2XMHA

The x-ray structure of ctp:inositol-1-phosphate cytidylyltransferase from archaeoglobus fulgidus
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
205
structure length
196
Chain Sequence
IKLMKAVILAVPKPLVRVGGCEIILRTMKLLSPHVSEFIIVASRYADDIDAFLKDKGFNYKIVRHDRPEKGNGYSLLVAKNHVEDRFILTMGDHVYSQQFIEKAVRGEGVIADREPRFVDIGEATKIRVEDGRVAKIGKDLREFDCVDTGFFVLDDSIFEHAEKLRDREEIPLSEIVKLARLPVTYVDGELWMDVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CTP-INOSITOL-1-PHOSPHATE CYTIDYLYLTRANSFERASE
publication title Crystal structure of Archaeoglobus fulgidus CTP:inositol-1-phosphate cytidylyltransferase, a key enzyme for di-myo-inositol-phosphate synthesis in (hyper)thermophiles.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Transferase
total genus 59
structure length 196
sequence length 205
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.74: 1L-myo-inositol 1-phosphate cytidylyltransferase.
pdb deposition date 2010-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2xmhA00
1O7QA 4D48A 1JYKA 4G3SA 3CKOA 1HJJA 1S4PA 3I0LA 4IRPA 4D11A 4HO9A 3T7MA 2OI7A 1R7VA 4KC4A 3T7NA 2RIYA 3N9WA 4AC3A 5FV9A 1V84A 3FOQA 4MNDA 2YCMA 1HJLA 4FRLA 1GX4A 2JCKA 4KNXA 5CQPA 4FRMA 5CMIA 2RJ9A 4HO3A 1H7LA 2RIXA 1K4VA 2OI6A 2FY7A 4J18A 4JISA 4NANA 5CMHA 1WT0A 1R7YA 1FR9A 5L6VA 5FUHA 5C4BA 1ZDGA 5JQQA 4HO5A 3ZLLA 3CKQA 2PA4A 1WT1A 4M2AA 1WVCA 4GBPA 1G97A 1TVYA 2O1GA 3CGXA 5EIYA 4KRVA 3U2WA 1VH1A 4EEOA 4HCQA 5FU0A 2PGYA 2V0LA 4NALA 4KC2A 3POLA 5C4DA 2PX7A 1R7TA 5C38A 1FGGA 5C3BA 1EZIA 1G0RA 4KQLA 1NQIB 4B4BA 1JV3A 3OGZA 4HOCA 2APCA 2Z87A 1FXOA 2OEFA 4AYJA 5AJNA 5C4EA 4C2SA 1NHEB 3U2UA 3OH3A 4FROA 2YESA 3SXDA 1O23B 2RITA 1GA8A 1PZTA 2OI5A 3U2XA 1H5SD 2YQSA 1ZJ2A 4FREA 1IINA 3I0CA 2Y4LA 2QGIA 2X5ZA 1HM8A 2D0JA 1NKHB 3SXCA 3USQA 1H5SA 1HV9A 3SXEA 4ECMA 3RSBA 2FYAA 1Z90A 1TW5A 2QH5A 2V0KA 3QVBA 3SX5A 1E5KA 4B4GA 5EJ1A 2WGZA 4KNRA 4CVHA 