPWA 1ZJOA 3I0JA 1H4EA 4FREA 3I0KA 3TZTA 3ZF8A 4Y64A 3BRKX 3IOHA 1HV9A 3SXAA 1IIMA 2RJ1A 4HO6A 5FTVA 3ZGFA 1VGWA 2AESA 4KXOA 3USRA 4B2WA 2AH9A 1VH3A 3SX7A 3K8DA 4CVHA 3OGZA 3V90A 5FU8A 1NHEB 1G9RA 1TW1A 1LZJA 1JVDA 4IRQA 2WEEA 4Y63A 3Q4SA 4K6RA 4Y7VA 2OI7A 1W57A 3U2XA 3T7NA 2ICYA 3I0LA 2VXLA 5HS2A 5C4FA 4C2SA 1NF5B 3U0XA 5C4BA 2I5EA 2AGDA 3PNNA 1WT0A 4M2AA 4Y9XA 1VGZA 3USQA 5J49A 1JYKA 4AAWA 5C48A 2Y6PA 3U0YA 3CKVA 2QH5A 4FIYA 4IRPA 5FV9A 5C1HA 1ZDGA 1FWYA 1R7VA 3V91A 2RIXA 2V0IA 1FZWA 1H5RA 2RJ5A 4E1KA 5C3DA 4ASYA 1HJJA 1G1LA 4L41C 2WAWA 4B4BA 1ON8A 1TVYA 1HM0A 1LL3A 2C0NA 4Y7FA 2YESA 1YP2A 2JCKA 4B5BA 2WVKA 3I0HA 2JCLA 5D92A 1EZIA 1S4OA 1H7TA 3CU0A 3V8ZA 1FO9A 3V0PA 3D8VA 1VGUA 1ZI5A 1GX4A 3SX5A 2YQCA 3ZLLA 4KPXA 5IDSA 2Y4MA 2Z87A 3I0GA 3POLA 1MP4A 3JTJA 1H7FA 2MZBA 1LVWA 4KC2A 4FQWA 3V0OA 4D11C 3SXDA 1H5SA 4KNXA 4FRQA 1VH1A 5BXCA 4HO5A 1GX0A 4LW3A 4D0TA 1FXJA 3JUJA 2FYDB 4G3PA 4NALA 2AM4A 4GBPA 4NAKA 5AJPA 5CQMX 1O7QA 1G3LA 5C8RA 2W0VA 3IOJA 3OH4A 1G0RA 2P72A 1PZYB 4LW6A 4O6NA 1ZIZA 2XWNA 5AJNA 2ZU7A 2AM5A 4HO4A 1GQ9A 2QGIA 2BO7A 1VZUA 5C1GA 2Y4KA 3SXBA 1LZIA 3SX8A 2D7IA 1ZJ1A 4B2XA 1VGTA 2YCMA 4FRLA 4EEMA 1HM8A 2RIYA 2BO6A 4M28A 1O23B 5IFYA 5CQPA 4HO3A 1NMMB 3BCVA 5D91A 1K4VA 1WT2A 2OI6A 4DE7A 1FG5N 1VM8A 1E5KA 5C1LA 4Q7CA 5CQLX 2VFZA 2V0KA 2VSHA 2ZU9A 2OEGA 1GWWA 4ASJA 5C4DA 5EJZA 2VD4A 1FRWA 3OH1A 3LW6A 2YC5A 4CJCA 5JQQA 2YQSA 3SXEA 1VZXA 2UX8A 3T7MA 4XWIA 4G3QA 3Q7UA 3U2WA 1ZJ2A 1H7EA 3I0IX 4MIXA 2E3DA 2AM3A 1JYLA 1H5RB 1YP3A 3I0CA 1R81A 5I1FA 2D0JA 1TZFA 2XWLA 3V0MA 2RJ6A 1W77A 1H7LA 2PGVA 3PKPA 1I52A 5C38A 4JD0A 2RJ8A 5C4EA 2BO4A 4FRMA 1OMZA 1VPAA 3OKRA 1ZI4A 2YQJA 3V0NA 2V0JA 2VK9A 1XHBA 4Y6UA 1WSZA 1S4NA 2VSIA 3CGXA 3SXGA 3V0LA 5C49A 1IINA 4HG6A 1YP4A 2WE9A 2CU2A 2I7BA 4KRVA 1LZ7A 2JCOA 4D48A 1G2VA 4EE4A 1ZI1A 3TQDA 1V84A 1SS9A 4AYLA 4KC4A 1WT1A 4B42A 5CMHA 4FRHA 4HO0A 1MC3A 2WVMA 3DJ4A 1R82A 3R3IA 3IOIA 4KC1A 2J0BA 3Q80A 3V8YA 3U2VA 5L6SA 4KPZA 5CMIA 4P02A 2BO8A 3T7OA 1H5SB 4YS8A 2XMHA 3K8EA 4ECMA 1FR9A 4KT7A 1H7QA 2J0AA 4NAIA 4Y7GA 1XZ6A 2X60A 4FCUA 1JVGA 3ZLKA 1G95A 4P00A 3JUKA 2A8UA 2W0WA 2ICXA 2O1HA 2O1GA 4CJBA 1MP3A 5DDTA 4DDZA 1G93A 3SXCA 2VS3A 3OH2A 2X5SA 4Y7UA 5FU0A 4HOCA 5C36A 1V82A 3RMVA 2JCJA 4O6MA 1R7TA 2A8WA 2RIZA 3OC9A 1ON6A 2GGOA 5L6VA 3NGWA 1ZJ3A 2FYBA 4UEGA 2Y4LA 3FOQA 2P6WA 5EJ1A 4FROA 2E8BA 2NXVA 3CKQA 3U2UA 3F1YA 3F1CA 1INIA 2PA4A 5DDVA 3I0DA 1QGQA 3V0QA 4G3SA 1G97A 5EIYA 2APCA 1ZJ0A 2Y7AA 2RJ7A 4BMAA 5C3BA 4D11A 