2VS5A

The binding of udp-galactose by an active site mutant of alpha-1,3 galactosyltransferase (alpha3gt)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
283
structure length
283
Chain Sequence
LKLSDWFNPFKRPEVVTMTKWKAPVVWEGTYNRAVLDNYYAKQKITVGLTVFAVGRYIEHYLEEFLTSANKHFMVGHPVIFYIMVDDVSRMPLIELGPLRSFKVFKIKPEKRWQDISMMRMKTIGEHIVAHIQHEVDFLFCMDVDQVFQDKFGVETLGESVAQLQAWWYKADPNDFTYERRKESAAYIPFGEGDFYYHAAIFGGTPTQVLNITQECFKGILKDKKNDIEAQWHDQSHLNKYFLLNKPTKILSPEYCWDYHIGLPADIKLVKMSWQTKEYNVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N-ACETYLLACTOSAMINIDE ALPHA-1,3-GALACTOSYLTRANSFERASE
publication title Structural Basis of Udp-Galactose Binding by Alpha- 1,3-Galactosyltransferase (Alpha3Gt): Role of Negative Charge on Aspartic Acid 316 in Structure and Activity.
pubmed doi rcsb
source organism Bos taurus
total genus 105
structure length 283
sequence length 283
chains with identical sequence B
ec nomenclature ec 2.4.1.87: N-acetyllactosaminide 3-alpha-galactosyltransferase.
pdb deposition date 2008-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2vs5A00
1EZIA 4IRPA 4Y7GA 1G0RA 4Y62A 3OAMA 2VS5A 5C49A 3ZGGA 1FO8A 1H4CA 1VZXA 4M2AA 4Y63A 1S4NA 1JV3A 4UEGA 1O7QA 2ICXA 4CJ8A 4HO6A 1ZCYA 3CKJA 2V0HA 5IDTA 4M4KA 3CU0A 4HO5A 4D0TA 2P6WA 3I0IX 1G95A 1ZI3A 2X60A 2VS4A 2I7BA 1H5SA 2RJ1A 4KC4A 1FGXA 4B2WA 1ZJOA 4KC2A 5FV9A 1ZHJA 3I0KA 2XWNA 5FTVA 3SXEA 3K8DA 4DE7A 5CMJA 3OGZA 4KPXA 3T7NA 2FFVA 2QGIA 4Y7FA 1GQCA 1INIA 2PX7A 4IRQA 1VICA 3K8EA 2Y4MA 2FYDB 3ZLKA 1XHBA 3QVBA 1WVCA 1TW5A 1ZI4A 1FGGA 4KXOA 1K4VA 4KNRA 3SX7A 3V0NA 2JCOA 2PGVA 5FU0A 2VXLA 2I5KA 2X65A 3OH0A 1H4DA 1FR9A 1I52A 4D48A 1PZYB 3USRA 3ZF8A 1R7TA 1YP3A 5L6SA 1JYKA 1R7UA 2BO4A 2E8BA 2ZU9A 2YC5A 4G3SA 4HO3A 5AJPA 2AESA 4MNDA 4FRBA 1H5RA 5HS2A 1VGUA 1JV1A 2RJ0A 2XWMA 2BO6A 1QWJA 4GBPA 1NHEB 1QG8A 3OH2A 2RIXA 2GGQA 1R7XA 5EJZA 2Z87A 2JCKA 1H7QA 1NF5B 1OMZA 2AM5A 2Z86A 4K6RA 1S4OA 1E5KA 3POLA 3FOQA 4EEMA 4HO0A 1O7OA 1R7YA 3D98A 1G1LA 4EEOA 5IFYA 3GUEA 1GWWA 4HOCA 2QH5A 3SXBA 2YQHA 1G93A 2JCJA 2AE7A 1H7GA 5DDTA 1G8OA 1H5TA 2RJ8A 4D11C 5L6VA 1G3LA 1LZ0A 4B4GA 4EEGA 1MC3A 1VGWA 1ZCVA 5AJOA 5CMIA 5CQPA 4JISA 3SXCA 1ZCTA 1YP2A 3V0MA 2AM3A 1TZFA 1FRWA 2P72A 4NANA 1VPAA 2Y7AA 3ST8A 2FYCB 2O1GA 3T7OA 2V0LA 3TZTA 3LW6A 1HJJA 2VXMA 1WT2A 4B2XA 5CQMX 1ZI1A 1QGQA 5C4EA 1LZIA 3CKOA 5C38A 2XWLA 2XMEA 2JCLA 2RJ4A 5C47A 3V0LA 5CMHA 3V8ZA 3BRKX 3V0QA 1WT0A 2P73A 1FOAA 5C4BA 3OC9A 1NQIB 4HO4A 3U0XA 4Y64A 5CQLX 1GX4A 2GGOA 3SXGA 1ZJ0A 1H7HA 1VH1A 2D7IA 2YQSA 4AYLA 2WAWA 3I0LA 5C3AA 1R80A 1JYLA 2QKXA 3U2TA 2VSHA 1H7FA 1R81A 2ZU8A 4HO9A 3DUVA 4KRVA 4HCQA 5I1FA 4FRPA 2NXVA 1QGSA 4D11A 4Y7UA 4CVHA 1G97A 4CJBA 4D0ZA 2A8WA 1H3MA 1VGZA 4C2SA 1OQMB 4AAWA 4FQWA 2YC3A 4KNXA 4J18A 2WE9A 1GQ9A 5C36A 1O0RA 1G23A 3Q80A 3D8VA 4EE4A 1LL2A 1MP3A 2V0JA 4JD0A 1NKHB 2OI6A 1HJLA 2XMHA 4G87A 4BQHA 3ZGFA 2Y4JA 1YROB 3USQA 3EE5A 1FO9A 2X5SA 1OMXA 3NGWA 2YQCA 4LW6A 3O3PA 1H5RB 5EIYA 4ARWA 3U2XA 2AM4A 3OH4A 3R2WA 4Y6NA 2RIZA 1FXOA 4M2BA 4LW3A 1G9RA 1TW1A 2RJ7A 2OEGA 2VD4A 2I5EA 4FCEA 1HM0A 4KT7A 2V0IA 3PKQA 4KC1A 3SX5A 2OI7A 3U0YA 5AJNA 1VGTA 4EVWA 2RJ6A 3I0CA 5C1GA 2UX8A 4EE5A 1EYRA 5C1LA 1GWVA 5EJ1A 3SX8A 4B3UA 5C8RA 3CKQA 1ZCUA 3I0FA 5CMFX 3OKRA 3V8YA 5JQQA 2BO8A 2FFUA 1H5TB 1H4EA 1YP4A 4Y9XA 4E1KA 1ON8A 2PA4A 5C3DA 2V0KA 1NMMB 3OH1A 4AC3A 3JUKA 2APCA 3F1CA 4MYBA 4R7PA 2AH9A 3PKPA 4B42A 4CJCA 1XZ6A 1LL0A 3T7MA 4ASYA 3FWWA 1LL3A 2D7RA 3D5NA 3JUJA 1GX0A 3I0HA 1TVYA 1NWGB 1MP4A 1R7VA 2YESA 1H7LA 1ZDFA 4FRAA 2YQJA 4EE3A 3CGXA 2RIYA 1O23B 1W57A 3DK5A 1VZUA 3I0JA 2YCMA 4P02A 