2RJ1A 3V0OA 3U0YA 1ZHJA 1OMXA 4EE3A 1VZTA 3OH0A 3SX3A 2WVLA 2P73A 3JUJA 4B5BA 5CMJA 5BXCA 4AAWA 5AJPA 4DECA 1FZWA 4P02A 1O7OA 5FTVA 1ZCVA 2XWLA 2Z86A 1FXJA 2ICYA 2ZU9A 4K6RA 5AJOA 2X65A 2VSIA 2RJ6A 1G2VA 2VS3A 1FO9A 4HO0A 1LZ7A 2D7IA 5EJZA 1JV1A 2DPWA 2FFVA 3E26A 1VGWA 1QWJA 4EE5A 1LZIA 4KT7A 5C1LA 2W0VA 2YQCA 5IDSA 4KPZA 5C36A 2AH9A 3ZLKA 4G87A 5C3DA 3SX8A 2ZU7A 2RIZA 1VICA 2OEGA 4DDZA 3F1CA 5CQLX 4ASJA 4YS8A 1YP3A 4B2XA 3GUEA 5FYEA 4FRQA 5IFYA 3I0JA 1VH3A 1FO8A 2VS4A 3PNNA 5J49A 1W77A 2YC3A 4M2BA 4Y7GA 3OC9A 2Y4KA 2ZU8A 4G3PA 3V0PA 1VZXA 2UX8A 4FRPA 1VZUA 1WT2A 5C1HA 1QGSA 3U2TA 4Y9XA 1H7QA 1W55A 2PGVA 5FTSA 4FCUA 4XWIA 1NF5B 4KC1A 2WVKA 2RJ7A 4Y7FA 1H5RA 2RJ5A 4Y7UA 3D98A 1V83A 1VGTA 5IDTA 5DDTA 3ST8A 1VPAA 5C8RA 3FWWA 5CQNX 2O1HA 1G8OA 3ZF8A 3ZGGA 1ON8A 2AM5A 3SPTA 1LZJA 2I5KA 4E1KA 1FOAA 1YP4A 2AGDA 1OQMB 3CKNA 4HO2A 1G3LA 1R7XA 3NGWA 3OKRA 3V90A 1PZYB 2I5EA 3TQDA 4AYLA 2RJ0A 4EEMA 1EYRA 2CU2A 4D0TA 2VSHA 1KWSA 1H5TB 5CMGX 1I52A 2Y6PA 5C4CA 1ZI3A 3SX7A 3OH1A 2YQHA 3K8DA 5C4FA 1INIA 4LW3A 2V0IA 2RJ8A 3JTJA 3BCVA 3DUVA 2WVMA 2WE9A 1LZ0A 4R7PA 4JD0A 5C3AA 1GWWA 3I0DA 2BO4A 2FYCB 1R80A 3EE5A 1INJA 3O3PA 4M4KA 2XMEA 5HS2A 3JUKA 1VGZA 4Y64A 3V0QA 1ZI5A 5C48A 1HM0A 3Q80A 3RMWA 4Y62A 3R3IA 4EVWA 3I0HA 2VFZA 3RMVA 2VS5A 2E3DA 1GQ9A 2YC5A 1ZCYA 4ARWA 1IIMA 3E25A 2XWNA 1TW1A 2QKXA 4M28A 4D0ZA 4B2WA 4FQWA 1LVWA 3V8ZA 2BO6A 2X60A 4Y6UA 4P00A 3SXGA 2VXMA 4Y6NA 1R81A 1GWVA 2MZBA 1JVGA 5CMFX 1WT3A 3OAMA 4Y7VA 2XWMA 2AECA 4EEAA 3I0GA 1R82A 1JYLA 1TZFA 3R2WA 1VGUA 4ZDQA 4HO8A 1G9RA 2JCJA 3D5NA 4NAIA 2AM4A 3I0FA 1MP5A 2BO8A 1H7EA 4BQHA 2Y4MA 3DK5A 3Q4SA 4G3QA 3TZTA 1G1LA 2V0HA 2Q4JA 3SXBA 1ZI1A 5C49A 1H4DA 2WEEA 4FRBA 1ZJ0A 1FGXA 1OMZA 2JCOA 1LL3A 5CQMX 1QG8A 3D8VA 4HO6A 4CJCA 1JVDA 1O0RA 2A8UA 2AE7A 2ICXA 4KXOA 1MP3A 4B4MA 4ASYA 1H4EA 3U0XA 2O1FA 4L41C 2P6WA 1R7UA 3U2VA 1FRWA 2I7BA 3HL3A 4Y7TA 1HM9A 3V0MA 1XHBA 2NXVA 