1VICA 4FRBA 3ST8A 2QKXA 1H5TA 3HL3A 2PX7A 2WGZA 2XWMA 4FCEA 1LL2A 1JV1A 1H7HA 1WVCA 1H3MA 1ZCTA 2RITA 2VXMA 3D98A 1LZ0A 3N9WA 5FYEA 1FXOA 1ZJPA 2VS5A 2GGQA 3CKOA 4KNRA 2I5KA 5C3AA 5IDTA 4AC3A 1H4DA 2YQHA 4FRAA 1O0RA 3CKJA 3I0EA 1H7GA 2P73A 5FTSA 1FGXA 2Z86A 3O3PA 2VS4A 4EEGA 1VZTA 1FR8A 1ZCVA 1ZCYA 1EYRA 2ZU8A 1NWGB 4EVWA 1MP5A 1KWSA 3R2WA 1JV3A 1INJA 1NQIB 4ZDQA 5CQNX 2OI5A 2FYCB 2D7RA 4Y6NA 4NANA 1ZDFA 2FY7A 3I0FA 5CQOA 4AYJA 3EE5A 4HO9A 2X5ZA 3QVBA 1QGSA 3DK5A 4EE5A 4FRPA 1YROB 1ZHJA 1R80A 1G8OA 2FYAA 5CMJA 1PZTA 3OH0A 2X65A 1G23A 1FO8A 5AJOA 1GQCA 1WT3A 2FFVA 1FOAA 4B4GA 3CKNA 1R7YA 1Z90A 3E26A 1OMXA 3SX3A 4M4KA 4R7PA 1GA8A 1GWVA 2Y4JA 4D0ZA 3OH3A 4FRDA 1OQMB 1H5SC 3FWWA 1QWJA 1ZCUA 4Y7TA 1O7OA 2AE7A 4ARWA 4B3UA 5C4CA 3GUEA 2XMEA 5CMGX 4HCQA 1HJLA 1R7UA 2O1FA 1R7XA 3PKQA 1W55A 4BQHA 2RJ4A 4M2BA 4EE3A 2WVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AEC A;  4MND A;  1S4P A;  2V0L A;  2OEF A;  3OAM A;  4EEA A;  4HO2 A;  2RJ9 A;  2Q4J A;  4HO8 A;  2FFU A;  1H5T B;  2V0H A;  3RMW A;  4DEC A;  1V83 A;  3U2T A;  4JIS A;  4KQL A;  5C47 A;  1TW5 A;  1NKH B;  3DUV A;  4MYB A;  3RSB A;  4Y62 A;  3ZGG A;  1FGG A;  3D5N A;  4J18 A;  3SPT A;  5FUH A;  1HM9 A;  1H5S D;  1QG8 A;  4G87 A;  2YC3 A;  3E25 A;  5CMF X;  4EEO A;  1LL0 A;  3KIA A;  1ZI3 A;  1H4C A;  4B4M A;  4CJ8 A;  2RJ0 A;  2PGY A;  2DPW A;  1ZJO A;  3I0J A;  1H4E A;  4FRE A;  3I0K A;  3TZT A;  3ZF8 A;  4Y64 A;  3BRK X;  3IOH A;  1HV9 A;  3SXA A;  1IIM A;  2RJ1 A;  4HO6 A;  5FTV A;  3ZGF A;  1VGW A;  2AES A;  4KXO A;  3USR A;  4B2W A;  2AH9 A;  1VH3 A;  3SX7 A;  3K8D A;  4CVH A;  3OGZ A;  3V90 A;  5FU8 A;  1NHE B;  1G9R A;  1TW1 A;  1LZJ A;  1JVD A;  4IRQ A;  2WEE A;  4Y63 A;  3Q4S A;  4K6R A;  4Y7V A;  2OI7 A;  1W57 A;  3U2X A;  3T7N A;  2ICY A;  3I0L A;  2VXL A;  5HS2 A;  5C4F A;  4C2S A;  1NF5 B;  3U0X A;  5C4B A;  2I5E A;  2AGD A;  3PNN A;  1WT0 A;  4M2A A;  4Y9X A;  1VGZ A;  3USQ A;  5J49 A;  1JYK A;  4AAW A;  5C48 A;  2Y6P A;  3U0Y A;  3CKV A;  2QH5 A;  4IRP A;  5FV9 A;  5C1H A;  1ZDG A;  1FWY A;  1R7V A;  3V91 A;  2RIX A;  2V0I A;  1FZW A;  1H5R A;  2RJ5 A;  4E1K A;  5C3D A;  4ASY A;  1HJJ A;  1G1L A;  4L41 C;  2WAW A;  4B4B A;  1ON8 A;  1TVY A;  1HM0 A;  1LL3 A;  4Y7F A;  2YES A;  1YP2 A;  2JCK A;  4B5B A;  2WVK A;  3I0H A;  2JCL A;  1EZI A;  1S4O A;  1H7T A;  3CU0 A;  3V8Z A;  1FO9 A;  3V0P A;  3D8V A;  1VGU A;  1ZI5 A;  1GX4 A;  3SX5 A;  2YQC A;  3ZLL A;  4KPX A;  5IDS A;  2Y4M