5C3BA 4DECA 1JVDA 1V82A 1ZJPA 4L41C 4HG6A 3V91A 2WGZA 5CMGX 1SS9A 4ZDQA 2WVKA 4HO2A 1PZTA 1VZTA 2FYAA 1S4PA 1H5SB 2O1HA 2MZBA 4M28A 5FU8A 3RMVA 2Y6PA 3DJ4A 5BXCA 4P00A 3U2VA 5IDSA 1H5SD 4G3PA 2W0WA 4B4BA 4FREA 5C1HA 4ECMA 2D0JA 1IIMA 3V90A 1ZJ1A 3SXDA 1FXJA 1KWSA 2OI5A 1WSZA 4FRMA 2PGYA 1FWYA 5J49A 1FZWA 1ZDGA 2A8UA 2RJ5A 4B5BA 2X5ZA 2FY7A 2Y4LA 4Y7TA 4AYJA 5FYEA 3KIAA 2OEFA 3CKVA 2ICYA 3U2WA 4HO8A 1ON6A 1ZIZA 4ASJA 4KPZA 3V0PA 4EEAA 1V84A 3OH3A 1W77A 3PNNA 1H7EA 2CU2A 5CQOA 4FROA 5FTSA 1V83A 2WVMA 3Q4SA 2VS3A 2Y4KA 3CKNA 1H7TA 5C4DA 2WEEA 4NAIA 1LZ7A 2AGDA 4YS8A 5CQNX 3F1YA 3E25A 3E26A 3IOHA 1JVGA 5DDVA 2E3DA 5C48A 2O1FA 3SXAA 3I0GA 3Q7UA 1ZI5A 4NALA 3RSBA 1INJA 4KQLA 2WVLA 4XWIA 1ZJ3A 2VSIA 2VFZA 4FRQA 2W0VA 4BMAA 1VM8A 3HL3A 3JTJA 1Z90A 5FUHA 4FRDA 4FRHA 1IINA 3U2UA 1H5SC 4Y7VA 4DDZA 2RJ9A 2RITA 2BO7A 1VH3A 4FCUA 2Q4JA 1FR8A 4NAKA 5C4FA 5C4CA 3R3IA 1W55A 3V0OA 1WT3A 4FRLA 3SX3A 2DPWA 3N9WA 2FYBA 1HM8A 1LVWA 4Y6UA 3IOJA 1FG5N 4B4MA 4G3QA 3TQDA 1HM9A 1GA8A 3RMWA 1LZJA 3ZLLA 2AECA 2ZU7A 3I0DA 1ZJ2A 3IOIA 1HV9A 1MP5A 3SPTA 1WT1A 1R82A 3BCVA 3I0EA 1G2VA
chains in the Genus database with same CATH superfamily
1EZIA 4IRPA 4Y7GA 1G0RA 4Y62A 3OAMA 2VS5A 5C49A 3ZGGA 1FO8A 1H4CA 1VZXA 4M2AA 4Y63A 1S4NA 1JV3A 4UEGA 1O7QA 2ICXA 4CJ8A 4HO6A 1ZCYA 3CKJA 2V0HA 5IDTA 4M4KA 3CU0A 4HO5A 4D0TA 2P6WA 3I0IX 1G95A 1ZI3A 2X60A 2VS4A 2I7BA 1H5SA 2RJ1A 4KC4A 1FGXA 4B2WA 1ZJOA 4KC2A 5FV9A 1ZHJA 3I0KA 2XWNA 5FTVA 3SXEA 3K8DA 4DE7A 5CMJA 3OGZA 4KPXA 3T7NA 2FFVA 2QGIA 4Y7FA 1GQCA 1INIA 2PX7A 4IRQA 1VICA 3K8EA 2Y4MA 2FYDB 3ZLKA 1XHBA 3QVBA 1WVCA 1TW5A 1ZI4A 1FGGA 4KXOA 1K4VA 4KNRA 3SX7A 3V0NA 2JCOA 2PGVA 5FU0A 2VXLA 2I5KA 2X65A 3OH0A 1H4DA 1FR9A 1I52A 4D48A 1PZYB 3USRA 3ZF8A 1R7TA 1YP3A 5L6SA 1JYKA 1R7UA 2BO4A 2E8BA 2ZU9A 2YC5A 4G3SA 4HO3A 5AJPA 2AESA 4MNDA 4FRBA 1H5RA 5HS2A 1VGUA 1JV1A 2RJ0A 2XWMA 2BO6A 1QWJA 4GBPA 1NHEB 1QG8A 3OH2A 2RIXA 2GGQA 1R7XA 5EJZA 2Z87A 2JCKA 1H7QA 1NF5B 1OMZA 2AM5A 2Z86A 4K6RA 1S4OA 4O6MA 1E5KA 3POLA 3FOQA 4EEMA 4HO0A 1O7OA 2J0AA 1R7YA 3D98A 1G1LA 4EEOA 5IFYA 3GUEA 1GWWA 5D91A 4HOCA 2QH5A 3SXBA 2YQHA 1G93A 2JCJA 2AE7A 1H7GA 5DDTA 1G8OA 1H5TA 2RJ8A 4D11C 5L6VA 1G3LA 1LZ0A 4B4GA 4EEGA 1MC3A 1VGWA 1ZCVA 5AJOA 5CMIA 5CQPA 4JISA 3SXCA 1ZCTA 1YP2A 3V0MA 2AM3A 1TZFA 1FRWA 2P72A 4NANA 1VPAA 2Y7AA 3ST8A 2FYCB 2O1GA 3T7OA 2V0LA 3TZTA 3LW6A 1HJJA 2VXMA 1WT2A 4B2XA 5CQMX 1ZI1A 1QGQA 5C4EA 1LZIA 3CKOA 5C38A 2XWLA 2XMEA 2JCLA 2RJ4A 5C47A 3V0LA 5CMHA 3V8ZA 3BRKX 3V0QA 1WT0A 2P73A 1FOAA 5C4BA 3OC9A 1NQIB 4HO4A 3U0XA 4Y64A 5CQLX 4O6NA 1GX4A 2GGOA 3SXGA 1ZJ0A 1H7HA 1VH1A 2D7IA 2YQSA 4AYLA 2WAWA 3I0LA 5C3AA 1R80A 1JYLA 2QKXA 3U2TA 2VSHA 5D92A 1H7FA 1R81A 2ZU8A 4HO9A 3DUVA 4KRVA 4HCQA 5I1FA 4FRPA 2NXVA 1QGSA 4D11A 4Y7UA 4CVHA 1G97A 4CJBA 4D0ZA 2A8WA 1H3MA 1VGZA 4C2SA 1OQMB 4AAWA 4FQWA 2YC3A 4KNXA 4J18A 2WE9A 1GQ9A 5C36A 1O0RA 1G23A 3Q80A 3D8VA 4EE4A 1LL2A 1MP3A 2V0JA 4JD0A 1NKHB 2OI6A 1HJLA 2XMHA 4G87A 2VK9A 3ZGFA 4BQHA 2Y4JA 1YROB 3USQA 3EE5A 1FO9A 2X5SA 1OMXA 3NGWA 2YQCA 4LW6A 3O3PA 1H5RB 5EIYA 4ARWA 3U2XA 2AM4A 3OH4A 3R2WA 4Y6NA 2RIZA 1FXOA 4M2BA 4LW3A 1G9RA 1TW1A 2RJ7A 2OEGA 2VD4A 4MIXA 2I5EA 4FCEA 1HM0A 4KT7A 2V0IA 3PKQA 4KC1A 3SX5A 2OI7A 3U0YA 5AJNA 1VGTA 4EVWA 2RJ6A 3I0CA 5C1GA 2UX8A 4EE5A 1EYRA 5C1LA 1GWVA 5EJ1A 3SX8A 4B3UA 5C8RA 3CKQA 1ZCUA 3I0FA 5CMFX 3OKRA 3V8YA 5JQQA 2BO8A 2FFUA 1H5TB 1H4EA 1YP4A 4Y9XA 4E1KA 1ON8A 2PA4A 5C3DA 2V0KA 1NMMB 3OH1A 4Q7CA 3JUKA 4AC3A 2APCA 3F1CA 4MYBA 4R7PA 2AH9A 3PKPA 4B42A 2C0NA 4FIYA 4CJCA 1XZ6A 1LL0A 3T7MA 4ASYA 3FWWA 1LL3A 2D7RA 3D5NA 3JUJA 1GX0A 3I0HA 1TVYA 