4FRHA 4BMAA 3OH2A 1S4NA 5C1GA 5FU8A 1H7HA 4CJBA 5CQOA 1ZJPA 3USRA 2VXLA 2FYBA 1H5SB 2A8WA 4EE4A 4NAKA 1G93A 4IRQA 2V0JA 1H7TA 4HG6A 3T7OA 2Y7AA 1H5SC 1H7FA 2YQJA 3F1YA 4EEGA 2GGOA 3V0NA 1S4OA 3I0EA 1NMMB 5DDVA 1ON6A 2JCLA 1FWYA 2Y4JA 4HO4A 2FYDB 2X5SA 3KIAA 2AM3A 1YROB 4FRAA 1H3MA 1FG5N 3LW6A 3K8EA 3ZGFA 1H4CA 1ZDFA 1ZJOA 1VM8A 4B42A 1ZI4A 4MYBA 4KPXA 5C47A 2VD4A 1ZCUA 3V0LA 1H5TA 1W57A 1MC3A 4UEGA 2GGQA 1FR8A 4FCEA 3IOJA 2P72A 1ZJ1A 3BRKX 2W0WA 2FFUA 2WAWA 1SS9A 1WSZA 4FRDA 4CJ8A 1ZIZA 3Q7UA 1ZCTA 3SXAA 4B3UA 3I0IX 4LW6A 5I1FA 3CKVA 1LL0A 3IOIA 4DE7A 3PKPA 1ZJ3A 3V91A 2XMHA 1V82A 3CU0A 3DJ4A 4D11C 3PKQA 1H7GA 1XZ6A 1YP2A 1LL2A 3V8YA 1GX0A 2RJ4A 2D7RA 2AESA 1G23A 2E8BA 1MP4A 4Y63A 1QGQA 3I0KA 1G95A 3CKJA 1NWGB 2BO7A 3OH4A 3IOHA 1H5RB 5L6SA 1GQCA
chains in the Genus database with same CATH superfamily
1O7QA 4D48A 1JYKA 4G3SA 3CKOA 1HJJA 1S4PA 3I0LA 4IRPA 4D11A 4HO9A 5D92A 3T7MA 2OI7A 1R7VA 4KC4A 3T7NA 2RIYA 3N9WA 4AC3A 5FV9A 1V84A 3FOQA 4MNDA 2YCMA 1HJLA 4FRLA 1GX4A 2JCKA 4KNXA 5CQPA 4FRMA 5CMIA 2RJ9A 4HO3A 1H7LA 2RIXA 1K4VA 2OI6A 2FY7A 4J18A 4JISA 4NANA 5CMHA 1WT0A 1R7YA 1FR9A 5L6VA 5FUHA 5C4BA 1ZDGA 5JQQA 4HO5A 3ZLLA 3CKQA 2PA4A 1WT1A 4M2AA 1WVCA 4GBPA 1G97A 1TVYA 2O1GA 3CGXA 5EIYA 4KRVA 3U2WA 1VH1A 4EEOA 4HCQA 5FU0A 2PGYA 2V0LA 4NALA 4KC2A 3POLA 5C4DA 2PX7A 1R7TA 5C38A 1FGGA 5C3BA 1EZIA 1G0RA 4KQLA 1NQIB 4B4BA 1JV3A 3OGZA 4HOCA 2APCA 2Z87A 1FXOA 2OEFA 4AYJA 5AJNA 5C4EA 4C2SA 1NHEB 3U2UA 3OH3A 4FROA 2YESA 3SXDA 1O23B 2RITA 1GA8A 1PZTA 2OI5A 3U2XA 1H5SD 2YQSA 1ZJ2A 4FREA 1IINA 3I0CA 2Y4LA 2C0NA 2QGIA 2X5ZA 1HM8A 2D0JA 1NKHB 3SXCA 3USQA 1H5SA 1HV9A 3SXEA 4ECMA 3RSBA 2FYAA 1Z90A 1TW5A 2QH5A 2V0KA 3QVBA 3SX5A 1E5KA 4B4GA 5EJ1A 2WGZA 4KNRA 4CVHA 2RJ1A 3V0OA 3U0YA 1ZHJA 1OMXA 4EE3A 1VZTA 3OH0A 3SX3A 2WVLA 2P73A 3JUJA 4B5BA 5CMJA 5BXCA 4AAWA 5AJPA 4DECA 1FZWA 4P02A 1O7OA 5FTVA 1ZCVA 2XWLA 2Z86A 1FXJA 2ICYA 2ZU9A 