A;  2Z87 A;  3I0G A;  3POL A;  1MP4 A;  3JTJ A;  1H7F A;  2MZB A;  1LVW A;  4KC2 A;  4FQW A;  3V0O A;  4D11 C;  3SXD A;  1H5S A;  4KNX A;  4FRQ A;  1VH1 A;  5BXC A;  4HO5 A;  1GX0 A;  4LW3 A;  4D0T A;  1FXJ A;  3JUJ A;  2FYD B;  4G3P A;  4NAL A;  2AM4 A;  4GBP A;  4NAK A;  5AJP A;  5CQM X;  1O7Q A;  1G3L A;  5C8R A;  2W0V A;  3IOJ A;  3OH4 A;  1G0R A;  2P72 A;  1PZY B;  4LW6 A;  1ZIZ A;  2XWN A;  5AJN A;  2ZU7 A;  2AM5 A;  4HO4 A;  1GQ9 A;  2QGI A;  2BO7 A;  1VZU A;  5C1G A;  2Y4K A;  3SXB A;  1LZI A;  3SX8 A;  2D7I A;  1ZJ1 A;  4B2X A;  1VGT A;  2YCM A;  4FRL A;  4EEM A;  1HM8 A;  2RIY A;  2BO6 A;  4M28 A;  1O23 B;  5IFY A;  5CQP A;  4HO3 A;  1NMM B;  3BCV A;  1K4V A;  1WT2 A;  2OI6 A;  4DE7 A;  1FG5 N;  1VM8 A;  1E5K A;  5C1L A;  5CQL X;  2VFZ A;  2V0K A;  2VSH A;  2ZU9 A;  2OEG A;  1GWW A;  4ASJ A;  5C4D A;  5EJZ A;  2VD4 A;  1FRW A;  3OH1 A;  3LW6 A;  2YC5 A;  4CJC A;  5JQQ A;  2YQS A;  3SXE A;  1VZX A;  2UX8 A;  3T7M A;  4XWI A;  4G3Q A;  3Q7U A;  3U2W A;  1ZJ2 A;  1H7E A;  3I0I X;  2E3D A;  2AM3 A;  1JYL A;  1H5R B;  1YP3 A;  3I0C A;  1R81 A;  5I1F A;  2D0J A;  1TZF A;  2XWL A;  3V0M A;  2RJ6 A;  1W77 A;  1H7L A;  2PGV A;  3PKP A;  1I52 A;  5C38 A;  4JD0 A;  2RJ8 A;  5C4E A;  2BO4 A;  4FRM A;  1OMZ A;  1VPA A;  3OKR A;  1ZI4 A;  2YQJ A;  3V0N A;  2V0J A;  1XHB A;  4Y6U A;  1WSZ A;  1S4N A;  2VSI A;  3CGX A;  3SXG A;  3V0L A;  5C49 A;  1IIN A;  4HG6 A;  1YP4 A;  2WE9 A;  2CU2 A;  2I7B A;  4KRV A;  1LZ7 A;  2JCO A;  4D48 A;  1G2V A;  4EE4 A;  1ZI1 A;  3TQD A;  1V84 A;  1SS9 A;  4AYL A;  4KC4 A;  1WT1 A;  4B42 A;  5CMH A;  4FRH A;  4HO0 A;  1MC3 A;  2WVM A;  3DJ4 A;  1R82 A;  3R3I A;  3IOI A;  4KC1 A;  3Q80 A;  3V8Y A;  3U2V A;  5L6S A;  4KPZ A;  5CMI A;  4P02 A;  2BO8 A;  3T7O A;  1H5S B;  4YS8 A;  2XMH A;  3K8E A;  4ECM A;  1FR9 A;  4KT7 A;  1H7Q A;  4NAI A;  4Y7G A;  1XZ6 A;  2X60 A;  4FCU A;  1JVG A;  3ZLK A;  1G95 A;  4P00 A;  3JUK A;  2A8U A;  2W0W A;  2ICX A;  2O1H A;  2O1G A;  4CJB A;  1MP3 A;  5DDT A;  4DDZ A;  1G93 A;  3SXC A;  2VS3 A;  3OH2 A;  2X5S A;  4Y7U A;  5FU0 A;  4HOC A;  5C36 A;  1V82 A;  3RMV A;  2JCJ A;  1R7T A;  2A8W A;  2RIZ A;  3OC9 A;  1ON6 A;  2GGO A;  5L6V A;  3NGW A;  1ZJ3 A;  2FYB A;  4UEG A;  2Y4L A;  3FOQ A;  2P6W A;  5EJ1 A;  4FRO A;  2E8B A;  2NXV A;  3CKQ A;  3U2U A;  3F1Y A;  3F1C A;  1INI A;  2PA4 A;  5DDV A;  3I0D A;  1QGQ A;  3V0Q A;  4G3S A;  1G97 A;  5EIY A;  2APC A;  1ZJ0 A;  2Y7A A;  2RJ7 A;  4BMA A;  