1NWGB 1MP4A 1R7VA 2YESA 1H7LA 1ZDFA 4FRAA 2YQJA 4EE3A 4FIXA 3CGXA 2RIYA 1O23B 1W57A 3DK5A 1VZUA 3I0JA 2YCMA 4P02A 5C3BA 4DECA 1JVDA 1V82A 1ZJPA 4L41C 4HG6A 3V91A 2WGZA 5CMGX 1SS9A 4ZDQA 2WVKA 4HO2A 1PZTA 1VZTA 2FYAA 1S4PA 1H5SB 2O1HA 2MZBA 4M28A 5FU8A 3RMVA 2Y6PA 3DJ4A 5BXCA 4P00A 3U2VA 5IDSA 1H5SD 4G3PA 2W0WA 4B4BA 4FREA 5C1HA 4ECMA 2D0JA 1IIMA 3V90A 1ZJ1A 2J0BA 3SXDA 1FXJA 1KWSA 2OI5A 1WSZA 4FRMA 2PGYA 1FWYA 5J49A 1FZWA 1ZDGA 2A8UA 2RJ5A 4B5BA 2X5ZA 2FY7A 2Y4LA 4Y7TA 4AYJA 5FYEA 3KIAA 2OEFA 3CKVA 2ICYA 3U2WA 4HO8A 1ON6A 1ZIZA 4ASJA 4KPZA 3V0PA 4EEAA 1V84A 3OH3A 1W77A 3PNNA 1H7EA 2CU2A 5CQOA 4FROA 5FTSA 1V83A 2WVMA 3Q4SA 2VS3A 2Y4KA 3CKNA 1H7TA 5C4DA 2WEEA 4NAIA 1LZ7A 2AGDA 4YS8A 5CQNX 3F1YA 3E25A 3E26A 3IOHA 1JVGA 5DDVA 2E3DA 5C48A 2O1FA 3SXAA 3I0GA 3Q7UA 1ZI5A 4NALA 3RSBA 1INJA 4KQLA 2WVLA 4XWIA 1ZJ3A 2VSIA 2VFZA 4FRQA 2W0VA 4BMAA 1VM8A 3HL3A 3JTJA 1Z90A 5FUHA 4FRDA 4FRHA 1IINA 3U2UA 1H5SC 4Y7VA 4DDZA 2RJ9A 2RITA 2BO7A 1VH3A 4FCUA 2Q4JA 1FR8A 4NAKA 5C4FA 5C4CA 3R3IA 1W55A 3V0OA 1WT3A 4FRLA 3SX3A 2DPWA 3N9WA 2FYBA 1HM8A 1LVWA 4Y6UA 3IOJA 1FG5N 4B4MA 4G3QA 3TQDA 1HM9A 1GA8A 3RMWA 1LZJA 3ZLLA 2AECA 2ZU7A 3I0DA 1ZJ2A 3IOIA 1HV9A 1MP5A 3SPTA 1WT1A 1R82A 3BCVA 3I0EA 1G2VA
chains in the Genus database with same CATH topology
1EZIA 4IRPA 4Y7GA 1G0RA 4Y62A 3OAMA 2VS5A 5C49A 3ZGGA 1FO8A 1H4CA 1VZXA 4M2AA 4Y63A 1S4NA 1JV3A 4UEGA 1O7QA 2ICXA 4CJ8A 4HO6A 1ZCYA 3CKJA 2V0HA 5IDTA 4M4KA 3CU0A 4HO5A 4D0TA 2P6WA 3I0IX 1G95A 1ZI3A 2X60A 2VS4A 2I7BA 1H5SA 2RJ1A 4KC4A 1FGXA 4B2WA 1ZJOA 4KC2A 5FV9A 1ZHJA 3I0KA 2XWNA 5FTVA 3SXEA 3K8DA 4DE7A 5CMJA 3OGZA 4KPXA 3T7NA 2FFVA 2QGIA 4Y7FA 1GQCA 1INIA 2PX7A 4IRQA 1VICA 3K8EA 2Y4MA 2FYDB 3ZLKA 1XHBA 3QVBA 1WVCA 1TW5A 1ZI4A 1FGGA 4KXOA 1K4VA 4KNRA 3SX7A 3V0NA 2JCOA 2PGVA 5FU0A 2VXLA 2I5KA 2X65A 3OH0A 1H4DA 1FR9A 1I52A 4D48A 1PZYB 3USRA 3ZF8A 1R7TA 1YP3A 5L6SA 1JYKA 1R7UA 2BO4A 2E8BA 2ZU9A 2YC5A 4G3SA 4HO3A 5AJPA 2AESA 4MNDA 4FRBA 1H5RA 5HS2A 1VGUA 1JV1A 2RJ0A 2XWMA 2BO6A 1QWJA 4GBPA 1NHEB 1QG8A 3OH2A 2RIXA 2GGQA 1R7XA 5EJZA 2Z87A 2JCKA 1H7QA 1NF5B 1OMZA 2AM5A 2Z86A 4K6RA 1S4OA 4O6MA 1E5KA 3POLA 3FOQA 4EEMA 4HO0A 1O7OA 2J0AA 1R7YA 3D98A 1G1LA 4EEOA 5IFYA 3GUEA 1GWWA 5D91A 4HOCA 2QH5A 3SXBA 2YQHA 1G93A 2JCJA 2AE7A 1H7GA 5DDTA 1G8OA 1H5TA 2RJ8A 4D11C 5L6VA 1G3LA 1LZ0A 4B4GA 4EEGA 1MC3A 1VGWA 1ZCVA 5AJOA 5CMIA 5CQPA 4JISA 3SXCA 1ZCTA 1YP2A 3V0MA 2AM3A 1TZFA 1FRWA 2P72A 4NANA 1VPAA 2Y7AA 3ST8A 2FYCB 2O1GA 3T7OA 2V0LA 3TZTA 3LW6A 1HJJA 2VXMA 1WT2A 4B2XA 5CQMX 1ZI1A 1QGQA 5C4EA 1LZIA 3CKOA 5C38A 2XWLA 2XMEA 2JCLA 2RJ4A 5C47A 3V0LA 5CMHA 3V8ZA 3BRKX 3V0QA 1WT0A 2P73A 1FOAA 5C4BA 3OC9A 1NQIB 4HO4A 3U0XA 4Y64A 5CQLX 4O6NA 1GX4A 2GGOA 3SXGA 1ZJ0A 1H7HA 1VH1A 2D7IA 2YQSA 4AYLA 2WAWA 3I0LA 5C3AA 1R80A 1JYLA 2QKXA 3U2TA 2VSHA 5D92A 1H7FA 1R81A 2ZU8A 4HO9A 3DUVA 4KRVA 4HCQA 5I1FA 4FRPA 2NXVA 1QGSA 4D11A 4Y7UA 4CVHA 1G97A 4CJBA 4D0ZA 2A8WA 1H3MA 1VGZA 4C2SA 1OQMB 4AAWA 4FQWA 2YC3A 4KNXA 4J18A 2WE9A 1GQ9A 5C36A 1O0RA 1G23A 3Q80A 3D8VA 4EE4A 1LL2A 1MP3A 2V0JA 4JD0A 1NKHB 2OI6A 1HJLA 2XMHA 4G87A 2VK9A 3ZGFA 4BQHA 2Y4JA 1YROB 3USQA 3EE5A 1FO9A 2X5SA 1OMXA 3NGWA 2YQCA 4LW6A 3O3PA 1H5RB 5EIYA 4ARWA 3U2XA 2AM4A 3OH4A 3R2WA 4Y6NA 2RIZA 1FXOA 4M2BA 4LW3A 1G9RA 1TW1A 2RJ7A 2OEGA 2VD4A 4MIXA 2I5EA 4FCEA 1HM0A 4KT7A 2V0IA 3PKQA 4KC1A 3SX5A 2OI7A 3U0YA 5AJNA 1VGTA 4EVWA 2RJ6A 3I0CA 5C1GA 2UX8A 4EE5A 1EYRA 5C1LA 1GWVA 5EJ1A 3SX8A 4B3UA 5C8RA 3CKQA 1ZCUA 3I0FA 5CMFX 3OKRA 3V8YA 5JQQA 2BO8A 2FFUA 1H5TB 1H4EA 1YP4A 4Y9XA 4E1KA 1ON8A 2PA4A 5C3DA 2V0KA 1NMMB 3OH1A 4Q7CA 3JUKA 4AC3A 2APCA 