2VS5A

The binding of udp-galactose by an active site mutant of alpha-1,3 galactosyltransferase (alpha3gt)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
283
structure length
283
Chain Sequence
LKLSDWFNPFKRPEVVTMTKWKAPVVWEGTYNRAVLDNYYAKQKITVGLTVFAVGRYIEHYLEEFLTSANKHFMVGHPVIFYIMVDDVSRMPLIELGPLRSFKVFKIKPEKRWQDISMMRMKTIGEHIVAHIQHEVDFLFCMDVDQVFQDKFGVETLGESVAQLQAWWYKADPNDFTYERRKESAAYIPFGEGDFYYHAAIFGGTPTQVLNITQECFKGILKDKKNDIEAQWHDQSHLNKYFLLNKPTKILSPEYCWDYHIGLPADIKLVKMSWQTKEYNVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACETYLLACTOSAMINIDE ALPHA-1,3-GALACTOSYLTRANSFERASE
publication title Structural Basis of Udp-Galactose Binding by Alpha- 1,3-Galactosyltransferase (Alpha3Gt): Role of Negative Charge on Aspartic Acid 316 in Structure and Activity.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 105
structure length 283
sequence length 283
chains with identical sequence B
ec nomenclature ec 2.4.1.87: N-acetyllactosaminide 3-alpha-galactosyltransferase.
pdb deposition date 2008-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2vs5A00
2YC5A 3ZF8A 4HO5A 1GA8A 4IRQA 1H3MA 1H5TB 1G2VA 2X5SA 1H4DA 1HM8A 4HO0A 1ZCUA 5FTSA 1G23A 2VS4A 4NALA 2Y7AA 2RJ8A 1H5SB 3D8VA 3QVBA 1JYKA 4B4MA 5C36A 4FREA 2O1GA 4G3QA 2VSHA 2AM5A 2YC3A 5DDTA 3FWWA 2OEFA 1NKHB 5C4EA 4KQLA 1HJJA 1VGWA 1G9RA 1GWWA 5CMHA 5C47A 3U2XA 4AC3A 1W77A 1H7GA 4P00A 1S4PA 3SXEA 5L6VA 3IOHA 2I5EA 2FFUA 3CKNA 3OH3A 1NWGB 3U2UA 1FR9A 1FO9A 3SPTA 4E1KA 1WSZA 1FGGA 1O23B 4G3PA 4KXOA 4HCQA 4GBPA 1PZTA 4FQWA 1WT2A 1VH3A 1ZDGA 2WVMA 3ZGFA 4D48A 2WVLA 1FOAA 1S4OA 1KWSA 1NHEB 1TZFA 1H7TA 1XHBA 3TQDA 4AYJA 1H7QA 2WVKA 5IDTA 4J18A 2CU2A 3CGXA 3U2WA 4G87A 4Y62A 3Q80A 2VD4A 1GX0A 1VGUA 2YQHA 4R7PA 1XZ6A 5JQQA 2JCJA 2GGOA 4EVWA 1R82A 1GWVA 3I0DA 4FRBA 1G1LA 3PNNA 2PGYA 3I0GA 1QWJA 3SXAA 2P72A 1ZI3A 1JV3A 2FYCB 2V0JA 2V0IA 2WGZA 3SX5A 4ARWA 3V90A 3K8DA 3USQA 1MP4A 2BO6A 2YCMA 4FRAA 2PGVA 2FYBA 2ZU7A 2XWNA 2QGIA 1R80A 3OAMA 4EEMA 1JVGA 2MZBA 5C49A 4FRLA 3OH4A 4MNDA 2RIXA 1H4EA 5C4FA 1R7XA 4G3SA 4HO4A 2WE9A 1O7QA 5C8RA 3T7NA 4AYLA 4Y9XA 4KPZA 3PKPA 4Y6NA 1YP2A 3OH1A 3D5NA 4JISA 1K4VA 3O3PA 3SX3A 3V0NA 1QGQA 1FRWA 2E3DA 5C3BA 3DK5A 1GX4A 2D0JA 3BCVA 3CKOA 1NMMB 1LZIA 3Q4SA 3FOQA 3OH2A 1HV9A 2RJ5A 1W55A 1G97A 3USRA 4XWIA 4Y7TA 4B4GA 4FRMA 2P6WA 1EYRA 3I0CA 4HG6A 2RJ4A 1NF5B 4CJBA 1VM8A 2BO8A 5AJOA 4EE3A 2VSIA 2O1FA 4EEOA 1INIA 1LZJA 3CU0A 1O7OA 2OEGA 4EE4A 1Z90A 3RSBA 1FO8A 1MP5A 4FRQA 1MP3A 3I0FA 1JYLA 4UEGA 1EZIA 4B2WA 3KIAA 1ZCTA 1ZHJA 5I1FA 2W0WA 3V0QA 2FYDB 1WT0A 5FUHA 1TVYA 2FY7A 1H5SC 1R7VA 3JUKA 5CMGX 4BMAA 1G95A 5FYEA 4ASJA 1ZIZA 2OI6A 2YQSA 5CQLX 5C4CA 2WEEA 5IDSA 2E8BA 3V0MA 4B42A 1H5RB 3I0EA 3U2TA 4CJ8A 3N9WA 1MC3A 4NAKA 3CKVA 4FRDA 4KC2A 4Y7VA 1ZI5A 4IRPA 5C1GA 3E25A 1HM0A 2ICYA 1YROB 4FROA 4D11A 1LZ0A 1LL3A 1W57A 1H7LA 1ON6A 2DPWA 4K6RA 2AECA 1H5SA 3I0HA 3SXBA 2X60A 1FZWA 2VFZA 1QG8A 2V0LA 2RIZA 3F1CA 3DJ4A 3PKQA 2Y4KA 5CMIA 3SXDA 1ON8A 4D0ZA 4ASYA 4Y6UA 1ZJ1A 4B2XA 1FGXA 1S4NA 1VZXA 2ICXA 2RJ1A 2QH5A 4HO2A 5FTVA 3V0PA 5EJZA 5EJ1A 2XWLA 4M2BA 1JVDA 1HJLA 4P02A 1H7EA 1FWYA 2RJ7A 5C48A 1FXOA 1GQ9A 3TZTA 4FCUA 5CQMX 1WT1A 2V0KA 4NANA 1PZYB 2Y4JA 3NGWA 4KC4A 3OH0A 1R7UA 2I7BA 2X65A 1WVCA 4NAIA 1ZJ3A 1VH1A 3K8EA 1VGTA 3R3IA 4LW3A 2AM3A 2BO4A 4ZDQA 3HL3A 1ZJ2A 5J49A 2A8WA 1OMZA 2VXMA 3V0OA 5C1HA 3I0LA 2ZU9A 2BO7A 1NQIB 4B3UA 4EE5A 4DECA 4Y7FA 2Y4MA 2YQJA 2PA4A 2RJ0A 3I0JA 2RITA 3JTJA 3JUJA 4DDZA 2OI5A 2Z86A 1OMXA 1R81A 4ECMA 5FV9A 5BXCA 4BQHA 2D7IA 1ZJPA 3SX7A 1YP4A 2FYAA 3ZLLA 1I52A 3BRKX 2RJ9A 2Z87A 1G0RA 1V82A 1SS9A 4M2AA 