5C3B A;  4D11 A;  1VIC A;  4FRB A;  3ST8 A;  2QKX A;  1H5T A;  3HL3 A;  2PX7 A;  2WGZ A;  2XWM A;  4FCE A;  1LL2 A;  1JV1 A;  1H7H A;  1WVC A;  1H3M A;  1ZCT A;  2RIT A;  2VXM A;  3D98 A;  1LZ0 A;  3N9W A;  5FYE A;  1FXO A;  1ZJP A;  2VS5 A;  2GGQ A;  3CKO A;  4KNR A;  2I5K A;  5C3A A;  5IDT A;  4AC3 A;  1H4D A;  2YQH A;  4FRA A;  1O0R A;  3CKJ A;  3I0E A;  1H7G A;  2P73 A;  5FTS A;  1FGX A;  2Z86 A;  3O3P A;  2VS4 A;  4EEG A;  1VZT A;  1FR8 A;  1ZCV A;  1ZCY A;  1EYR A;  2ZU8 A;  1NWG B;  4EVW A;  1MP5 A;  1KWS A;  3R2W A;  1JV3 A;  1INJ A;  1NQI B;  4ZDQ A;  5CQN X;  2OI5 A;  2FYC B;  2D7R A;  4Y6N A;  4NAN A;  1ZDF A;  2FY7 A;  3I0F A;  5CQO A;  4AYJ A;  3EE5 A;  4HO9 A;  2X5Z A;  3QVB A;  1QGS A;  3DK5 A;  4EE5 A;  4FRP A;  1YRO B;  1ZHJ A;  1R80 A;  1G8O A;  2FYA A;  5CMJ A;  1PZT A;  3OH0 A;  2X65 A;  1G23 A;  1FO8 A;  5AJO A;  1GQC A;  1WT3 A;  2FFV A;  1FOA A;  4B4G A;  3CKN A;  1R7Y A;  1Z90 A;  3E26 A;  1OMX A;  3SX3 A;  4M4K A;  4R7P A;  1GA8 A;  1GWV A;  2Y4J A;  4D0Z A;  3OH3 A;  4FRD A;  1OQM B;  1H5S C;  3FWW A;  1QWJ A;  1ZCU A;  4Y7T A;  1O7O A;  2AE7 A;  4ARW A;  4B3U A;  5C4C A;  3GUE A;  2XME A;  5CMG X;  4HCQ A;  1HJL A;  1R7U A;  2O1F A;  1R7X A;  3PKQ A;  1W55 A;  4BQH A;  2RJ4 A;  4M2B A;  4EE3 A;  2WVL A; 
#chains in the Genus database with same CATH topology
 2AEC A;  4MND A;  1S4P A;  2V0L A;  2OEF A;  3OAM A;  4EEA A;  4HO2 A;  2RJ9 A;  2Q4J A;  4HO8 A;  2FFU A;  1H5T B;  2V0H A;  3RMW A;  4DEC A;  1V83 A;  3U2T A;  4JIS A;  4KQL A;  5C47 A;  1TW5 A;  1NKH B;  3DUV A;  4MYB A;  3RSB A;  4Y62 A;  3ZGG A;  1FGG A;  3D5N A;  4J18 A;  3SPT A;  5FUH A;  1HM9 A;  1H5S D;  1QG8 A;  4G87 A;  2YC3 A;  3E25 A;  5CMF X;  4FIX A;  4EEO A;  1LL0 A;  3KIA A;  1ZI3 A;  1H4C A;  4B4M A;  4CJ8 A;  2RJ0 A;  2PGY A;  2DPW A;  1ZJO A;  3I0J A;  1H4E A;  4FRE A;  3I0K A;  3TZT A;  3ZF8 A;  4Y64 A;  3BRK X;  3IOH A;  1HV9 A;  3SXA A;  1IIM A;  2RJ1 A;  4HO6 A;  5FTV A;  3ZGF A;  1VGW A;  2AES A;  4KXO A;  3USR A;  4B2W A;  2AH9 A;  1VH3 A;  3SX7 A;  3K8D A;  4CVH A;  3OGZ A;  3V90 A;  5FU8 A;  1NHE B;  1G9R A;  1TW1 A;  1LZJ A;  1JVD A;  4IRQ A;  2WEE A;  4Y63 A;  3Q4S A;  4K6R A;  4Y7V A;  2OI7 A;  1W57 A;  3U2X A;  3T7N A;  2ICY A;  3I0L A;  2VXL A;  5HS2 A;  5C4F A;  4C2S A;  1NF5 B;  3U0X A;  5C4B A;  2I5E A;  2AGD A;  3PNN A;  1WT0 A;  4M2A A;  4Y9X A;  1VGZ A;  3USQ A;  5J49 A;  1JYK A;  4AAW A;  5C48 A;  2Y6P A;  3U0Y A;  3CKV A;  2QH5 