3F1CA 4MYBA 4R7PA 2AH9A 3PKPA 4B42A 2C0NA 4FIYA 4CJCA 1XZ6A 1LL0A 3T7MA 4ASYA 3FWWA 1LL3A 2D7RA 3D5NA 3JUJA 1GX0A 3I0HA 1TVYA 1NWGB 1MP4A 1R7VA 2YESA 1H7LA 1ZDFA 4FRAA 2YQJA 4EE3A 4FIXA 3CGXA 2RIYA 1O23B 1W57A 3DK5A 1VZUA 3I0JA 2YCMA 4P02A 5C3BA 4DECA 1JVDA 1V82A 1ZJPA 4L41C 4HG6A 3V91A 2WGZA 5CMGX 1SS9A 4ZDQA 2WVKA 4HO2A 1PZTA 1VZTA 2FYAA 1S4PA 1H5SB 2O1HA 2MZBA 4M28A 5FU8A 3RMVA 2Y6PA 3DJ4A 5BXCA 4P00A 3U2VA 5IDSA 1H5SD 4G3PA 2W0WA 4B4BA 4FREA 5C1HA 4ECMA 2D0JA 1IIMA 3V90A 1ZJ1A 2J0BA 3SXDA 1FXJA 1KWSA 2OI5A 1WSZA 4FRMA 2PGYA 1FWYA 5J49A 1FZWA 1ZDGA 2A8UA 2RJ5A 4B5BA 2X5ZA 2FY7A 2Y4LA 4Y7TA 4AYJA 5FYEA 3KIAA 2OEFA 3CKVA 2ICYA 3U2WA 4HO8A 1ON6A 1ZIZA 4ASJA 4KPZA 3V0PA 4EEAA 1V84A 3OH3A 1W77A 3PNNA 1H7EA 2CU2A 5CQOA 4FROA 5FTSA 1V83A 2WVMA 3Q4SA 2VS3A 2Y4KA 3CKNA 1H7TA 5C4DA 2WEEA 4NAIA 1LZ7A 2AGDA 4YS8A 5CQNX 3F1YA 3E25A 3E26A 3IOHA 1JVGA 5DDVA 2E3DA 5C48A 2O1FA 3SXAA 3I0GA 3Q7UA 1ZI5A 4NALA 3RSBA 1INJA 4KQLA 2WVLA 4XWIA 1ZJ3A 2VSIA 2VFZA 4FRQA 2W0VA 4BMAA 1VM8A 3HL3A 3JTJA 1Z90A 5FUHA 4FRDA 4FRHA 1IINA 3U2UA 1H5SC 4Y7VA 4DDZA 2RJ9A 2RITA 2BO7A 1VH3A 4FCUA 2Q4JA 1FR8A 4NAKA 5C4FA 5C4CA 3R3IA 1W55A 3V0OA 1WT3A 4FRLA 3SX3A 2DPWA 3N9WA 2FYBA 1HM8A 1LVWA 4Y6UA 3IOJA 1FG5N 4B4MA 4G3QA 3TQDA 1HM9A 1GA8A 3RMWA 1LZJA 3ZLLA 2AECA 2ZU7A 3I0DA 1ZJ2A 3IOIA 1HV9A 1MP5A 3SPTA 1WT1A 1R82A 3BCVA 3I0EA 1G2VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZI A;  4IRP A;  4Y7G A;  1G0R A;  4Y62 A;  3OAM A;  2VS5 A;  5C49 A;  3ZGG A;  1FO8 A;  1H4C A;  1VZX A;  4M2A A;  4Y63 A;  1S4N A;  1JV3 A;  4UEG A;  1O7Q A;  2ICX A;  4CJ8 A;  4HO6 A;  1ZCY A;  3CKJ A;  2V0H A;  5IDT A;  4M4K A;  3CU0 A;  4HO5 A;  4D0T A;  2P6W A;  3I0I X;  1G95 A;  1ZI3 A;  2X60 A;  2VS4 A;  2I7B A;  1H5S A;  2RJ1 A;  4KC4 A;  1FGX A;  4B2W A;  1ZJO A;  4KC2 A;  5FV9 A;  1ZHJ A;  3I0K A;  2XWN A;  5FTV A;  3SXE A;  3K8D A;  4DE7 A;  5CMJ A;  3OGZ A;  4KPX A;  3T7N A;  2FFV A;  2QGI A;  4Y7F A;  1GQC A;  1INI A;  2PX7 A;  4IRQ A;  1VIC A;  3K8E A;  2Y4M A;  2FYD B;  3ZLK A;  1XHB A;  3QVB A;  1WVC A;  1TW5 A;  1ZI4 A;  1FGG A;  4KXO A;  1K4V A;  4KNR A;  3SX7 A;  3V0N A;  2JCO A;  2PGV A;  5FU0 A;  2VXL A;  2I5K A;  2X65 A;  3OH0 A;  1H4D A;  1FR9 A;  1I52 A;  4D48 A;  1PZY B;  3USR A;  3ZF8 A;  1R7T A;  1YP3 A;  5L6S A;  1JYK A;  1R7U A;  2BO4 A;  2E8B A;  2ZU9 A;  2YC5 A;  4G3S A;  4HO3 A;  5AJP A;  2AES A;  4MND A;  4FRB A;  1H5R A;  5HS2 A;  1VGU A;  1JV1 A;  2RJ0 A;  2XWM A;  2BO6 A;  1QWJ A;  4GBP A;  1NHE B;  1QG8 A;  3OH2 A;  2RIX A;  2GGQ A;  1R7X A;  5EJZ A;  2Z87 A;  2JCK A;  1H7Q A;  1NF5 B;  1OMZ A;  2AM5 A;  2Z86 A;  4K6R A;  1S4O A;  1E5K A;  3POL A;  3FOQ A;  4EEM A;  4HO0 A;  1O7O A;  1R7Y A;  3D98 A;  1G1L A;  4EEO A;  5IFY A;  3GUE A;  1GWW A;  4HOC A;  2QH5 A;  3SXB A;  2YQH A;  1G93 A;  2JCJ A;  2AE7 A;  1H7G A;  5DDT A;  1G8O A;  1H5T A;  2RJ8 A;  4D11 C;  5L6V A;  1G3L A;  1LZ0 A;  4B4G A;  4EEG A;  1MC3 A;  1VGW A;  1ZCV A;  5AJO A;  5CMI A;  5CQP A;  4JIS A;  3SXC A;  1ZCT A;  1YP2 A;  3V0M A;  2AM3 A;  1TZF A;  1FRW A;  2P72 A;  4NAN A;  1VPA A;  2Y7A A;  3ST8 A;  2FYC B;  2O1G A;  3T7O A;  2V0L A;  3TZT A;  3LW6 A;  1HJJ A;  2VXM A;  1WT2 A;  4B2X A;  5CQM X;  1ZI1 A;  1QGQ A;  5C4E A;  1LZI A;  3CKO A;  5C38 A;  2XWL A;  2XME A;  2JCL A;  2RJ4 A;  5C47 A;  3V0L A;  5CMH A;  3V8Z A;  3BRK X;  3V0Q A;  1WT0 A;  2P73 A;  1FOA A;  5C4B A;  3OC9 A;  1NQI B;  4HO4 A;  3U0X A;  4Y64 A;  5CQL X;  1GX4 A;  2GGO A;  3SXG A;  1ZJ0 A;  1H7H A;  1VH1 A;  2D7I A;  2YQS A;  4AYL A;  2WAW A;  3I0L A;  5C3A A;  