4K6RA 5AJOA 2X65A 2VSIA 2RJ6A 1G2VA 2VS3A 1FO9A 4HO0A 1LZ7A 2D7IA 5EJZA 1JV1A 2DPWA 2FFVA 3E26A 1VGWA 1QWJA 4EE5A 1LZIA 4KT7A 5C1LA 2W0VA 2YQCA 5IDSA 4KPZA 5C36A 2AH9A 3ZLKA 4G87A 5C3DA 3SX8A 2ZU7A 2RIZA 4FIYA 1VICA 2OEGA 4DDZA 3F1CA 5CQLX 4ASJA 4YS8A 1YP3A 2VK9A 4B2XA 3GUEA 5FYEA 4FRQA 5IFYA 3I0JA 1VH3A 1FO8A 2VS4A 3PNNA 5J49A 1W77A 2YC3A 4M2BA 4Y7GA 3OC9A 2Y4KA 2ZU8A 4G3PA 3V0PA 1VZXA 2UX8A 4FRPA 1VZUA 1WT2A 5C1HA 1QGSA 3U2TA 4Y9XA 1H7QA 1W55A 2PGVA 5FTSA 4FCUA 4XWIA 1NF5B 4KC1A 2WVKA 2RJ7A 4Y7FA 1H5RA 2RJ5A 4Y7UA 3D98A 1V83A 1VGTA 5IDTA 5DDTA 3ST8A 1VPAA 5C8RA 3FWWA 5CQNX 2O1HA 1G8OA 3ZF8A 3ZGGA 1ON8A 2AM5A 3SPTA 1LZJA 2I5KA 4E1KA 1FOAA 1YP4A 2AGDA 1OQMB 3CKNA 4HO2A 1G3LA 1R7XA 3NGWA 3OKRA 3V90A 1PZYB 2I5EA 3TQDA 4AYLA 2RJ0A 4EEMA 1EYRA 2CU2A 4D0TA 2VSHA 1KWSA 1H5TB 5CMGX 1I52A 2Y6PA 5C4CA 1ZI3A 3SX7A 3OH1A 2YQHA 3K8DA 5C4FA 1INIA 4LW3A 2V0IA 2RJ8A 4O6NA 3JTJA 3BCVA 3DUVA 2WVMA 2WE9A 1LZ0A 4Q7CA 4R7PA 4JD0A 5C3AA 1GWWA 3I0DA 2BO4A 2FYCB 1R80A 3EE5A 1INJA 3O3PA 4M4KA 2XMEA 5HS2A 3JUKA 1VGZA 4Y64A 3V0QA 1ZI5A 5C48A 1HM0A 3Q80A 3RMWA 4Y62A 3R3IA 4EVWA 3I0HA 2VFZA 3RMVA 2VS5A 2E3DA 1GQ9A 2YC5A 1ZCYA 4ARWA 1IIMA 3E25A 2XWNA 1TW1A 2QKXA 4M28A 4D0ZA 4B2WA 4FQWA 1LVWA 3V8ZA 2BO6A 2X60A 4Y6UA 4P00A 3SXGA 2VXMA 4Y6NA 1R81A 1GWVA 2MZBA 1JVGA 5CMFX 1WT3A 3OAMA 4Y7VA 2XWMA 2AECA 4EEAA 3I0GA 1R82A 1JYLA 1TZFA 3R2WA 1VGUA 4ZDQA 4HO8A 1G9RA 2JCJA 3D5NA 4NAIA 2AM4A 3I0FA 1MP5A 2BO8A 1H7EA 4BQHA 2Y4MA 3DK5A 3Q4SA 4G3QA 3TZTA 1G1LA 2V0HA 2Q4JA 3SXBA 1ZI1A 5C49A 1H4DA 2WEEA 4FRBA 1ZJ0A 1FGXA 1OMZA 2JCOA 1LL3A 5CQMX 1QG8A 3D8VA 4HO6A 4CJCA 1JVDA 1O0RA 2A8UA 2AE7A 2ICXA 4KXOA 1MP3A 4B4MA 5D91A 4ASYA 1H4EA 3U0XA 2O1FA 4L41C 2P6WA 1R7UA 3U2VA 1FRWA 2I7BA 3HL3A 4Y7TA 1HM9A 3V0MA 1XHBA 2NXVA 4FRHA 4BMAA 4MIXA 3OH2A 1S4NA 5C1GA 5FU8A 1H7HA 4CJBA 5CQOA 1ZJPA 3USRA 2VXLA 2J0BA 2FYBA 1H5SB 2A8WA 4EE4A 4NAKA 1G93A 4IRQA 2V0JA 1H7TA 