A;  4FIY A;  4IRP A;  5FV9 A;  5C1H A;  1ZDG A;  1FWY A;  1R7V A;  3V91 A;  2RIX A;  2V0I A;  1FZW A;  1H5R A;  2RJ5 A;  4E1K A;  5C3D A;  4ASY A;  1HJJ A;  1G1L A;  4L41 C;  2WAW A;  4B4B A;  1ON8 A;  1TVY A;  1HM0 A;  1LL3 A;  2C0N A;  4Y7F A;  2YES A;  1YP2 A;  2JCK A;  4B5B A;  2WVK A;  3I0H A;  2JCL A;  5D92 A;  1EZI A;  1S4O A;  1H7T A;  3CU0 A;  3V8Z A;  1FO9 A;  3V0P A;  3D8V A;  1VGU A;  1ZI5 A;  1GX4 A;  3SX5 A;  2YQC A;  3ZLL A;  4KPX A;  5IDS A;  2Y4M A;  2Z87 A;  3I0G A;  3POL A;  1MP4 A;  3JTJ A;  1H7F A;  2MZB A;  1LVW A;  4KC2 A;  4FQW A;  3V0O A;  4D11 C;  3SXD A;  1H5S A;  4KNX A;  4FRQ A;  1VH1 A;  5BXC A;  4HO5 A;  1GX0 A;  4LW3 A;  4D0T A;  1FXJ A;  3JUJ A;  2FYD B;  4G3P A;  4NAL A;  2AM4 A;  4GBP A;  4NAK A;  5AJP A;  5CQM X;  1O7Q A;  1G3L A;  5C8R A;  2W0V A;  3IOJ A;  3OH4 A;  1G0R A;  2P72 A;  1PZY B;  4LW6 A;  4O6N A;  1ZIZ A;  2XWN A;  5AJN A;  2ZU7 A;  2AM5 A;  4HO4 A;  1GQ9 A;  2QGI A;  2BO7 A;  1VZU A;  5C1G A;  2Y4K A;  3SXB A;  1LZI A;  3SX8 A;  2D7I A;  1ZJ1 A;  4B2X A;  1VGT A;  2YCM A;  4FRL A;  4EEM A;  1HM8 A;  2RIY A;  2BO6 A;  4M28 A;  1O23 B;  5IFY A;  5CQP A;  4HO3 A;  1NMM B;  3BCV A;  5D91 A;  1K4V A;  1WT2 A;  2OI6 A;  4DE7 A;  1FG5 N;  1VM8 A;  1E5K A;  5C1L A;  4Q7C A;  5CQL X;  2VFZ A;  2V0K A;  2VSH A;  2ZU9 A;  2OEG A;  1GWW A;  4ASJ A;  5C4D A;  5EJZ A;  2VD4 A;  1FRW A;  3OH1 A;  3LW6 A;  2YC5 A;  4CJC A;  5JQQ A;  2YQS A;  3SXE A;  1VZX A;  2UX8 A;  3T7M A;  4XWI A;  4G3Q A;  3Q7U A;  3U2W A;  1ZJ2 A;  1H7E A;  3I0I X;  4MIX A;  2E3D A;  2AM3 A;  1JYL A;  1H5R B;  1YP3 A;  3I0C A;  1R81 A;  5I1F A;  2D0J A;  1TZF A;  2XWL A;  3V0M A;  2RJ6 A;  1W77 A;  1H7L A;  2PGV A;  3PKP A;  1I52 A;  5C38 A;  4JD0 A;  2RJ8 A;  5C4E A;  2BO4 A;  4FRM A;  1OMZ A;  1VPA A;  3OKR A;  1ZI4 A;  2YQJ A;  3V0N A;  2V0J A;  2VK9 A;  1XHB A;  4Y6U A;  1WSZ A;  1S4N A;  2VSI A;  3CGX A;  3SXG A;  3V0L A;  5C49 A;  1IIN A;  4HG6 A;  1YP4 A;  2WE9 A;  2CU2 A;  2I7B A;  4KRV A;  1LZ7 A;  2JCO A;  4D48 A;  1G2V A;  4EE4 A;  1ZI1 A;  3TQD A;  1V84 A;  1SS9 A;  4AYL A;  4KC4 A;  1WT1 A;  4B42 A;  5CMH A;  4FRH A;  4HO0 A;  1MC3 A;  2WVM A;  3DJ4 A;  1R82 A;  3R3I A;  3IOI A;  4KC1 A;  2J0B A;  3Q80 A;  3V8Y A;  3U2V A;  5L6S A;  4KPZ A;  5CMI A;  4P02 A;  2BO8 A;  3T7O A;  1H5S B;  4YS8 A;  2XMH A;  3K8E A;  4ECM A;  1FR9 A;  4KT7 A;  1H7Q A;  2J0A A;  4NAI A;  4Y7G A;  1XZ6 A;  2X60 A;  4FCU A;  1JVG A;  3ZLK A;  1G95 