1R80 A;  1JYL A;  2QKX A;  3U2T A;  2VSH A;  1H7F A;  1R81 A;  2ZU8 A;  4HO9 A;  3DUV A;  4KRV A;  4HCQ A;  5I1F A;  4FRP A;  2NXV A;  1QGS A;  4D11 A;  4Y7U A;  4CVH A;  1G97 A;  4CJB A;  4D0Z A;  2A8W A;  1H3M A;  1VGZ A;  4C2S A;  1OQM B;  4AAW A;  4FQW A;  2YC3 A;  4KNX A;  4J18 A;  2WE9 A;  1GQ9 A;  5C36 A;  1O0R A;  1G23 A;  3Q80 A;  3D8V A;  4EE4 A;  1LL2 A;  1MP3 A;  2V0J A;  4JD0 A;  1NKH B;  2OI6 A;  1HJL A;  2XMH A;  4G87 A;  4BQH A;  3ZGF A;  2Y4J A;  1YRO B;  3USQ A;  3EE5 A;  1FO9 A;  2X5S A;  1OMX A;  3NGW A;  2YQC A;  4LW6 A;  3O3P A;  1H5R B;  5EIY A;  4ARW A;  3U2X A;  2AM4 A;  3OH4 A;  3R2W A;  4Y6N A;  2RIZ A;  1FXO A;  4M2B A;  4LW3 A;  1G9R A;  1TW1 A;  2RJ7 A;  2OEG A;  2VD4 A;  2I5E A;  4FCE A;  1HM0 A;  4KT7 A;  2V0I A;  3PKQ A;  4KC1 A;  3SX5 A;  2OI7 A;  3U0Y A;  5AJN A;  1VGT A;  4EVW A;  2RJ6 A;  3I0C A;  5C1G A;  2UX8 A;  4EE5 A;  1EYR A;  5C1L A;  1GWV A;  5EJ1 A;  3SX8 A;  4B3U A;  5C8R A;  3CKQ A;  1ZCU A;  3I0F A;  5CMF X;  3OKR A;  3V8Y A;  5JQQ A;  2BO8 A;  2FFU A;  1H5T B;  1H4E A;  1YP4 A;  4Y9X A;  4E1K A;  1ON8 A;  2PA4 A;  5C3D A;  2V0K A;  1NMM B;  3OH1 A;  4AC3 A;  3JUK A;  2APC A;  3F1C A;  4MYB A;  4R7P A;  2AH9 A;  3PKP A;  4B42 A;  4CJC A;  1XZ6 A;  1LL0 A;  3T7M A;  4ASY A;  3FWW A;  1LL3 A;  2D7R A;  3D5N A;  3JUJ A;  1GX0 A;  3I0H A;  1TVY A;  1NWG B;  1MP4 A;  1R7V A;  2YES A;  1H7L A;  1ZDF A;  4FRA A;  2YQJ A;  4EE3 A;  3CGX A;  2RIY A;  1O23 B;  1W57 A;  3DK5 A;  1VZU A;  3I0J A;  2YCM A;  4P02 A;  5C3B A;  4DEC A;  1JVD A;  1V82 A;  1ZJP A;  4L41 C;  4HG6 A;  3V91 A;  2WGZ A;  5CMG X;  1SS9 A;  4ZDQ A;  2WVK A;  4HO2 A;  1PZT A;  1VZT A;  2FYA A;  1S4P A;  1H5S B;  2O1H A;  2MZB A;  4M28 A;  5FU8 A;  3RMV A;  2Y6P A;  3DJ4 A;  5BXC A;  4P00 A;  3U2V A;  5IDS A;  1H5S D;  4G3P A;  2W0W A;  4B4B A;  4FRE A;  5C1H A;  4ECM A;  2D0J A;  1IIM A;  3V90 A;  1ZJ1 A;  3SXD A;  1FXJ A;  1KWS A;  2OI5 A;  1WSZ A;  4FRM A;  2PGY A;  1FWY A;  5J49 A;  1FZW A;  1ZDG A;  2A8U A;  2RJ5 A;  4B5B A;  2X5Z A;  2FY7 A;  2Y4L A;  4Y7T A;  4AYJ A;  5FYE A;  3KIA A;  2OEF A;  3CKV A;  2ICY A;  3U2W A;  4HO8 A;  1ON6 A;  1ZIZ A;  4ASJ A;  4KPZ A;  3V0P A;  4EEA A;  1V84 A;  3OH3 A;  1W77 A;  3PNN A;  1H7E A;  2CU2 A;  5CQO A;  4FRO A;  5FTS A;  1V83 A;  2WVM A;  3Q4S A;  2VS3 A;  2Y4K A;  3CKN A;  1H7T A;  5C4D A;  2WEE A;  4NAI A;  1LZ7 A;  2AGD A;  4YS8 A;  5CQN X;  3F1Y A;  3E25 A;  3E26 A;  3IOH A;  1JVG A;  5DDV A;  2E3D A;  5C48 A;  2O1F A;  3SXA A;  3I0G A;  3Q7U A;  1ZI5 A;  4NAL A;  3RSB A;  1INJ A;  4KQL A;  2WVL A;  4XWI A;  1ZJ3 A;  2VSI A;  2VFZ A;  4FRQ A;  2W0V A;  4BMA A;  1VM8 A;  3HL3 A;  3JTJ A;  1Z90 A;  5FUH A;  4FRD A;  4FRH A;  1IIN A;  3U2U A;  1H5S C;  4Y7V A;  4DDZ A;  2RJ9 A;  2RIT A;  2BO7 A;  1VH3 A;  4FCU A;  2Q4J A;  1FR8 A;  4NAK A;  5C4F A;  5C4C A;  3R3I A;  1W55 A;  3V0O A;  1WT3 A;  4FRL A;  3SX3 A;  2DPW A;  3N9W A;  2FYB A;  1HM8 A;  1LVW A;  4Y6U A;  3IOJ A;  1FG5 N;  4B4M A;  4G3Q A;  3TQD A;  1HM9 A;  1GA8 A;  3RMW A;  1LZJ A;  3ZLL A;  2AEC A;  2ZU7 A;  3I0D A;  1ZJ2 A;  3IOI A;  1HV9 A;  1MP5 A;  3SPT A;  1WT1 A;  1R82 A;  3BCV A;  3I0E A;  1G2V A; 
#chains in the Genus database with same CATH topology