4HG6A 3T7OA 2Y7AA 1H5SC 1H7FA 2YQJA 3F1YA 4EEGA 2GGOA 3V0NA 1S4OA 2J0AA 3I0EA 1NMMB 5DDVA 1ON6A 2JCLA 1FWYA 2Y4JA 4HO4A 2FYDB 2X5SA 3KIAA 2AM3A 1YROB 4FRAA 1H3MA 1FG5N 3LW6A 3K8EA 3ZGFA 1H4CA 1ZDFA 1ZJOA 1VM8A 4B42A 1ZI4A 4MYBA 4KPXA 5C47A 2VD4A 1ZCUA 3V0LA 1H5TA 1W57A 1MC3A 4UEGA 2GGQA 1FR8A 4FCEA 3IOJA 2P72A 1ZJ1A 3BRKX 2W0WA 2FFUA 2WAWA 4FIXA 1SS9A 1WSZA 4FRDA 4CJ8A 1ZIZA 3Q7UA 1ZCTA 3SXAA 4B3UA 3I0IX 4LW6A 5I1FA 3CKVA 1LL0A 3IOIA 4DE7A 3PKPA 1ZJ3A 3V91A 2XMHA 1V82A 3CU0A 3DJ4A 4D11C 3PKQA 1H7GA 1XZ6A 1YP2A 1LL2A 3V8YA 1GX0A 2RJ4A 2D7RA 2AESA 1G23A 2E8BA 1MP4A 4Y63A 1QGQA 3I0KA 1G95A 4O6MA 3CKJA 1NWGB 2BO7A 3OH4A 3IOHA 1H5RB 5L6SA 1GQCA
chains in the Genus database with same CATH topology
1O7QA 4D48A 1JYKA 4G3SA 3CKOA 1HJJA 1S4PA 3I0LA 4IRPA 4D11A 4HO9A 5D92A 3T7MA 2OI7A 1R7VA 4KC4A 3T7NA 2RIYA 3N9WA 4AC3A 5FV9A 1V84A 3FOQA 4MNDA 2YCMA 1HJLA 4FRLA 1GX4A 2JCKA 4KNXA 5CQPA 4FRMA 5CMIA 2RJ9A 4HO3A 1H7LA 2RIXA 1K4VA 2OI6A 2FY7A 4J18A 4JISA 4NANA 5CMHA 1WT0A 1R7YA 1FR9A 5L6VA 5FUHA 5C4BA 1ZDGA 5JQQA 4HO5A 3ZLLA 3CKQA 2PA4A 1WT1A 4M2AA 1WVCA 4GBPA 1G97A 1TVYA 2O1GA 3CGXA 5EIYA 4KRVA 3U2WA 1VH1A 4EEOA 4HCQA 5FU0A 2PGYA 2V0LA 4NALA 4KC2A 3POLA 5C4DA 2PX7A 1R7TA 5C38A 1FGGA 5C3BA 1EZIA 1G0RA 4KQLA 1NQIB 4B4BA 1JV3A 3OGZA 4HOCA 2APCA 2Z87A 1FXOA 2OEFA 4AYJA 5AJNA 5C4EA 4C2SA 1NHEB 3U2UA 3OH3A 4FROA 2YESA 3SXDA 1O23B 2RITA 1GA8A 1PZTA 2OI5A 3U2XA 1H5SD 2YQSA 1ZJ2A 4FREA 1IINA 3I0CA 2Y4LA 2C0NA 2QGIA 2X5ZA 1HM8A 2D0JA 1NKHB 3SXCA 3USQA 1H5SA 1HV9A 3SXEA 4ECMA 3RSBA 2FYAA 1Z90A 1TW5A 2QH5A 2V0KA 3QVBA 3SX5A 1E5KA 4B4GA 5EJ1A 2WGZA 4KNRA 4CVHA 2RJ1A 3V0OA 3U0YA 1ZHJA 1OMXA 4EE3A 1VZTA 3OH0A 3SX3A 2WVLA 2P73A 3JUJA 4B5BA 5CMJA 5BXCA 4AAWA 5AJPA 4DECA 1FZWA 4P02A 1O7OA 5FTVA 1ZCVA 2XWLA 2Z86A 1FXJA 2ICYA 2ZU9A 4K6RA 5AJOA 2X65A 2VSIA 2RJ6A 1G2VA 2VS3A 1FO9A 4HO0A 1LZ7A 2D7IA 5EJZA 1JV1A 2DPWA 2FFVA 3E26A 1VGWA 1QWJA 