2VXLA 3GUEA 3OKRA 1H7HA 1LL2A 4HO6A 2RIYA 2V0HA 3I0IX 3T7OA 1ZDFA 5C1LA 3EE5A 2VS3A 1VZUA 3SX8A 3IOIA 5EIYA 2QKXA 4D11C 3ZLKA 2AESA 3DUVA 1ZJ0A 2NXVA 2AM4A 4CJCA 1ZI4A 1LVWA 1LL0A 5C4DA 1ZI1A 4EEAA 1QGSA 1JV1A 2GGQA 5CQOA 3IOJA 4CVHA 2P73A 2I5KA 3LW6A 1IINA 1INJA 1FR8A 2O1HA 1H5TA 1GQCA 3U2VA 1HM9A 1R7YA 4L41C 3E26A 1TW1A 3V8ZA 4KPXA 4M28A 2APCA 2OI7A 2X5ZA 4Y7UA 2D7RA 1VPAA 1G8OA 4JD0A 5C38A 4Y63A 2JCKA 3CKQA 1V83A 4HO8A 1ZCVA 3ST8A 4FRPA 2Q4JA 5AJPA 5C4BA 3Q7UA 3R2WA 4M4KA 2ZU8A 4YS8A 2AH9A 3T7MA 4KRVA 1V84A 3V0LA 1TW5A 4HOCA 1LZ7A 4DE7A 5FU8A 5C3DA 1H7FA 2JCOA 1FXJA 2Y6PA 4FRHA 1OQMB 3CKJA 5CMJA 1E5KA 1G93A 4FCEA 5AJNA 4HO9A 3SXGA 3U0XA 3V8YA 2PX7A 1WT3A 2W0VA 5CQNX 5CQPA 5DDVA 1O0RA 2YESA 2FFVA 2WAWA 3V91A 2JCLA 2UX8A 4LW6A 1FG5N 1VICA 1H5SD 4KNRA 4KT7A 1YP3A 1H5RA 3OC9A 4B5BA 3ZGGA 4EEGA 4B4BA 5IFYA 2XWMA 3F1YA 4Y7GA 3U0YA 2XMHA 5FU0A 4D0TA 3POLA 5C3AA 2YQCA 4KNXA 4MYBA 2AGDA 4HO3A 4C2SA 1H4CA 2AE7A 3I0KA 1IIMA 5CMFX 5L6SA 3RMVA 3D98A 2VS5A 2RJ6A 3OGZA 5HS2A 1ZCYA 2A8UA 1R7TA 2XMEA 4KC1A 1G3LA 1VZTA 1VGZA 3SXCA 4Y64A 3RMWA 1ZJOA 2Y4LA 4AAWA
chains in the Genus database with same CATH superfamily
2YC5A 3ZF8A 4HO5A 1GA8A 4IRQA 1H3MA 1H5TB 4O6MA 1G2VA 2X5SA 1H4DA 1HM8A 4HO0A 1ZCUA 5FTSA 1G23A 2VS4A 4NALA 2Y7AA 2RJ8A 1H5SB 3D8VA 3QVBA 1JYKA 4B4MA 5C36A 4FREA 2O1GA 4G3QA 2VSHA 2AM5A 2YC3A 5DDTA 3FWWA 2OEFA 1NKHB 5C4EA 4KQLA 1HJJA 1VGWA 1G9RA 1GWWA 5CMHA 5C47A 3U2XA 4AC3A 1W77A 1H7GA 4P00A 1S4PA 3SXEA 5L6VA 3IOHA 2I5EA 2FFUA 3CKNA 3OH3A 1NWGB 3U2UA 1FR9A 1FO9A 3SPTA 4E1KA 1WSZA 1FGGA 1O23B 4G3PA 4KXOA 4HCQA 4GBPA 1PZTA 4FQWA 1WT2A 1VH3A 1ZDGA 2WVMA 3ZGFA 4D48A 2WVLA 1FOAA 1S4OA 1KWSA 1NHEB 1TZFA 1H7TA 1XHBA 3TQDA 5D92A 4AYJA 1H7QA 2WVKA 4FIYA 5IDTA 4J18A 2CU2A 3CGXA 3U2WA 4G87A 4Y62A 3Q80A 2VD4A 1GX0A 1VGUA 2YQHA 4R7PA 1XZ6A 5JQQA 2JCJA 2GGOA 4EVWA 1R82A 1GWVA 3I0DA 4FRBA 1G1LA 3PNNA 2PGYA 3I0GA 4Q7CA 1QWJA 3SXAA 2P72A 1ZI3A 1JV3A 2FYCB 2V0JA 2V0IA 2WGZA 3SX5A 4ARWA 3V90A 3K8DA 3USQA 1MP4A 2BO6A 2YCMA 4FRAA 2PGVA 2FYBA 2ZU7A 2XWNA 2QGIA 1R80A 3OAMA 4EEMA 1JVGA 2MZBA 5C49A 4FRLA 3OH4A 4MNDA 2RIXA 1H4EA 5C4FA 1R7XA 4G3SA 4HO4A 2WE9A 1O7QA 5C8RA 3T7NA 4AYLA 4Y9XA 4KPZA 3PKPA 4Y6NA 1YP2A 3OH1A 3D5NA 4JISA 1K4VA 3O3PA 3SX3A 3V0NA 1QGQA 1FRWA 2E3DA 5C3BA 3DK5A 1GX4A 2D0JA 2VK9A 3BCVA 3CKOA 1NMMB 1LZIA 3Q4SA 3FOQA 3OH2A 1HV9A 2RJ5A 4FIXA 1W55A 1G97A 3USRA 4XWIA 4Y7TA 4B4GA 4FRMA 2P6WA 1EYRA 3I0CA 4HG6A 2RJ4A 1NF5B 4CJBA 1VM8A 2BO8A 5AJOA 4EE3A 2VSIA 2O1FA 4EEOA 1INIA 1LZJA 3CU0A 1O7OA 2OEGA 4EE4A 1Z90A 3RSBA 1FO8A 1MP5A 4FRQA 1MP3A 3I0FA 1JYLA 4UEGA 1EZIA 4B2WA 3KIAA 1ZCTA 1ZHJA 5I1FA 2W0WA 3V0QA 2FYDB 1WT0A 5FUHA 1TVYA 2FY7A 1H5SC 1R7VA 3JUKA 5CMGX 4BMAA 1G95A 5FYEA 4ASJA 1ZIZA 2OI6A 2YQSA 5CQLX 5C4CA 2WEEA 5IDSA 2E8BA 3V0MA 4B42A 1H5RB 3I0EA 3U2TA 4CJ8A 3N9WA 1MC3A 4NAKA 3CKVA 4FRDA 4KC2A 4Y7VA 1ZI5A 4IRPA 5C1GA 3E25A 1HM0A 2ICYA 1YROB 4FROA 4D11A 1LZ0A 1LL3A 1W57A 1H7LA 1ON6A 2DPWA 4K6RA 2AECA 1H5SA 3I0HA 3SXBA 2X60A 1FZWA 2VFZA 1QG8A 2V0LA 2RIZA 3F1CA 3DJ4A 3PKQA 2Y4KA 5CMIA 3SXDA 1ON8A 4D0ZA 4ASYA 4Y6UA 1ZJ1A 4B2XA 1FGXA 1S4NA 1VZXA 2ICXA 2RJ1A 2QH5A 4HO2A 5FTVA 3V0PA 5EJZA 5EJ1A 2XWLA 4M2BA 1JVDA 1HJLA 4P02A 1H7EA 1FWYA 2RJ7A 5C48A 1FXOA 5D91A 1GQ9A 3TZTA 4FCUA 2C0NA 5CQMX 1WT1A 2V0KA 4NANA 1PZYB 2Y4JA 3NGWA 4KC4A 3OH0A 1R7UA 2I7BA 2X65A 1WVCA 4NAIA 1ZJ3A 1VH1A 3K8EA 1VGTA 3R3IA 4LW3A 2AM3A 2BO4A 4ZDQA 3HL3A 1ZJ2A 5J49A 2A8WA 1OMZA 2VXMA 3V0OA 5C1HA 3I0LA 2ZU9A 2BO7A 1NQIB 4B3UA 4EE5A 4DECA 4Y7FA 2Y4MA 2YQJA 2PA4A 2RJ0A 3I0JA 2RITA 3JTJA 3JUJA 4DDZA 2OI5A 2Z86A 1OMXA 1R81A 4ECMA 