 1EZI A;  4IRP A;  4Y7G A;  1G0R A;  4Y62 A;  3OAM A;  2VS5 A;  5C49 A;  3ZGG A;  1FO8 A;  1H4C A;  1VZX A;  4M2A A;  4Y63 A;  1S4N A;  1JV3 A;  4UEG A;  1O7Q A;  2ICX A;  4CJ8 A;  4HO6 A;  1ZCY A;  3CKJ A;  2V0H A;  5IDT A;  4M4K A;  3CU0 A;  4HO5 A;  4D0T A;  2P6W A;  3I0I X;  1G95 A;  1ZI3 A;  2X60 A;  2VS4 A;  2I7B A;  1H5S A;  2RJ1 A;  4KC4 A;  1FGX A;  4B2W A;  1ZJO A;  4KC2 A;  5FV9 A;  1ZHJ A;  3I0K A;  2XWN A;  5FTV A;  3SXE A;  3K8D A;  4DE7 A;  5CMJ A;  3OGZ A;  4KPX A;  3T7N A;  2FFV A;  2QGI A;  4Y7F A;  1GQC A;  1INI A;  2PX7 A;  4IRQ A;  1VIC A;  3K8E A;  2Y4M A;  2FYD B;  3ZLK A;  1XHB A;  3QVB A;  1WVC A;  1TW5 A;  1ZI4 A;  1FGG A;  4KXO A;  1K4V A;  4KNR A;  3SX7 A;  3V0N A;  2JCO A;  2PGV A;  5FU0 A;  2VXL A;  2I5K A;  2X65 A;  3OH0 A;  1H4D A;  1FR9 A;  1I52 A;  4D48 A;  1PZY B;  3USR A;  3ZF8 A;  1R7T A;  1YP3 A;  5L6S A;  1JYK A;  1R7U A;  2BO4 A;  2E8B A;  2ZU9 A;  2YC5 A;  4G3S A;  4HO3 A;  5AJP A;  2AES A;  4MND A;  4FRB A;  1H5R A;  5HS2 A;  1VGU A;  1JV1 A;  2RJ0 A;  2XWM A;  2BO6 A;  1QWJ A;  4GBP A;  1NHE B;  1QG8 A;  3OH2 A;  2RIX A;  2GGQ A;  1R7X A;  5EJZ A;  2Z87 A;  2JCK A;  1H7Q A;  1NF5 B;  1OMZ A;  2AM5 A;  2Z86 A;  4K6R A;  1S4O A;  4O6M A;  1E5K A;  3POL A;  3FOQ A;  4EEM A;  4HO0 A;  1O7O A;  2J0A A;  1R7Y A;  3D98 A;  1G1L A;  4EEO A;  5IFY A;  3GUE A;  1GWW A;  5D91 A;  4HOC A;  2QH5 A;  3SXB A;  2YQH A;  1G93 A;  2JCJ A;  2AE7 A;  1H7G A;  5DDT A;  1G8O A;  1H5T A;  2RJ8 A;  4D11 C;  5L6V A;  1G3L A;  1LZ0 A;  4B4G A;  4EEG A;  1MC3 A;  1VGW A;  1ZCV A;  5AJO A;  5CMI A;  5CQP A;  4JIS A;  3SXC A;  1ZCT A;  1YP2 A;  3V0M A;  2AM3 A;  1TZF A;  1FRW A;  2P72 A;  4NAN A;  1VPA A;  2Y7A A;  3ST8 A;  2FYC B;  2O1G A;  3T7O A;  2V0L A;  3TZT A;  3LW6 A;  1HJJ A;  2VXM A;  1WT2 A;  4B2X A;  5CQM X;  1ZI1 A;  1QGQ A;  5C4E A;  1LZI A;  3CKO A;  5C38 A;  2XWL A;  2XME A;  2JCL A;  2RJ4 A;  5C47 A;  3V0L A;  5CMH A;  3V8Z A;  3BRK X;  3V0Q A;  1WT0 A;  2P73 A;  1FOA A;  5C4B A;  3OC9 A;  1NQI B;  4HO4 A;  3U0X A;  4Y64 A;  5CQL X;  4O6N A;  1GX4 A;  2GGO A;  3SXG A;  1ZJ0 A;  1H7H A;  1VH1 A;  2D7I A;  2YQS A;  4AYL A;  2WAW A;  3I0L A;  5C3A A;  1R80 A;  1JYL A;  2QKX A;  3U2T A;  2VSH A;  5D92 A;  1H7F A;  1R81 A;  2ZU8 A;  4HO9 A;  3DUV A;  4KRV A;  4HCQ A;  5I1F A;  4FRP A;  2NXV A;  1QGS A;  4D11 A;  4Y7U A;  4CVH A;  1G97 A;  4CJB A;  4D0Z A;  2A8W A;  1H3M A;  1VGZ A;  4C2S A;  1OQM B;  4AAW A;  4FQW A;  2YC3 A;  4KNX A;  4J18 A;  2WE9 A;  1GQ9 A;  5C36 A;  1O0R A;  1G23 A;  3Q80 A;  3D8V A;  4EE4 A;  1LL2 A;  1MP3 A;  2V0J A;  4JD0 A;  1NKH B;  2OI6 A;  1HJL A;  2XMH A;  4G87 A;  2VK9 A;  3ZGF A;  4BQH A;  2Y4J A;  1YRO B;  3USQ A;  3EE5 A;  1FO9 A;  2X5S A;  1OMX A;  3NGW A;  2YQC A;  4LW6 A;  3O3P A;  1H5R B;  5EIY A;  4ARW A;  3U2X A;  2AM4 A;  3OH4 A;  3R2W A;  4Y6N A;  2RIZ A;  1FXO A;  4M2B A;  4LW3 A;  1G9R A;  1TW1 A;  2RJ7 A;  2OEG A;  2VD4 A;  4MIX A;  2I5E A;  4FCE A;  1HM0 A;  4KT7 A;  2V0I A;  3PKQ A;  4KC1 A;  3SX5 A;  2OI7 A;  3U0Y A;  5AJN A;  1VGT A;  4EVW A;  2RJ6 A;  3I0C A;  5C1G A;  2UX8 A;  4EE5 A;  1EYR A;  5C1L A;  1GWV A;  5EJ1 A;  3SX8 A;  4B3U A;  5C8R A;  3CKQ A;  1ZCU A;  3I0F A;  5CMF X;  3OKR A;  3V8Y A;  5JQQ A;  2BO8 A;  2FFU A;  1H5T B;  1H4E A;  1YP4 A;  4Y9X A;  4E1K A;  1ON8 A;  2PA4 A;  5C3D A;  2V0K A;  1NMM B;  3OH1 A;  4Q7C A;  3JUK A;  4AC3 A;  2APC A;  3F1C A;  4MYB A;  4R7P A;  2AH9 A;  3PKP A;  4B42 A;  2C0N A;  4FIY A;  4CJC A;  1XZ6 A;  1LL0 A;  3T7M A;  4ASY A;  3FWW A;  1LL3 A;  2D7R A;  3D5N A;  3JUJ A;  1GX0 A;  3I0H A;  1TVY A;  1NWG B;  1MP4 A;  1R7V A;  2YES A;  1H7L A;  1ZDF A;  4FRA A;  2YQJ A;  4EE3 A;  4FIX A;  3CGX A;  2RIY A;  1O23 B;  1W57 A;  3DK5 A;  1VZU A;  3I0J A;  2YCM A;  4P02 A;  5C3B A;  4DEC A;  1JVD A;  1V82 A;  1ZJP A;  4L41 C;  4HG6 A;  3V91 A;  2WGZ A;  5CMG X;  1SS9 A;  