A;  4P00 A;  3JUK A;  2A8U A;  2W0W A;  2ICX A;  2O1H A;  2O1G A;  4CJB A;  1MP3 A;  5DDT A;  4DDZ A;  1G93 A;  3SXC A;  2VS3 A;  3OH2 A;  2X5S A;  4Y7U A;  5FU0 A;  4HOC A;  5C36 A;  1V82 A;  3RMV A;  2JCJ A;  4O6M A;  1R7T A;  2A8W A;  2RIZ A;  3OC9 A;  1ON6 A;  2GGO A;  5L6V A;  3NGW A;  1ZJ3 A;  2FYB A;  4UEG A;  2Y4L A;  3FOQ A;  2P6W A;  5EJ1 A;  4FRO A;  2E8B A;  2NXV A;  3CKQ A;  3U2U A;  3F1Y A;  3F1C A;  1INI A;  2PA4 A;  5DDV A;  3I0D A;  1QGQ A;  3V0Q A;  4G3S A;  1G97 A;  5EIY A;  2APC A;  1ZJ0 A;  2Y7A A;  2RJ7 A;  4BMA A;  5C3B A;  4D11 A;  1VIC A;  4FRB A;  3ST8 A;  2QKX A;  1H5T A;  3HL3 A;  2PX7 A;  2WGZ A;  2XWM A;  4FCE A;  1LL2 A;  1JV1 A;  1H7H A;  1WVC A;  1H3M A;  1ZCT A;  2RIT A;  2VXM A;  3D98 A;  1LZ0 A;  3N9W A;  5FYE A;  1FXO A;  1ZJP A;  2VS5 A;  2GGQ A;  3CKO A;  4KNR A;  2I5K A;  5C3A A;  5IDT A;  4AC3 A;  1H4D A;  2YQH A;  4FRA A;  1O0R A;  3CKJ A;  3I0E A;  1H7G A;  2P73 A;  5FTS A;  1FGX A;  2Z86 A;  3O3P A;  2VS4 A;  4EEG A;  1VZT A;  1FR8 A;  1ZCV A;  1ZCY A;  1EYR A;  2ZU8 A;  1NWG B;  4EVW A;  1MP5 A;  1KWS A;  3R2W A;  1JV3 A;  1INJ A;  1NQI B;  4ZDQ A;  5CQN X;  2OI5 A;  2FYC B;  2D7R A;  4Y6N A;  4NAN A;  1ZDF A;  2FY7 A;  3I0F A;  5CQO A;  4AYJ A;  3EE5 A;  4HO9 A;  2X5Z A;  3QVB A;  1QGS A;  3DK5 A;  4EE5 A;  4FRP A;  1YRO B;  1ZHJ A;  1R80 A;  1G8O A;  2FYA A;  5CMJ A;  1PZT A;  3OH0 A;  2X65 A;  1G23 A;  1FO8 A;  5AJO A;  1GQC A;  1WT3 A;  2FFV A;  1FOA A;  4B4G A;  3CKN A;  1R7Y A;  1Z90 A;  3E26 A;  1OMX A;  3SX3 A;  4M4K A;  4R7P A;  1GA8 A;  1GWV A;  2Y4J A;  4D0Z A;  3OH3 A;  4FRD A;  1OQM B;  1H5S C;  3FWW A;  1QWJ A;  1ZCU A;  4Y7T A;  1O7O A;  2AE7 A;  4ARW A;  4B3U A;  5C4C A;  3GUE A;  2XME A;  5CMG X;  4HCQ A;  1HJL A;  1R7U A;  2O1F A;  1R7X A;  3PKQ A;  1W55 A;  4BQH A;  2RJ4 A;  4M2B A;  4EE3 A;  2WVL A; 
#chains in the Genus database with same CATH homology
 2AEC A;  4MND A;  1S4P A;  2V0L A;  2OEF A;  3OAM A;  4EEA A;  4HO2 A;  2RJ9 A;  2Q4J A;  4HO8 A;  2FFU A;  1H5T B;  2V0H A;  3RMW A;  4DEC A;  1V83 A;  3U2T A;  4JIS A;  4KQL A;  5C47 A;  1TW5 A;  1NKH B;  3DUV A;  4MYB A;  3RSB A;  4Y62 A;  3ZGG A;  1FGG A;  3D5N A;  4J18 A;  3SPT A;  5FUH A;  1HM9 A;  1H5S D;  1QG8 A;  4G87 A;  2YC3 A;  3E25 A;  5CMF X;  4FIX A;  4EEO A;  1LL0 A;  3KIA A;  1ZI3 A;  1H4C A;  4B4M A;  4CJ8 A;  2RJ0 A;  2PGY A;  2DPW A;  1ZJO A;  3I0J A;  1H4E A;  4FRE A;  3I0K A;  3TZT A;  3ZF8 A;  4Y64 A;  3BRK X;  