5FV9A 5BXCA 4BQHA 2D7IA 1ZJPA 3SX7A 4MIXA 1YP4A 2FYAA 3ZLLA 1I52A 3BRKX 2RJ9A 2Z87A 1G0RA 1V82A 1SS9A 4M2AA 2VXLA 3GUEA 3OKRA 1H7HA 1LL2A 4HO6A 2RIYA 2V0HA 2J0BA 3I0IX 3T7OA 1ZDFA 5C1LA 3EE5A 2VS3A 1VZUA 3SX8A 3IOIA 5EIYA 2QKXA 4D11C 3ZLKA 2AESA 3DUVA 1ZJ0A 2NXVA 2AM4A 4CJCA 1ZI4A 1LVWA 1LL0A 5C4DA 1ZI1A 4EEAA 1QGSA 1JV1A 2GGQA 5CQOA 3IOJA 4CVHA 2P73A 2I5KA 3LW6A 1IINA 1INJA 1FR8A 2O1HA 1H5TA 1GQCA 3U2VA 1HM9A 1R7YA 4L41C 3E26A 1TW1A 3V8ZA 4KPXA 4M28A 2APCA 2OI7A 2X5ZA 4Y7UA 2D7RA 1VPAA 1G8OA 4JD0A 5C38A 4Y63A 2JCKA 3CKQA 1V83A 4HO8A 1ZCVA 3ST8A 4FRPA 2Q4JA 5AJPA 5C4BA 3Q7UA 3R2WA 4M4KA 2ZU8A 4YS8A 2AH9A 3T7MA 4KRVA 1V84A 3V0LA 1TW5A 4HOCA 1LZ7A 4DE7A 5FU8A 5C3DA 1H7FA 2JCOA 1FXJA 2Y6PA 2J0AA 4FRHA 1OQMB 3CKJA 5CMJA 1E5KA 1G93A 4FCEA 5AJNA 4HO9A 3SXGA 3U0XA 3V8YA 2PX7A 1WT3A 2W0VA 5CQNX 5CQPA 5DDVA 1O0RA 2YESA 2FFVA 2WAWA 3V91A 2JCLA 2UX8A 4LW6A 1FG5N 1VICA 1H5SD 4KNRA 4KT7A 1YP3A 1H5RA 3OC9A 4B5BA 3ZGGA 4EEGA 4B4BA 5IFYA 2XWMA 3F1YA 4Y7GA 3U0YA 2XMHA 5FU0A 4D0TA 4O6NA 3POLA 5C3AA 2YQCA 4KNXA 4MYBA 2AGDA 4HO3A 4C2SA 1H4CA 2AE7A 3I0KA 1IIMA 5CMFX 5L6SA 3RMVA 3D98A 2VS5A 2RJ6A 3OGZA 5HS2A 1ZCYA 2A8UA 1R7TA 2XMEA 4KC1A 1G3LA 1VZTA 1VGZA 3SXCA 4Y64A 3RMWA 1ZJOA 2Y4LA 4AAWA
chains in the Genus database with same CATH topology
2YC5A 3ZF8A 4HO5A 1GA8A 4IRQA 1H3MA 1H5TB 4O6MA 1G2VA 2X5SA 1H4DA 1HM8A 4HO0A 1ZCUA 5FTSA 1G23A 2VS4A 4NALA 2Y7AA 2RJ8A 1H5SB 3D8VA 3QVBA 1JYKA 4B4MA 5C36A 4FREA 2O1GA 4G3QA 2VSHA 2AM5A 2YC3A 5DDTA 3FWWA 2OEFA 1NKHB 5C4EA 4KQLA 1HJJA 1VGWA 1G9RA 1GWWA 5CMHA 5C47A 3U2XA 4AC3A 1W77A 1H7GA 4P00A 1S4PA 3SXEA 5L6VA 3IOHA 2I5EA 2FFUA 3CKNA 3OH3A 1NWGB 3U2UA 1FR9A 1FO9A 3SPTA 4E1KA 1WSZA 1FGGA 1O23B 4G3PA 4KXOA 4HCQA 4GBPA 1PZTA 4FQWA 1WT2A 1VH3A 1ZDGA 2WVMA 3ZGFA 4D48A 2WVLA 1FOAA 1S4OA 1KWSA 1NHEB 1TZFA 1H7TA 1XHBA 3TQDA 5D92A 4AYJA 1H7QA 2WVKA 4FIYA 5IDTA 4J18A 2CU2A 3CGXA 3U2WA 4G87A 4Y62A 3Q80A 2VD4A 1GX0A 1VGUA 2YQHA 4R7PA 1XZ6A 5JQQA 2JCJA 2GGOA 4EVWA 1R82A 1GWVA 3I0DA 4FRBA 1G1LA 3PNNA 2PGYA 3I0GA 4Q7CA 1QWJA 3SXAA 2P72A 1ZI3A 1JV3A 2FYCB 2V0JA 2V0IA 2WGZA 3SX5A 4ARWA 3V90A 3K8DA 3USQA 1MP4A 2BO6A 2YCMA 4FRAA 2PGVA 2FYBA 2ZU7A 2XWNA 2QGIA 1R80A 3OAMA 4EEMA 1JVGA 2MZBA 5C49A 4FRLA 3OH4A 4MNDA 2RIXA 1H4EA 5C4FA 1R7XA 4G3SA 4HO4A 2WE9A 1O7QA 5C8RA 3T7NA 4AYLA 4Y9XA 4KPZA 3PKPA 4Y6NA 1YP2A 3OH1A 3D5NA 4JISA 1K4VA 3O3PA 3SX3A 3V0NA 1QGQA 1FRWA 2E3DA 5C3BA 3DK5A 1GX4A 2D0JA 2VK9A 3BCVA 3CKOA 1NMMB 1LZIA 3Q4SA 3FOQA 3OH2A 1HV9A 2RJ5A 4FIXA 1W55A 1G97A 3USRA 4XWIA 4Y7TA 4B4GA 4FRMA 2P6WA 1EYRA 3I0CA 4HG6A 2RJ4A 1NF5B 4CJBA 1VM8A 2BO8A 5AJOA 4EE3A 2VSIA 2O1FA 4EEOA 1INIA 1LZJA 3CU0A 1O7OA 2OEGA 4EE4A 1Z90A 3RSBA 1FO8A 1MP5A 4FRQA 1MP3A 3I0FA 1JYLA 4UEGA 1EZIA 4B2WA 3KIAA 1ZCTA 1ZHJA 5I1FA 2W0WA 3V0QA 2FYDB 1WT0A 5FUHA 1TVYA 2FY7A 1H5SC 1R7VA 3JUKA 5CMGX 4BMAA 1G95A 5FYEA 4ASJA 1ZIZA 2OI6A 2YQSA 5CQLX 5C4CA 2WEEA 5IDSA 2E8BA 3V0MA 4B42A 1H5RB 3I0EA 3U2TA 4CJ8A 3N9WA 1MC3A 4NAKA 3CKVA 4FRDA 4KC2A 4Y7VA 1ZI5A 4IRPA 5C1GA 3E25A 1HM0A 2ICYA 1YROB 4FROA 4D11A 1LZ0A 1LL3A 1W57A 1H7LA 1ON6A 2DPWA 4K6RA 2AECA 1H5SA 3I0HA 3SXBA 2X60A 1FZWA 2VFZA 1QG8A 2V0LA 2RIZA 3F1CA 3DJ4A 3PKQA 2Y4KA 5CMIA 3SXDA 1ON8A 4D0ZA 4ASYA 4Y6UA 1ZJ1A 4B2XA 1FGXA 1S4NA 1VZXA 2ICXA 2RJ1A 2QH5A 4HO2A 5FTVA 3V0PA 5EJZA 5EJ1A 2XWLA 4M2BA 1JVDA 1HJLA 4P02A 1H7EA 1FWYA 2RJ7A 5C48A 1FXOA 5D91A 1GQ9A 3TZTA 4FCUA 2C0NA 5CQMX 1WT1A 2V0KA 4NANA 1PZYB 2Y4JA 3NGWA 4KC4A 3OH0A 1R7UA 2I7BA 2X65A 1WVCA 4NAIA 1ZJ3A 1VH1A 3K8EA 1VGTA 3R3IA 4LW3A 2AM3A 2BO4A 4ZDQA 3HL3A 1ZJ2A 5J49A 2A8WA 1OMZA 2VXMA 3V0OA 5C1HA 3I0LA 2ZU9A 