4ZDQ A;  2WVK A;  4HO2 A;  1PZT A;  1VZT A;  2FYA A;  1S4P A;  1H5S B;  2O1H A;  2MZB A;  4M28 A;  5FU8 A;  3RMV A;  2Y6P A;  3DJ4 A;  5BXC A;  4P00 A;  3U2V A;  5IDS A;  1H5S D;  4G3P A;  2W0W A;  4B4B A;  4FRE A;  5C1H A;  4ECM A;  2D0J A;  1IIM A;  3V90 A;  1ZJ1 A;  2J0B A;  3SXD A;  1FXJ A;  1KWS A;  2OI5 A;  1WSZ A;  4FRM A;  2PGY A;  1FWY A;  5J49 A;  1FZW A;  1ZDG A;  2A8U A;  2RJ5 A;  4B5B A;  2X5Z A;  2FY7 A;  2Y4L A;  4Y7T A;  4AYJ A;  5FYE A;  3KIA A;  2OEF A;  3CKV A;  2ICY A;  3U2W A;  4HO8 A;  1ON6 A;  1ZIZ A;  4ASJ A;  4KPZ A;  3V0P A;  4EEA A;  1V84 A;  3OH3 A;  1W77 A;  3PNN A;  1H7E A;  2CU2 A;  5CQO A;  4FRO A;  5FTS A;  1V83 A;  2WVM A;  3Q4S A;  2VS3 A;  2Y4K A;  3CKN A;  1H7T A;  5C4D A;  2WEE A;  4NAI A;  1LZ7 A;  2AGD A;  4YS8 A;  5CQN X;  3F1Y A;  3E25 A;  3E26 A;  3IOH A;  1JVG A;  5DDV A;  2E3D A;  5C48 A;  2O1F A;  3SXA A;  3I0G A;  3Q7U A;  1ZI5 A;  4NAL A;  3RSB A;  1INJ A;  4KQL A;  2WVL A;  4XWI A;  1ZJ3 A;  2VSI A;  2VFZ A;  4FRQ A;  2W0V A;  4BMA A;  1VM8 A;  3HL3 A;  3JTJ A;  1Z90 A;  5FUH A;  4FRD A;  4FRH A;  1IIN A;  3U2U A;  1H5S C;  4Y7V A;  4DDZ A;  2RJ9 A;  2RIT A;  2BO7 A;  1VH3 A;  4FCU A;  2Q4J A;  1FR8 A;  4NAK A;  5C4F A;  5C4C A;  3R3I A;  1W55 A;  3V0O A;  1WT3 A;  4FRL A;  3SX3 A;  2DPW A;  3N9W A;  2FYB A;  1HM8 A;  1LVW A;  4Y6U A;  3IOJ A;  1FG5 N;  4B4M A;  4G3Q A;  3TQD A;  1HM9 A;  1GA8 A;  3RMW A;  1LZJ A;  3ZLL A;  2AEC A;  2ZU7 A;  3I0D A;  1ZJ2 A;  3IOI A;  1HV9 A;  1MP5 A;  3SPT A;  1WT1 A;  1R82 A;  3BCV A;  3I0E A;  1G2V A; 
#chains in the Genus database with same CATH homology
 1EZI A;  4IRP A;  4Y7G A;  1G0R A;  4Y62 A;  3OAM A;  2VS5 A;  5C49 A;  3ZGG A;  1FO8 A;  1H4C A;  1VZX A;  4M2A A;  4Y63 A;  1S4N A;  1JV3 A;  4UEG A;  1O7Q A;  2ICX A;  4CJ8 A;  4HO6 A;  1ZCY A;  3CKJ A;  2V0H A;  5IDT A;  4M4K A;  3CU0 A;  4HO5 A;  4D0T A;  2P6W A;  3I0I X;  1G95 A;  1ZI3 A;  2X60 A;  2VS4 A;  2I7B A;  1H5S A;  2RJ1 A;  4KC4 A;  1FGX A;  4B2W A;  1ZJO A;  4KC2 A;  5FV9 A;  1ZHJ A;  3I0K A;  2XWN A;  5FTV A;  3SXE A;  3K8D A;  4DE7 A;  5CMJ A;  3OGZ A;  4KPX A;  3T7N A;  2FFV A;  2QGI A;  4Y7F A;  1GQC A;  1INI A;  2PX7 A;  4IRQ A;  1VIC A;  3K8E A;  2Y4M A;  2FYD B;  3ZLK A;  1XHB A;  3QVB A;  1WVC A;  1TW5 A;  1ZI4 A;  1FGG A;  4KXO A;  1K4V A;  4KNR A;  3SX7 A;  3V0N A;  2JCO A;  2PGV A;  5FU0 A;  2VXL A;  2I5K A;  2X65 A;  3OH0 A;  1H4D A;  1FR9 A;  1I52 A;  4D48 A;  1PZY B;  3USR A;  3ZF8 A;  1R7T A;  1YP3 A;  5L6S A;  1JYK A;  1R7U A;  2BO4 A;  2E8B A;  2ZU9 A;  2YC5 A;  4G3S A;  4HO3 A;  5AJP A;  2AES A;  4MND A;  4FRB A;  1H5R A;  5HS2 A;  1VGU A;  1JV1 A;  2RJ0 A;  2XWM A;  2BO6 A;  1QWJ A;  4GBP A;  1NHE B;  1QG8 A;  3OH2 A;  2RIX A;  2GGQ A;  1R7X A;  5EJZ A;  2Z87 A;  2JCK A;  1H7Q A;  1NF5 B;  1OMZ A;  2AM5 A;  2Z86 A;  4K6R A;  1S4O A;  4O6M A;  1E5K A;  3POL A;  3FOQ A;  4EEM A;  4HO0 A;  1O7O A;  2J0A A;  1R7Y A;  3D98 A;  1G1L A;  4EEO A;  5IFY A;  3GUE A;  1GWW A;  5D91 A;  4HOC A;  2QH5 A;  3SXB A;  2YQH A;  1G93 A;  2JCJ A;  2AE7 A;  1H7G A;  5DDT A;  1G8O A;  1H5T A;  2RJ8 A;  4D11 C;  5L6V A;  1G3L A;  1LZ0 A;  4B4G A;  4EEG A;  1MC3 A;  1VGW A;  1ZCV A;  5AJO A;  5CMI A;  5CQP A;  4JIS A;  3SXC A;  1ZCT A;  1YP2 A;  3V0M A;  2AM3 A;  1TZF A;  1FRW A;  2P72 A;  4NAN A;  1VPA A;  2Y7A A;  3ST8 A;  2FYC B;  2O1G A;  3T7O A;  2V0L A;  3TZT A;  3LW6 A;  1HJJ A;  2VXM A;  1WT2 A;  4B2X A;  5CQM X;  1ZI1 A;  1QGQ A;  5C4E A;  1LZI A;  3CKO A;  5C38 A;  2XWL A;  2XME A;  2JCL A;  2RJ4 A;  5C47 A;  3V0L A;  