3IOH A;  1HV9 A;  3SXA A;  1IIM A;  2RJ1 A;  4HO6 A;  5FTV A;  3ZGF A;  1VGW A;  2AES A;  4KXO A;  3USR A;  4B2W A;  2AH9 A;  1VH3 A;  3SX7 A;  3K8D A;  4CVH A;  3OGZ A;  3V90 A;  5FU8 A;  1NHE B;  1G9R A;  1TW1 A;  1LZJ A;  1JVD A;  4IRQ A;  2WEE A;  4Y63 A;  3Q4S A;  4K6R A;  4Y7V A;  2OI7 A;  1W57 A;  3U2X A;  3T7N A;  2ICY A;  3I0L A;  2VXL A;  5HS2 A;  5C4F A;  4C2S A;  1NF5 B;  3U0X A;  5C4B A;  2I5E A;  2AGD A;  3PNN A;  1WT0 A;  4M2A A;  4Y9X A;  1VGZ A;  3USQ A;  5J49 A;  1JYK A;  4AAW A;  5C48 A;  2Y6P A;  3U0Y A;  3CKV A;  2QH5 A;  4FIY A;  4IRP A;  5FV9 A;  5C1H A;  1ZDG A;  1FWY A;  1R7V A;  3V91 A;  2RIX A;  2V0I A;  1FZW A;  1H5R A;  2RJ5 A;  4E1K A;  5C3D A;  4ASY A;  1HJJ A;  1G1L A;  4L41 C;  2WAW A;  4B4B A;  1ON8 A;  1TVY A;  1HM0 A;  1LL3 A;  2C0N A;  4Y7F A;  2YES A;  1YP2 A;  2JCK A;  4B5B A;  2WVK A;  3I0H A;  2JCL A;  5D92 A;  1EZI A;  1S4O A;  1H7T A;  3CU0 A;  3V8Z A;  1FO9 A;  3V0P A;  3D8V A;  1VGU A;  1ZI5 A;  1GX4 A;  3SX5 A;  2YQC A;  3ZLL A;  4KPX A;  5IDS A;  2Y4M A;  2Z87 A;  3I0G A;  3POL A;  1MP4 A;  3JTJ A;  1H7F A;  2MZB A;  1LVW A;  4KC2 A;  4FQW A;  3V0O A;  4D11 C;  3SXD A;  1H5S A;  4KNX A;  4FRQ A;  1VH1 A;  5BXC A;  4HO5 A;  1GX0 A;  4LW3 A;  4D0T A;  1FXJ A;  3JUJ A;  2FYD B;  4G3P A;  4NAL A;  2AM4 A;  4GBP A;  4NAK A;  5AJP A;  5CQM X;  1O7Q A;  1G3L A;  5C8R A;  2W0V A;  3IOJ A;  3OH4 A;  1G0R A;  2P72 A;  1PZY B;  4LW6 A;  4O6N A;  1ZIZ A;  2XWN A;  5AJN A;  2ZU7 A;  2AM5 A;  4HO4 A;  1GQ9 A;  2QGI A;  2BO7 A;  1VZU A;  5C1G A;  2Y4K A;  3SXB A;  1LZI A;  3SX8 A;  2D7I A;  1ZJ1 A;  4B2X A;  1VGT A;  2YCM A;  4FRL A;  4EEM A;  1HM8 A;  2RIY A;  2BO6 A;  4M28 A;  1O23 B;  5IFY A;  5CQP A;  4HO3 A;  1NMM B;  3BCV A;  5D91 A;  1K4V A;  1WT2 A;  2OI6 A;  4DE7 A;  1FG5 N;  1VM8 A;  1E5K A;  5C1L A;  4Q7C A;  5CQL X;  2VFZ A;  2V0K A;  2VSH A;  2ZU9 A;  2OEG A;  1GWW A;  4ASJ A;  5C4D A;  5EJZ A;  2VD4 A;  1FRW A;  3OH1 A;  3LW6 A;  2YC5 A;  4CJC A;  5JQQ A;  2YQS A;  3SXE A;  1VZX A;  2UX8 A;  3T7M A;  4XWI A;  4G3Q A;  3Q7U A;  3U2W A;  1ZJ2 A;  1H7E A;  3I0I X;  4MIX A;  2E3D A;  2AM3 A;  1JYL A;  1H5R B;  1YP3 A;  3I0C A;  1R81 A;  5I1F A;  2D0J A;  1TZF A;  2XWL A;  3V0M A;  2RJ6 A;  1W77 A;  1H7L A;  2PGV A;  3PKP A;  1I52 A;  5C38 A;  4JD0 A;  2RJ8 A;  5C4E A;  2BO4 A;  4FRM A;  1OMZ A;  1VPA A;  3OKR A;  1ZI4 A;  2YQJ A;  3V0N A;  2V0J A;  2VK9 A;  1XHB A;  4Y6U A;  1WSZ A;  1S4N A;  2VSI A;  