2BO7A 1NQIB 4B3UA 4EE5A 4DECA 4Y7FA 2Y4MA 2YQJA 2PA4A 2RJ0A 3I0JA 2RITA 3JTJA 3JUJA 4DDZA 2OI5A 2Z86A 1OMXA 1R81A 4ECMA 5FV9A 5BXCA 4BQHA 2D7IA 1ZJPA 3SX7A 4MIXA 1YP4A 2FYAA 3ZLLA 1I52A 3BRKX 2RJ9A 2Z87A 1G0RA 1V82A 1SS9A 4M2AA 2VXLA 3GUEA 3OKRA 1H7HA 1LL2A 4HO6A 2RIYA 2V0HA 2J0BA 3I0IX 3T7OA 1ZDFA 5C1LA 3EE5A 2VS3A 1VZUA 3SX8A 3IOIA 5EIYA 2QKXA 4D11C 3ZLKA 2AESA 3DUVA 1ZJ0A 2NXVA 2AM4A 4CJCA 1ZI4A 1LVWA 1LL0A 5C4DA 1ZI1A 4EEAA 1QGSA 1JV1A 2GGQA 5CQOA 3IOJA 4CVHA 2P73A 2I5KA 3LW6A 1IINA 1INJA 1FR8A 2O1HA 1H5TA 1GQCA 3U2VA 1HM9A 1R7YA 4L41C 3E26A 1TW1A 3V8ZA 4KPXA 4M28A 2APCA 2OI7A 2X5ZA 4Y7UA 2D7RA 1VPAA 1G8OA 4JD0A 5C38A 4Y63A 2JCKA 3CKQA 1V83A 4HO8A 1ZCVA 3ST8A 4FRPA 2Q4JA 5AJPA 5C4BA 3Q7UA 3R2WA 4M4KA 2ZU8A 4YS8A 2AH9A 3T7MA 4KRVA 1V84A 3V0LA 1TW5A 4HOCA 1LZ7A 4DE7A 5FU8A 5C3DA 1H7FA 2JCOA 1FXJA 2Y6PA 2J0AA 4FRHA 1OQMB 3CKJA 5CMJA 1E5KA 1G93A 4FCEA 5AJNA 4HO9A 3SXGA 3U0XA 3V8YA 2PX7A 1WT3A 2W0VA 5CQNX 5CQPA 5DDVA 1O0RA 2YESA 2FFVA 2WAWA 3V91A 2JCLA 2UX8A 4LW6A 1FG5N 1VICA 1H5SD 4KNRA 4KT7A 1YP3A 1H5RA 3OC9A 4B5BA 3ZGGA 4EEGA 4B4BA 5IFYA 2XWMA 3F1YA 4Y7GA 3U0YA 2XMHA 5FU0A 4D0TA 4O6NA 3POLA 5C3AA 2YQCA 4KNXA 4MYBA 2AGDA 4HO3A 4C2SA 1H4CA 2AE7A 3I0KA 1IIMA 5CMFX 5L6SA 3RMVA 3D98A 2VS5A 2RJ6A 3OGZA 5HS2A 1ZCYA 2A8UA 1R7TA 2XMEA 4KC1A 1G3LA 1VZTA 1VGZA 3SXCA 4Y64A 3RMWA 1ZJOA 2Y4LA 4AAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YC5 A;  3ZF8 A;  4HO5 A;  1GA8 A;  4IRQ A;  1H3M A;  1H5T B;  1G2V A;  2X5S A;  1H4D A;  1HM8 A;  4HO0 A;  1ZCU A;  5FTS A;  1G23 A;  2VS4 A;  4NAL A;  2Y7A A;  2RJ8 A;  1H5S B;  3D8V A;  3QVB A;  1JYK A;  4B4M A;  5C36 A;  4FRE A;  2O1G A;  4G3Q A;  2VSH A;  2AM5 A;  2YC3 A;  5DDT A;  3FWW A;  2OEF A;  1NKH B;  5C4E A;  4KQL A;  1HJJ A;  1VGW A;  1G9R A;  1GWW A;  5CMH A;  5C47 A;  3U2X A;  4AC3 A;  1W77 A;  1H7G A;  4P00 A;  1S4P A;  3SXE A;  5L6V A;  3IOH A;  2I5E A;  2FFU A;  3CKN A;  3OH3 A;  1NWG B;  3U2U A;  1FR9 A;  1FO9 A;  3SPT A;  4E1K A;  1WSZ A;  1FGG A;  1O23 B;  4G3P A;  4KXO A;  4HCQ A;  4GBP A;  1PZT A;  4FQW A;  1WT2 A;  1VH3 A;  1ZDG A;  2WVM A;  3ZGF A;  4D48 A;  2WVL A;  1FOA A;  1S4O A;  1KWS A;  1NHE B;  1TZF A;  1H7T A;  1XHB A;  3TQD A;  4AYJ A;  1H7Q A;  2WVK A;  5IDT A;  4J18 A;  2CU2 A;  3CGX A;  3U2W A;  4G87 A;  4Y62 A;  3Q80 A;  2VD4 A;  1GX0 A;  1VGU A;  2YQH A;  4R7P A;  1XZ6 A;  5JQQ A;  2JCJ A;  2GGO A;  4EVW A;  1R82 A;  1GWV A;  3I0D A;  4FRB A;  1G1L A;  3PNN A;  2PGY A;  3I0G A;  1QWJ A;  3SXA A;  2P72 A;  1ZI3 A;  1JV3 A;  2FYC B;  2V0J A;  2V0I A;  2WGZ A;  3SX5 A;  4ARW A;  3V90 A;  3K8D A;  3USQ A;  1MP4 A;  2BO6 A;  2YCM A;  4FRA A;  2PGV A;  2FYB A;  2ZU7 A;  2XWN A;  2QGI A;  1R80 A;  3OAM A;  4EEM A;  1JVG A;  2MZB A;  5C49 A;  4FRL A;  3OH4 A;  4MND A;  2RIX A;  1H4E A;  5C4F A;  1R7X A;  4G3S A;  4HO4 A;  2WE9 A;  1O7Q A;  5C8R A;  3T7N A;  4AYL A;  4Y9X A;  4KPZ A;  3PKP A;  4Y6N A;  1YP2 A;  3OH1 A;  3D5N A;  4JIS A;  1K4V A;  3O3P A;  3SX3 A;  3V0N A;  1QGQ A;  1FRW A;  2E3D A;  5C3B A;  3DK5 A;  1GX4 A;  2D0J A;  3BCV A;  3CKO A;  1NMM B;  1LZI A;  3Q4S A;  3FOQ A;  3OH2 A;  1HV9 A;  2RJ5 A;  1W55 A;  1G97 A;  3USR A;  4XWI A;  4Y7T A;  4B4G A;  4FRM A;  2P6W A;  1EYR A;  3I0C A;  4HG6 A;  2RJ4 A;  1NF5 B;  4CJB A;  1VM8 A;  2BO8 A;  5AJO A;  4EE3 A;  2VSI A;  2O1F A;  4EEO A;  1INI A;  1LZJ A;  3CU0 A;  1O7O A;  2OEG A;  4EE4 A;  1Z90 A;  3RSB A;  1FO8 A;  1MP5 A;  4FRQ A;  1MP3 A;  3I0F A;  1JYL A;  4UEG A;  1EZI A;  4B2W A;  3KIA A;  1ZCT A;  1ZHJ A;  5I1F A;  2W0W A;  3V0Q A;  2FYD B;  1WT0 