5CMH A;  3V8Z A;  3BRK X;  3V0Q A;  1WT0 A;  2P73 A;  1FOA A;  5C4B A;  3OC9 A;  1NQI B;  4HO4 A;  3U0X A;  4Y64 A;  5CQL X;  4O6N A;  1GX4 A;  2GGO A;  3SXG A;  1ZJ0 A;  1H7H A;  1VH1 A;  2D7I A;  2YQS A;  4AYL A;  2WAW A;  3I0L A;  5C3A A;  1R80 A;  1JYL A;  2QKX A;  3U2T A;  2VSH A;  5D92 A;  1H7F A;  1R81 A;  2ZU8 A;  4HO9 A;  3DUV A;  4KRV A;  4HCQ A;  5I1F A;  4FRP A;  2NXV A;  1QGS A;  4D11 A;  4Y7U A;  4CVH A;  1G97 A;  4CJB A;  4D0Z A;  2A8W A;  1H3M A;  1VGZ A;  4C2S A;  1OQM B;  4AAW A;  4FQW A;  2YC3 A;  4KNX A;  4J18 A;  2WE9 A;  1GQ9 A;  5C36 A;  1O0R A;  1G23 A;  3Q80 A;  3D8V A;  4EE4 A;  1LL2 A;  1MP3 A;  2V0J A;  4JD0 A;  1NKH B;  2OI6 A;  1HJL A;  2XMH A;  4G87 A;  2VK9 A;  3ZGF A;  4BQH A;  2Y4J A;  1YRO B;  3USQ A;  3EE5 A;  1FO9 A;  2X5S A;  1OMX A;  3NGW A;  2YQC A;  4LW6 A;  3O3P A;  1H5R B;  5EIY A;  4ARW A;  3U2X A;  2AM4 A;  3OH4 A;  3R2W A;  4Y6N A;  2RIZ A;  1FXO A;  4M2B A;  4LW3 A;  1G9R A;  1TW1 A;  2RJ7 A;  2OEG A;  2VD4 A;  4MIX A;  2I5E A;  4FCE A;  1HM0 A;  4KT7 A;  2V0I A;  3PKQ A;  4KC1 A;  3SX5 A;  2OI7 A;  3U0Y A;  5AJN A;  1VGT A;  4EVW A;  2RJ6 A;  3I0C A;  5C1G A;  2UX8 A;  4EE5 A;  1EYR A;  5C1L A;  1GWV A;  5EJ1 A;  3SX8 A;  4B3U A;  5C8R A;  3CKQ A;  1ZCU A;  3I0F A;  5CMF X;  3OKR A;  3V8Y A;  5JQQ A;  2BO8 A;  2FFU A;  1H5T B;  1H4E A;  1YP4 A;  4Y9X A;  4E1K A;  1ON8 A;  2PA4 A;  5C3D A;  2V0K A;  1NMM B;  3OH1 A;  4Q7C A;  3JUK A;  4AC3 A;  2APC A;  3F1C A;  4MYB A;  4R7P A;  2AH9 A;  3PKP A;  4B42 A;  2C0N A;  4FIY A;  4CJC A;  1XZ6 A;  1LL0 A;  3T7M A;  4ASY A;  3FWW A;  1LL3 A;  2D7R A;  3D5N A;  3JUJ A;  1GX0 A;  3I0H A;  1TVY A;  1NWG B;  1MP4 A;  1R7V A;  2YES A;  1H7L A;  1ZDF A;  4FRA A;  2YQJ A;  4EE3 A;  4FIX A;  3CGX A;  2RIY A;  1O23 B;  1W57 A;  3DK5 A;  1VZU A;  3I0J A;  2YCM A;  4P02 A;  5C3B A;  4DEC A;  1JVD A;  1V82 A;  1ZJP A;  4L41 C;  4HG6 A;  3V91 A;  2WGZ A;  5CMG X;  1SS9 A;  4ZDQ A;  2WVK A;  4HO2 A;  1PZT A;  1VZT A;  2FYA A;  1S4P A;  1H5S B;  2O1H A;  2MZB A;  4M28 A;  5FU8 A;  3RMV A;  2Y6P A;  3DJ4 A;  5BXC A;  4P00 A;  3U2V A;  5IDS A;  1H5S D;  4G3P A;  2W0W A;  4B4B A;  4FRE A;  5C1H A;  4ECM A;  2D0J A;  1IIM A;  3V90 A;  1ZJ1 A;  2J0B A;  3SXD A;  1FXJ A;  1KWS A;  2OI5 A;  1WSZ A;  4FRM A;  2PGY A;  1FWY A;  5J49 A;  1FZW A;  1ZDG A;  2A8U A;  2RJ5 A;  4B5B A;  2X5Z A;  2FY7 A;  2Y4L A;  4Y7T A;  4AYJ A;  5FYE A;  3KIA A;  2OEF A;  3CKV A;  2ICY A;  3U2W A;  4HO8 A;  1ON6 A;  1ZIZ A;  4ASJ A;  4KPZ A;  3V0P A;  4EEA A;  1V84 A;  3OH3 A;  1W77 A;  3PNN A;  1H7E A;  2CU2 A;  5CQO A;  4FRO A;  5FTS A;  1V83 A;  2WVM A;  3Q4S A;  2VS3 A;  2Y4K A;  3CKN A;  1H7T A;  5C4D A;  2WEE A;  4NAI A;  1LZ7 A;  2AGD A;  4YS8 A;  5CQN X;  3F1Y A;  3E25 A;  3E26 A;  3IOH A;  1JVG A;  5DDV A;  2E3D A;  5C48 A;  2O1F A;  3SXA A;  3I0G A;  3Q7U A;  1ZI5 A;  4NAL A;  3RSB A;  1INJ A;  4KQL A;  2WVL A;  4XWI A;  1ZJ3 A;  2VSI A;  2VFZ A;  4FRQ A;  2W0V A;  4BMA A;  1VM8 A;  3HL3 A;  3JTJ A;  1Z90 A;  5FUH A;  4FRD A;  4FRH A;  1IIN A;  3U2U A;  1H5S C;  4Y7V A;  4DDZ A;  2RJ9 A;  2RIT A;  2BO7 A;  1VH3 A;  4FCU A;  2Q4J A;  1FR8 A;  4NAK A;  5C4F A;  5C4C A;  3R3I A;  1W55 A;  3V0O A;  1WT3 A;  4FRL A;  3SX3 A;  2DPW A;  3N9W A;  2FYB A;  1HM8 A;  1LVW A;  4Y6U A;  3IOJ A;  1FG5 N;  4B4M A;  4G3Q A;  3TQD A;  1HM9 A;  1GA8 A;  3RMW A;  1LZJ A;  3ZLL A;  2AEC A;  2ZU7 A;  3I0D A;  1ZJ2 A;  3IOI A;  1HV9 A;  1MP5 A;  3SPT A;  1WT1 A;  1R82 A;  3BCV A;  3I0E A;  1G2V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...