4EE5A 1LZIA 4KT7A 5C1LA 2W0VA 2YQCA 5IDSA 4KPZA 5C36A 2AH9A 3ZLKA 4G87A 5C3DA 3SX8A 2ZU7A 2RIZA 4FIYA 1VICA 2OEGA 4DDZA 3F1CA 5CQLX 4ASJA 4YS8A 1YP3A 2VK9A 4B2XA 3GUEA 5FYEA 4FRQA 5IFYA 3I0JA 1VH3A 1FO8A 2VS4A 3PNNA 5J49A 1W77A 2YC3A 4M2BA 4Y7GA 3OC9A 2Y4KA 2ZU8A 4G3PA 3V0PA 1VZXA 2UX8A 4FRPA 1VZUA 1WT2A 5C1HA 1QGSA 3U2TA 4Y9XA 1H7QA 1W55A 2PGVA 5FTSA 4FCUA 4XWIA 1NF5B 4KC1A 2WVKA 2RJ7A 4Y7FA 1H5RA 2RJ5A 4Y7UA 3D98A 1V83A 1VGTA 5IDTA 5DDTA 3ST8A 1VPAA 5C8RA 3FWWA 5CQNX 2O1HA 1G8OA 3ZF8A 3ZGGA 1ON8A 2AM5A 3SPTA 1LZJA 2I5KA 4E1KA 1FOAA 1YP4A 2AGDA 1OQMB 3CKNA 4HO2A 1G3LA 1R7XA 3NGWA 3OKRA 3V90A 1PZYB 2I5EA 3TQDA 4AYLA 2RJ0A 4EEMA 1EYRA 2CU2A 4D0TA 2VSHA 1KWSA 1H5TB 5CMGX 1I52A 2Y6PA 5C4CA 1ZI3A 3SX7A 3OH1A 2YQHA 3K8DA 5C4FA 1INIA 4LW3A 2V0IA 2RJ8A 4O6NA 3JTJA 3BCVA 3DUVA 2WVMA 2WE9A 1LZ0A 4Q7CA 4R7PA 4JD0A 5C3AA 1GWWA 3I0DA 2BO4A 2FYCB 1R80A 3EE5A 1INJA 3O3PA 4M4KA 2XMEA 5HS2A 3JUKA 1VGZA 4Y64A 3V0QA 1ZI5A 5C48A 1HM0A 3Q80A 3RMWA 4Y62A 3R3IA 4EVWA 3I0HA 2VFZA 3RMVA 2VS5A 2E3DA 1GQ9A 2YC5A 1ZCYA 4ARWA 1IIMA 3E25A 2XWNA 1TW1A 2QKXA 4M28A 4D0ZA 4B2WA 4FQWA 1LVWA 3V8ZA 2BO6A 2X60A 4Y6UA 4P00A 3SXGA 2VXMA 4Y6NA 1R81A 1GWVA 2MZBA 1JVGA 5CMFX 1WT3A 3OAMA 4Y7VA 2XWMA 2AECA 4EEAA 3I0GA 1R82A 1JYLA 1TZFA 3R2WA 1VGUA 4ZDQA 4HO8A 1G9RA 2JCJA 3D5NA 4NAIA 2AM4A 3I0FA 1MP5A 2BO8A 1H7EA 4BQHA 2Y4MA 3DK5A 3Q4SA 4G3QA 3TZTA 1G1LA 2V0HA 2Q4JA 3SXBA 1ZI1A 5C49A 1H4DA 2WEEA 4FRBA 1ZJ0A 1FGXA 1OMZA 2JCOA 1LL3A 5CQMX 1QG8A 3D8VA 4HO6A 4CJCA 1JVDA 1O0RA 2A8UA 2AE7A 2ICXA 4KXOA 1MP3A 4B4MA 5D91A 4ASYA 1H4EA 3U0XA 2O1FA 4L41C 2P6WA 1R7UA 3U2VA 1FRWA 2I7BA 3HL3A 4Y7TA 1HM9A 3V0MA 1XHBA 2NXVA 4FRHA 4BMAA 4MIXA 3OH2A 1S4NA 5C1GA 5FU8A 1H7HA 4CJBA 5CQOA 1ZJPA 3USRA 2VXLA 2J0BA 2FYBA 1H5SB 2A8WA 4EE4A 4NAKA 1G93A 4IRQA 2V0JA 1H7TA 4HG6A 3T7OA 2Y7AA 1H5SC 1H7FA 2YQJA 3F1YA 4EEGA 2GGOA 3V0NA 1S4OA 2J0AA 3I0EA 1NMMB 5DDVA 1ON6A 2JCLA 1FWYA 2Y4JA 