A;  5FUH A;  1TVY A;  2FY7 A;  1H5S C;  1R7V A;  3JUK A;  5CMG X;  4BMA A;  1G95 A;  5FYE A;  4ASJ A;  1ZIZ A;  2OI6 A;  2YQS A;  5CQL X;  5C4C A;  2WEE A;  5IDS A;  2E8B A;  3V0M A;  4B42 A;  1H5R B;  3I0E A;  3U2T A;  4CJ8 A;  3N9W A;  1MC3 A;  4NAK A;  3CKV A;  4FRD A;  4KC2 A;  4Y7V A;  1ZI5 A;  4IRP A;  5C1G A;  3E25 A;  1HM0 A;  2ICY A;  1YRO B;  4FRO A;  4D11 A;  1LZ0 A;  1LL3 A;  1W57 A;  1H7L A;  1ON6 A;  2DPW A;  4K6R A;  2AEC A;  1H5S A;  3I0H A;  3SXB A;  2X60 A;  1FZW A;  2VFZ A;  1QG8 A;  2V0L A;  2RIZ A;  3F1C A;  3DJ4 A;  3PKQ A;  2Y4K A;  5CMI A;  3SXD A;  1ON8 A;  4D0Z A;  4ASY A;  4Y6U A;  1ZJ1 A;  4B2X A;  1FGX A;  1S4N A;  1VZX A;  2ICX A;  2RJ1 A;  2QH5 A;  4HO2 A;  5FTV A;  3V0P A;  5EJZ A;  5EJ1 A;  2XWL A;  4M2B A;  1JVD A;  1HJL A;  4P02 A;  1H7E A;  1FWY A;  2RJ7 A;  5C48 A;  1FXO A;  1GQ9 A;  3TZT A;  4FCU A;  5CQM X;  1WT1 A;  2V0K A;  4NAN A;  1PZY B;  2Y4J A;  3NGW A;  4KC4 A;  3OH0 A;  1R7U A;  2I7B A;  2X65 A;  1WVC A;  4NAI A;  1ZJ3 A;  1VH1 A;  3K8E A;  1VGT A;  3R3I A;  4LW3 A;  2AM3 A;  2BO4 A;  4ZDQ A;  3HL3 A;  1ZJ2 A;  5J49 A;  2A8W A;  1OMZ A;  2VXM A;  3V0O A;  5C1H A;  3I0L A;  2ZU9 A;  2BO7 A;  1NQI B;  4B3U A;  4EE5 A;  4DEC A;  4Y7F A;  2Y4M A;  2YQJ A;  2PA4 A;  2RJ0 A;  3I0J A;  2RIT A;  3JTJ A;  3JUJ A;  4DDZ A;  2OI5 A;  2Z86 A;  1OMX A;  1R81 A;  4ECM A;  5FV9 A;  5BXC A;  4BQH A;  2D7I A;  1ZJP A;  3SX7 A;  1YP4 A;  2FYA A;  3ZLL A;  1I52 A;  3BRK X;  2RJ9 A;  2Z87 A;  1G0R A;  1V82 A;  1SS9 A;  4M2A A;  2VXL A;  3GUE A;  3OKR A;  1H7H A;  1LL2 A;  4HO6 A;  2RIY A;  2V0H A;  3I0I X;  3T7O A;  1ZDF A;  5C1L A;  3EE5 A;  2VS3 A;  1VZU A;  3SX8 A;  3IOI A;  5EIY A;  2QKX A;  4D11 C;  3ZLK A;  2AES A;  3DUV A;  1ZJ0 A;  2NXV A;  2AM4 A;  4CJC A;  1ZI4 A;  1LVW A;  1LL0 A;  5C4D A;  1ZI1 A;  4EEA A;  1QGS A;  1JV1 A;  2GGQ A;  5CQO A;  3IOJ A;  4CVH A;  2P73 A;  2I5K A;  3LW6 A;  1IIN A;  1INJ A;  1FR8 A;  2O1H A;  1H5T A;  1GQC A;  3U2V A;  1HM9 A;  1R7Y A;  4L41 C;  3E26 A;  1TW1 A;  3V8Z A;  4KPX A;  4M28 A;  2APC A;  2OI7 A;  2X5Z A;  4Y7U A;  2D7R A;  1VPA A;  1G8O A;  4JD0 A;  5C38 A;  4Y63 A;  2JCK A;  3CKQ A;  1V83 A;  4HO8 A;  1ZCV A;  3ST8 A;  4FRP A;  2Q4J A;  5AJP A;  5C4B A;  3Q7U A;  3R2W A;  4M4K A;  2ZU8 A;  4YS8 A;  2AH9 A;  3T7M A;  4KRV A;  1V84 A;  3V0L A;  1TW5 A;  4HOC A;  1LZ7 A;  4DE7 A;  5FU8 A;  5C3D A;  1H7F A;  2JCO A;  1FXJ A;  2Y6P A;  4FRH A;  1OQM B;  3CKJ A;  5CMJ A;  1E5K A;  1G93 A;  4FCE A;  5AJN A;  4HO9 A;  3SXG A;  3U0X A;  3V8Y A;  2PX7 A;  1WT3 A;  2W0V A;  5CQN X;  5CQP A;  5DDV A;  1O0R A;  2YES A;  2FFV A;  2WAW A;  3V91 A;  2JCL A;  2UX8 A;  4LW6 A;  1FG5 N;  1VIC A;  1H5S D;  4KNR A;  4KT7 A;  1YP3 A;  1H5R A;  3OC9 A;  4B5B A;  3ZGG A;  4EEG A;  4B4B A;  5IFY A;  2XWM A;  3F1Y A;  4Y7G A;  3U0Y A;  2XMH A;  5FU0 A;  4D0T A;  3POL A;  5C3A A;  2YQC A;  4KNX A;  4MYB A;  2AGD A;  4HO3 A;  4C2S A;  1H4C A;  2AE7 A;  3I0K A;  1IIM A;  5CMF X;  5L6S A;  3RMV A;  3D98 A;  2VS5 A;  2RJ6 A;  3OGZ A;  5HS2 A;  1ZCY A;  2A8U A;  1R7T A;  2XME A;  4KC1 A;  1G3L A;  1VZT A;  1VGZ A;  3SXC A;  4Y64 A;  3RMW A;  1ZJO A;  2Y4L A;  4AAW A; 
#chains in the Genus database with same CATH topology