3CGX A;  3SXG A;  3V0L A;  5C49 A;  1IIN A;  4HG6 A;  1YP4 A;  2WE9 A;  2CU2 A;  2I7B A;  4KRV A;  1LZ7 A;  2JCO A;  4D48 A;  1G2V A;  4EE4 A;  1ZI1 A;  3TQD A;  1V84 A;  1SS9 A;  4AYL A;  4KC4 A;  1WT1 A;  4B42 A;  5CMH A;  4FRH A;  4HO0 A;  1MC3 A;  2WVM A;  3DJ4 A;  1R82 A;  3R3I A;  3IOI A;  4KC1 A;  2J0B A;  3Q80 A;  3V8Y A;  3U2V A;  5L6S A;  4KPZ A;  5CMI A;  4P02 A;  2BO8 A;  3T7O A;  1H5S B;  4YS8 A;  2XMH A;  3K8E A;  4ECM A;  1FR9 A;  4KT7 A;  1H7Q A;  2J0A A;  4NAI A;  4Y7G A;  1XZ6 A;  2X60 A;  4FCU A;  1JVG A;  3ZLK A;  1G95 A;  4P00 A;  3JUK A;  2A8U A;  2W0W A;  2ICX A;  2O1H A;  2O1G A;  4CJB A;  1MP3 A;  5DDT A;  4DDZ A;  1G93 A;  3SXC A;  2VS3 A;  3OH2 A;  2X5S A;  4Y7U A;  5FU0 A;  4HOC A;  5C36 A;  1V82 A;  3RMV A;  2JCJ A;  4O6M A;  1R7T A;  2A8W A;  2RIZ A;  3OC9 A;  1ON6 A;  2GGO A;  5L6V A;  3NGW A;  1ZJ3 A;  2FYB A;  4UEG A;  2Y4L A;  3FOQ A;  2P6W A;  5EJ1 A;  4FRO A;  2E8B A;  2NXV A;  3CKQ A;  3U2U A;  3F1Y A;  3F1C A;  1INI A;  2PA4 A;  5DDV A;  3I0D A;  1QGQ A;  3V0Q A;  4G3S A;  1G97 A;  5EIY A;  2APC A;  1ZJ0 A;  2Y7A A;  2RJ7 A;  4BMA A;  5C3B A;  4D11 A;  1VIC A;  4FRB A;  3ST8 A;  2QKX A;  1H5T A;  3HL3 A;  2PX7 A;  2WGZ A;  2XWM A;  4FCE A;  1LL2 A;  1JV1 A;  1H7H A;  1WVC A;  1H3M A;  1ZCT A;  2RIT A;  2VXM A;  3D98 A;  1LZ0 A;  3N9W A;  5FYE A;  1FXO A;  1ZJP A;  2VS5 A;  2GGQ A;  3CKO A;  4KNR A;  2I5K A;  5C3A A;  5IDT A;  4AC3 A;  1H4D A;  2YQH A;  4FRA A;  1O0R A;  3CKJ A;  3I0E A;  1H7G A;  2P73 A;  5FTS A;  1FGX A;  2Z86 A;  3O3P A;  2VS4 A;  4EEG A;  1VZT A;  1FR8 A;  1ZCV A;  1ZCY A;  1EYR A;  2ZU8 A;  1NWG B;  4EVW A;  1MP5 A;  1KWS A;  3R2W A;  1JV3 A;  1INJ A;  1NQI B;  4ZDQ A;  5CQN X;  2OI5 A;  2FYC B;  2D7R A;  4Y6N A;  4NAN A;  1ZDF A;  2FY7 A;  3I0F A;  5CQO A;  4AYJ A;  3EE5 A;  4HO9 A;  2X5Z A;  3QVB A;  1QGS A;  3DK5 A;  4EE5 A;  4FRP A;  1YRO B;  1ZHJ A;  1R80 A;  1G8O A;  2FYA A;  5CMJ A;  1PZT A;  3OH0 A;  2X65 A;  1G23 A;  1FO8 A;  5AJO A;  1GQC A;  1WT3 A;  2FFV A;  1FOA A;  4B4G A;  3CKN A;  1R7Y A;  1Z90 A;  3E26 A;  1OMX A;  3SX3 A;  4M4K A;  4R7P A;  1GA8 A;  1GWV A;  2Y4J A;  4D0Z A;  3OH3 A;  4FRD A;  1OQM B;  1H5S C;  3FWW A;  1QWJ A;  1ZCU A;  4Y7T A;  1O7O A;  2AE7 A;  4ARW A;  4B3U A;  5C4C A;  3GUE A;  2XME A;  5CMG X;  4HCQ A;  1HJL A;  1R7U A;  2O1F A;  1R7X A;  3PKQ A;  1W55 A;  4BQH A;  2RJ4 A;  4M2B A;  4EE3 A;  2WVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...