4HO4A 2FYDB 2X5SA 3KIAA 2AM3A 1YROB 4FRAA 1H3MA 1FG5N 3LW6A 3K8EA 3ZGFA 1H4CA 1ZDFA 1ZJOA 1VM8A 4B42A 1ZI4A 4MYBA 4KPXA 5C47A 2VD4A 1ZCUA 3V0LA 1H5TA 1W57A 1MC3A 4UEGA 2GGQA 1FR8A 4FCEA 3IOJA 2P72A 1ZJ1A 3BRKX 2W0WA 2FFUA 2WAWA 4FIXA 1SS9A 1WSZA 4FRDA 4CJ8A 1ZIZA 3Q7UA 1ZCTA 3SXAA 4B3UA 3I0IX 4LW6A 5I1FA 3CKVA 1LL0A 3IOIA 4DE7A 3PKPA 1ZJ3A 3V91A 2XMHA 1V82A 3CU0A 3DJ4A 4D11C 3PKQA 1H7GA 1XZ6A 1YP2A 1LL2A 3V8YA 1GX0A 2RJ4A 2D7RA 2AESA 1G23A 2E8BA 1MP4A 4Y63A 1QGQA 3I0KA 1G95A 4O6MA 3CKJA 1NWGB 2BO7A 3OH4A 3IOHA 1H5RB 5L6SA 1GQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7Q A;  4D48 A;  1JYK A;  4G3S A;  3CKO A;  1HJJ A;  1S4P A;  3I0L A;  4IRP A;  4D11 A;  4HO9 A;  3T7M A;  2OI7 A;  1R7V A;  4KC4 A;  3T7N A;  2RIY A;  3N9W A;  4AC3 A;  5FV9 A;  1V84 A;  3FOQ A;  4MND A;  2YCM A;  1HJL A;  4FRL A;  1GX4 A;  2JCK A;  4KNX A;  5CQP A;  4FRM A;  5CMI A;  2RJ9 A;  4HO3 A;  1H7L A;  2RIX A;  1K4V A;  2OI6 A;  2FY7 A;  4J18 A;  4JIS A;  4NAN A;  5CMH A;  1WT0 A;  1R7Y A;  1FR9 A;  5L6V A;  5FUH A;  5C4B A;  1ZDG A;  5JQQ A;  4HO5 A;  3ZLL A;  3CKQ A;  2PA4 A;  1WT1 A;  4M2A A;  1WVC A;  4GBP A;  1G97 A;  1TVY A;  2O1G A;  3CGX A;  5EIY A;  4KRV A;  3U2W A;  1VH1 A;  4EEO A;  4HCQ A;  5FU0 A;  2PGY A;  2V0L A;  4NAL A;  4KC2 A;  3POL A;  5C4D A;  2PX7 A;  1R7T A;  5C38 A;  1FGG A;  5C3B A;  1EZI A;  1G0R A;  4KQL A;  1NQI B;  4B4B A;  1JV3 A;  3OGZ A;  4HOC A;  2APC A;  2Z87 A;  1FXO A;  2OEF A;  4AYJ A;  5AJN A;  5C4E A;  4C2S A;  1NHE B;  3U2U A;  3OH3 A;  4FRO A;  2YES A;  3SXD A;  1O23 B;  2RIT A;  1GA8 A;  1PZT A;  2OI5 A;  3U2X A;  1H5S D;  2YQS A;  1ZJ2 A;  4FRE A;  1IIN A;  3I0C A;  2Y4L A;  2QGI A;  2X5Z A;  1HM8 A;  2D0J A;  1NKH B;  3SXC A;  3USQ A;  1H5S A;  1HV9 A;  3SXE A;  4ECM A;  3RSB A;  2FYA A;  1Z90 A;  1TW5 A;  2QH5 A;  2V0K A;  3QVB A;  3SX5 A;  1E5K A;  4B4G A;  5EJ1 A;  2WGZ A;  