 2YC5 A;  3ZF8 A;  4HO5 A;  1GA8 A;  4IRQ A;  1H3M A;  1H5T B;  4O6M A;  1G2V A;  2X5S A;  1H4D A;  1HM8 A;  4HO0 A;  1ZCU A;  5FTS A;  1G23 A;  2VS4 A;  4NAL A;  2Y7A A;  2RJ8 A;  1H5S B;  3D8V A;  3QVB A;  1JYK A;  4B4M A;  5C36 A;  4FRE A;  2O1G A;  4G3Q A;  2VSH A;  2AM5 A;  2YC3 A;  5DDT A;  3FWW A;  2OEF A;  1NKH B;  5C4E A;  4KQL A;  1HJJ A;  1VGW A;  1G9R A;  1GWW A;  5CMH A;  5C47 A;  3U2X A;  4AC3 A;  1W77 A;  1H7G A;  4P00 A;  1S4P A;  3SXE A;  5L6V A;  3IOH A;  2I5E A;  2FFU A;  3CKN A;  3OH3 A;  1NWG B;  3U2U A;  1FR9 A;  1FO9 A;  3SPT A;  4E1K A;  1WSZ A;  1FGG A;  1O23 B;  4G3P A;  4KXO A;  4HCQ A;  4GBP A;  1PZT A;  4FQW A;  1WT2 A;  1VH3 A;  1ZDG A;  2WVM A;  3ZGF A;  4D48 A;  2WVL A;  1FOA A;  1S4O A;  1KWS A;  1NHE B;  1TZF A;  1H7T A;  1XHB A;  3TQD A;  5D92 A;  4AYJ A;  1H7Q A;  2WVK A;  4FIY A;  5IDT A;  4J18 A;  2CU2 A;  3CGX A;  3U2W A;  4G87 A;  4Y62 A;  3Q80 A;  2VD4 A;  1GX0 A;  1VGU A;  2YQH A;  4R7P A;  1XZ6 A;  5JQQ A;  2JCJ A;  2GGO A;  4EVW A;  1R82 A;  1GWV A;  3I0D A;  4FRB A;  1G1L A;  3PNN A;  2PGY A;  3I0G A;  4Q7C A;  1QWJ A;  3SXA A;  2P72 A;  1ZI3 A;  1JV3 A;  2FYC B;  2V0J A;  2V0I A;  2WGZ A;  3SX5 A;  4ARW A;  3V90 A;  3K8D A;  3USQ A;  1MP4 A;  2BO6 A;  2YCM A;  4FRA A;  2PGV A;  2FYB A;  2ZU7 A;  2XWN A;  2QGI A;  1R80 A;  3OAM A;  4EEM A;  1JVG A;  2MZB A;  5C49 A;  4FRL A;  3OH4 A;  4MND A;  2RIX A;  1H4E A;  5C4F A;  1R7X A;  4G3S A;  4HO4 A;  2WE9 A;  1O7Q A;  5C8R A;  3T7N A;  4AYL A;  4Y9X A;  4KPZ A;  3PKP A;  4Y6N A;  1YP2 A;  3OH1 A;  3D5N A;  4JIS A;  1K4V A;  3O3P A;  3SX3 A;  3V0N A;  1QGQ A;  1FRW A;  2E3D A;  5C3B A;  3DK5 A;  1GX4 A;  2D0J A;  2VK9 A;  3BCV A;  3CKO A;  1NMM B;  1LZI A;  3Q4S A;  3FOQ A;  3OH2 A;  1HV9 A;  2RJ5 A;  4FIX A;  1W55 A;  1G97 A;  3USR A;  4XWI A;  4Y7T A;  4B4G A;  4FRM A;  2P6W A;  1EYR A;  3I0C A;  4HG6 A;  2RJ4 A;  1NF5 B;  4CJB A;  1VM8 A;  2BO8 A;  5AJO A;  4EE3 A;  2VSI A;  2O1F A;  4EEO A;  1INI A;  1LZJ A;  3CU0 A;  1O7O A;  2OEG A;  4EE4 A;  1Z90 A;  3RSB A;  1FO8 A;  1MP5 A;  4FRQ A;  1MP3 A;  3I0F A;  1JYL A;  4UEG A;  1EZI A;  4B2W A;  3KIA A;  1ZCT A;  1ZHJ A;  5I1F A;  2W0W A;  3V0Q A;  2FYD B;  1WT0 A;  5FUH A;  1TVY A;  2FY7 A;  1H5S C;  1R7V A;  3JUK A;  5CMG X;  4BMA A;  1G95 A;  5FYE A;  4ASJ A;  1ZIZ A;  2OI6 A;  2YQS A;  5CQL X;  5C4C A;  2WEE A;  5IDS A;  2E8B A;  3V0M A;  4B42 A;  1H5R B;  3I0E A;  3U2T A;  4CJ8 A;  3N9W A;  1MC3 A;  4NAK A;  3CKV A;  4FRD A;  4KC2 A;  4Y7V A;  1ZI5 A;  4IRP A;  5C1G A;  3E25 A;  1HM0 A;  2ICY A;  1YRO B;  4FRO A;  4D11 A;  1LZ0 A;  1LL3 A;  1W57 A;  1H7L A;  1ON6 A;  2DPW A;  4K6R A;  2AEC A;  1H5S A;  3I0H A;  3SXB A;  2X60 A;  1FZW A;  2VFZ A;  1QG8 A;  2V0L A;  2RIZ A;  3F1C A;  3DJ4 A;  3PKQ A;  2Y4K A;  5CMI A;  3SXD A;  1ON8 A;  4D0Z A;  4ASY A;  4Y6U A;  1ZJ1 A;  4B2X A;  1FGX A;  1S4N A;  1VZX A;  2ICX A;  2RJ1 A;  2QH5 A;  4HO2 A;  5FTV A;  3V0P A;  5EJZ A;  5EJ1 A;  2XWL A;  4M2B A;  1JVD A;  1HJL A;  4P02 A;  1H7E A;  1FWY A;  2RJ7 A;  5C48 A;  1FXO A;  5D91 A;  1GQ9 A;  3TZT A;  4FCU A;  2C0N A;  5CQM X;  1WT1 A;  2V0K A;  4NAN A;  1PZY B;  2Y4J A;  3NGW A;  4KC4 A;  3OH0 A;  1R7U A;  2I7B A;  2X65 A;  1WVC A;  4NAI A;  1ZJ3 A;  1VH1 A;  3K8E A;  1VGT A;  3R3I A;  4LW3 A;  2AM3 A;  2BO4 A;  4ZDQ A;  3HL3 A;  1ZJ2 A;  5J49 A;  2A8W A;  1OMZ A;  2VXM A;  3V0O A;  5C1H A;  3I0L A;  2ZU9 A;  2BO7 A;  1NQI B;  4B3U A;  4EE5 A;  4DEC A;  4Y7F A;  2Y4M A;  2YQJ A;  2PA4 A;  2RJ0 A;  3I0J A;  2RIT A;  3JTJ A;  3JUJ A;  4DDZ A;  2OI5 A;  2Z86 A;  1OMX A;  1R81 A;  4ECM A;  5FV9 A;  5BXC A;  4BQH A;  2D7I A;  1ZJP A;  3SX7 A;  4MIX A;  1YP4 A;  2FYA A;  3ZLL A;  1I52 A;  3BRK X;  2RJ9 A;  2Z87 A;  1G0R A;  1V82 A;  1SS9 A;  4M2A A;  2VXL A;  3GUE A;  3OKR A;  1H7H A;  1LL2 A;  4HO6 A;  2RIY A;  2V0H A;  2J0B A;  3I0I X;  3T7O A;  1ZDF A;  5C1L A;  3EE5 A;  2VS3 A;  1VZU A;  3SX8 A;  3IOI A;  5EIY A;  2QKX A;  4D11 C;  3ZLK A;  2AES A;  3DUV A;  1ZJ0 A;  2NXV A;  2AM4 A;  4CJC A;  1ZI4 A;  1LVW A;  1LL0 A;  5C4D A;  1ZI1 A;  4EEA A;  1QGS A;  1JV1 A;  2GGQ A;  5CQO A;  3IOJ A;  4CVH A;  2P73 A;  2I5K A;  3LW6 A;  1IIN A;  1INJ A;  1FR8 A;  2O1H A;  1H5T A;  1GQC A;  3U2V A;  1HM9 A;  1R7Y A;  4L41 C;  3E26 A;  1TW1 A;  3V8Z A;  4KPX A;  4M28 A;  2APC A;  2OI7 A;  2X5Z A;  4Y7U A;  2D7R A;  1VPA A;  1G8O A;  4JD0 A;  5C38 A;  4Y63 A;  2JCK A;  3CKQ A;  1V83 A;  4HO8 A;  1ZCV A;  3ST8 A;  4FRP A;  2Q4J A;  5AJP A;  5C4B A;  3Q7U A;  3R2W A;  4M4K A;  2ZU8 A;  4YS8 A;  2AH9 A;  3T7M A;  4KRV A;  1V84 A;  3V0L A;  1TW5 A;  4HOC A;  1LZ7 A;  4DE7 A;  5FU8 A;  5C3D A;  1H7F A;  2JCO A;  1FXJ A;  2Y6P A;  2J0A A;  4FRH A;  1OQM B;  3CKJ A;  5CMJ A;  1E5K A;  1G93 A;  4FCE A;  5AJN A;  4HO9 A;  3SXG A;  3U0X A;  3V8Y A;  2PX7 A;  1WT3 A;  2W0V A;  5CQN X;  5CQP A;  5DDV A;  1O0R A;  2YES A;  2FFV A;  2WAW A;  3V91 A;  2JCL A;  2UX8 A;  4LW6 A;  1FG5 N;  1VIC A;  1H5S D;  4KNR A;  4KT7 A;  1YP3 A;  1H5R A;  3OC9 A;  4B5B A;  3ZGG A;  4EEG A;  4B4B A;  5IFY A;  2XWM A;  3F1Y A;  4Y7G A;  3U0Y A;  2XMH A;  5FU0 A;  4D0T A;  4O6N A;  3POL A;  5C3A A;  2YQC A;  4KNX A;  4MYB A;  2AGD A;  4HO3 A;  4C2S A;  1H4C A;  2AE7 A;  3I0K A;  1IIM A;  5CMF X;  5L6S A;  3RMV A;  3D98 A;  2VS5 A;  2RJ6 A;  3OGZ A;  5HS2 A;  1ZCY A;  2A8U A;  1R7T A;  2XME A;  4KC1 A;  1G3L A;  1VZT A;  1VGZ A;  3SXC A;  4Y64 A;  3RMW A;  1ZJO A;  2Y4L A;  4AAW A; 
#chains in the Genus database with same CATH homology
 2YC5 A;  3ZF8 A;  4HO5 A;  1GA8 A;  4IRQ A;  1H3M A;  1H5T B;  4O6M A;  1G2V A;  2X5S A;  1H4D A;  1HM8 A;  4HO0 A;  1ZCU A;  5FTS A;  1G23 A;  2VS4 A;  4NAL A;  2Y7A A;  2RJ8 A;  1H5S B;  3D8V A;  3QVB A;  1JYK A;  4B4M A;  5C36 A;  4FRE A;  2O1G A;  4G3Q A;  2VSH A;  2AM5 A;  2YC3 A;  5DDT A;  3FWW A;  2OEF A;  1NKH B;  5C4E A;  4KQL A;  1HJJ A;  1VGW A;  1G9R A;  1GWW A;  5CMH A;  5C47 A;  3U2X A;  4AC3 A;  1W77 A;  1H7G A;  4P00 A;  1S4P A;  3SXE A;  5L6V A;  3IOH A;  2I5E A;  2FFU A;  3CKN A;  3OH3 A;  1NWG B;  3U2U A;  1FR9 A;  1FO9 A;  3SPT A;  4E1K A;  1WSZ A;  1FGG A;  1O23 B;  4G3P A;  4KXO A;  4HCQ A;  4GBP A;  1PZT A;  4FQW A;  1WT2 A;  1VH3 A;  1ZDG A;  2WVM A;  3ZGF A;  4D48 A;  2WVL A;  1FOA A;  1S4O A;  1KWS A;  1NHE B;  1TZF A;  1H7T A;  1XHB A;  3TQD A;  5D92 A;  4AYJ A;  1H7Q A;  2WVK A;  4FIY A;  5IDT A;  4J18 A;  2CU2 A;  3CGX A;  3U2W A;  4G87 A;  4Y62 A;  3Q80 A;  2VD4 A;  1GX0 A;  1VGU A;  2YQH A;  4R7P A;  1XZ6 A;  5JQQ A;  2JCJ A;  2GGO A;  4EVW A;  1R82 A;  1GWV A;  3I0D A;  4FRB A;  1G1L A;  3PNN A;  2PGY A;  3I0G A;  4Q7C A;  1QWJ A;  3SXA A;  2P72 A;  1ZI3 A;  1JV3 A;  2FYC B;  2V0J A;  2V0I A;  2WGZ A;  3SX5 A;  4ARW A;  3V90 A;  3K8D A;  3USQ A;  1MP4 A;  2BO6 A;  2YCM A;  4FRA A;  2PGV A;  2FYB A;  2ZU7 A;  2XWN A;  2QGI A;  1R80 A;  3OAM A;  4EEM A;  1JVG A;  2MZB A;  5C49 A;  4FRL A;  3OH4 A;  4MND A;  2RIX A;  1H4E A;  5C4F A;  1R7X A;  4G3S A;  4HO4 A;  2WE9 A;  1O7Q A;  5C8R A;  3T7N A;  4AYL A;  4Y9X A;  4KPZ A;  3PKP A;  4Y6N A;  1YP2 A;  3OH1 A;  3D5N A;  4JIS A;  1K4V A;  3O3P A;  3SX3 A;  3V0N A;  1QGQ A;  1FRW A;  2E3D A;  5C3B A;  3DK5 A;  1GX4 A;  2D0J A;  2VK9 A;  3BCV A;  3CKO A;  1NMM B;  1LZI A;  3Q4S A;  3FOQ A;  3OH2 A;  1HV9 A;  2RJ5 A;  4FIX A;  1W55 A;  1G97 A;  3USR A;  4XWI A;  4Y7T A;  4B4G A;  4FRM A;  2P6W A;  1EYR A;  3I0C A;  4HG6 A;  2RJ4 A;  1NF5 B;  4CJB A;  1VM8 A;  2BO8 A;  5AJO A;  4EE3 A;  2VSI A;  2O1F A;  4EEO A;  1INI A;  1LZJ A;  3CU0 A;  1O7O A;  2OEG A;  4EE4 A;  1Z90 A;  3RSB A;  1FO8 A;  1MP5 A;  4FRQ A;  1MP3 A;  3I0F A;  1JYL A;  4UEG A;  1EZI A;  4B2W A;  3KIA A;  1ZCT A;  1ZHJ A;  5I1F A;  2W0W A;  3V0Q A;  2FYD B;  1WT0 A;  5FUH A;  1TVY A;  2FY7 A;  1H5S C;  1R7V A;  3JUK A;  5CMG X;  4BMA A;  1G95 A;  5FYE A;  4ASJ A;  1ZIZ A;  2OI6 A;  2YQS A;  5CQL X;  5C4C A;  2WEE A;  5IDS A;  2E8B A;  3V0M A;  4B42 A;  1H5R B;  3I0E A;  3U2T A;  4CJ8 A;  3N9W A;  1MC3 A;  4NAK A;  3CKV A;  4FRD A;  4KC2 A;  4Y7V A;  1ZI5 A;  4IRP A;  5C1G A;  3E25 A;  1HM0 A;  2ICY A;  1YRO B;  4FRO A;  4D11 A;  1LZ0 A;  1LL3 A;  1W57 A;  1H7L A;  1ON6 A;  2DPW A;  4K6R A;  2AEC A;  1H5S A;  3I0H A;  3SXB A;  2X60 A;  1FZW A;  2VFZ A;  1QG8 A;  2V0L A;  2RIZ A;  3F1C A;  3DJ4 A;  3PKQ A;  2Y4K A;  5CMI A;  3SXD A;  1ON8 A;  4D0Z A;  4ASY A;  4Y6U A;  1ZJ1 A;  4B2X A;  1FGX A;  1S4N A;  1VZX A;  2ICX A;  2RJ1 A;  2QH5 A;  4HO2 A;  5FTV A;  3V0P A;  5EJZ A;  5EJ1 A;  2XWL A;  4M2B A;  1JVD A;  1HJL A;  4P02 A;  1H7E A;  1FWY A;  2RJ7 A;  5C48 A;  1FXO A;  5D91 A;  1GQ9 A;  3TZT A;  4FCU A;  2C0N A;  5CQM X;  1WT1 A;  2V0K A;  4NAN A;  1PZY B;  2Y4J A;  3NGW A;  4KC4 A;  3OH0 A;  1R7U A;  2I7B A;  2X65 A;  1WVC A;  4NAI A;  1ZJ3 A;  1VH1 A;  3K8E A;  1VGT A;  3R3I A;  4LW3 A;  2AM3 A;  2BO4 A;  4ZDQ A;  3HL3 A;  1ZJ2 A;  5J49 A;  2A8W A;  1OMZ A;  2VXM A;  3V0O A;  5C1H A;  3I0L A;  2ZU9 A;  2BO7 A;  1NQI B;  4B3U A;  4EE5 A;  4DEC A;  4Y7F A;  2Y4M A;  2YQJ A;  2PA4 A;  2RJ0 A;  3I0J A;  2RIT A;  3JTJ A;  3JUJ A;  4DDZ A;  2OI5 A;  2Z86 A;  1OMX A;  1R81 A;  4ECM A;  5FV9 A;  5BXC A;  4BQH A;  2D7I A;  1ZJP A;  3SX7 A;  4MIX A;  1YP4 A;  2FYA A;  3ZLL A;  1I52 A;  3BRK X;  2RJ9 A;  2Z87 A;  1G0R A;  1V82 A;  1SS9 A;  4M2A A;  2VXL A;  3GUE A;  3OKR A;  1H7H A;  1LL2 A;  4HO6 A;  2RIY A;  2V0H A;  2J0B A;  3I0I X;  3T7O A;  1ZDF A;  5C1L A;  3EE5 A;  2VS3 A;  1VZU A;  3SX8 A;  3IOI A;  5EIY A;  2QKX A;  4D11 C;  3ZLK A;  2AES A;  3DUV A;  1ZJ0 A;  2NXV A;  2AM4 A;  4CJC A;  1ZI4 A;  1LVW A;  1LL0 A;  5C4D A;  1ZI1 A;  4EEA A;  1QGS A;  1JV1 A;  2GGQ A;  5CQO A;  3IOJ A;  4CVH A;  2P73 A;  2I5K A;  3LW6 A;  1IIN A;  1INJ A;  1FR8 A;  2O1H A;  1H5T A;  1GQC A;  3U2V A;  1HM9 A;  1R7Y A;  4L41 C;  3E26 A;  1TW1 A;  3V8Z A;  4KPX A;  4M28 A;  2APC A;  2OI7 A;  2X5Z A;  4Y7U A;  2D7R A;  1VPA A;  1G8O A;  4JD0 A;  5C38 A;  4Y63 A;  2JCK A;  3CKQ A;  1V83 A;  4HO8 A;  1ZCV A;  3ST8 A;  4FRP A;  2Q4J A;  5AJP A;  5C4B A;  3Q7U A;  3R2W A;  4M4K A;  2ZU8 A;  4YS8 A;  2AH9 A;  3T7M A;  4KRV A;  1V84 A;  3V0L A;  1TW5 A;  4HOC A;  1LZ7 A;  4DE7 A;  5FU8 A;  5C3D A;  1H7F A;  2JCO A;  1FXJ A;  2Y6P A;  2J0A A;  4FRH A;  1OQM B;  3CKJ A;  5CMJ A;  1E5K A;  1G93 A;  4FCE A;  5AJN A;  4HO9 A;  3SXG A;  3U0X A;  3V8Y A;  2PX7 A;  1WT3 A;  2W0V A;  5CQN X;  5CQP A;  5DDV A;  1O0R A;  2YES A;  2FFV A;  2WAW A;  3V91 A;  2JCL A;  2UX8 A;  4LW6 A;  1FG5 N;  1VIC A;  1H5S D;  4KNR A;  4KT7 A;  1YP3 A;  1H5R A;  3OC9 A;  4B5B A;  3ZGG A;  4EEG A;  4B4B A;  5IFY A;  2XWM A;  3F1Y A;  4Y7G A;  3U0Y A;  2XMH A;  5FU0 A;  4D0T A;  4O6N A;  3POL A;  5C3A A;  2YQC A;  4KNX A;  4MYB A;  2AGD A;  4HO3 A;  4C2S A;  1H4C A;  2AE7 A;  3I0K A;  1IIM A;  5CMF X;  5L6S A;  3RMV A;  3D98 A;  2VS5 A;  2RJ6 A;  3OGZ A;  5HS2 A;  1ZCY A;  2A8U A;  1R7T A;  2XME A;  4KC1 A;  1G3L A;  1VZT A;  1VGZ A;  3SXC A;  4Y64 A;  3RMW A;  1ZJO A;  2Y4L A;  4AAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...