4KNR A;  4CVH A;  2RJ1 A;  3V0O A;  3U0Y A;  1ZHJ A;  1OMX A;  4EE3 A;  1VZT A;  3OH0 A;  3SX3 A;  2WVL A;  2P73 A;  3JUJ A;  4B5B A;  5CMJ A;  5BXC A;  4AAW A;  5AJP A;  4DEC A;  1FZW A;  4P02 A;  1O7O A;  5FTV A;  1ZCV A;  2XWL A;  2Z86 A;  1FXJ A;  2ICY A;  2ZU9 A;  4K6R A;  5AJO A;  2X65 A;  2VSI A;  2RJ6 A;  1G2V A;  2VS3 A;  1FO9 A;  4HO0 A;  1LZ7 A;  2D7I A;  5EJZ A;  1JV1 A;  2DPW A;  2FFV A;  3E26 A;  1VGW A;  1QWJ A;  4EE5 A;  1LZI A;  4KT7 A;  5C1L A;  2W0V A;  2YQC A;  5IDS A;  4KPZ A;  5C36 A;  2AH9 A;  3ZLK A;  4G87 A;  5C3D A;  3SX8 A;  2ZU7 A;  2RIZ A;  1VIC A;  2OEG A;  4DDZ A;  3F1C A;  5CQL X;  4ASJ A;  4YS8 A;  1YP3 A;  4B2X A;  3GUE A;  5FYE A;  4FRQ A;  5IFY A;  3I0J A;  1VH3 A;  1FO8 A;  2VS4 A;  3PNN A;  5J49 A;  1W77 A;  2YC3 A;  4M2B A;  4Y7G A;  3OC9 A;  2Y4K A;  2ZU8 A;  4G3P A;  3V0P A;  1VZX A;  2UX8 A;  4FRP A;  1VZU A;  1WT2 A;  5C1H A;  1QGS A;  3U2T A;  4Y9X A;  1H7Q A;  1W55 A;  2PGV A;  5FTS A;  4FCU A;  4XWI A;  1NF5 B;  4KC1 A;  2WVK A;  2RJ7 A;  4Y7F A;  1H5R A;  2RJ5 A;  4Y7U A;  3D98 A;  1V83 A;  1VGT A;  5IDT A;  5DDT A;  3ST8 A;  1VPA A;  5C8R A;  3FWW A;  5CQN X;  2O1H A;  1G8O A;  3ZF8 A;  3ZGG A;  1ON8 A;  2AM5 A;  3SPT A;  1LZJ A;  2I5K A;  4E1K A;  1FOA A;  1YP4 A;  2AGD A;  1OQM B;  3CKN A;  4HO2 A;  1G3L A;  1R7X A;  3NGW A;  3OKR A;  3V90 A;  1PZY B;  2I5E A;  3TQD A;  4AYL A;  2RJ0 A;  4EEM A;  1EYR A;  2CU2 A;  4D0T A;  2VSH A;  1KWS A;  1H5T B;  5CMG X;  1I52 A;  2Y6P A;  5C4C A;  1ZI3 A;  3SX7 A;  3OH1 A;  2YQH A;  3K8D A;  5C4F A;  1INI A;  4LW3 A;  2V0I A;  2RJ8 A;  3JTJ A;  3BCV A;  3DUV A;  2WVM A;  2WE9 A;  1LZ0 A;  4R7P A;  4JD0 A;  5C3A A;  1GWW A;  3I0D A;  2BO4 A;  2FYC B;  1R80 A;  3EE5 A;  1INJ A;  3O3P A;  4M4K A;  2XME A;  5HS2 A;  3JUK A;  1VGZ A;  4Y64 A;  3V0Q A;  1ZI5 A;  5C48 A;  1HM0 A;  3Q80 A;  3RMW A;  4Y62 A;  3R3I A;  4EVW A;  3I0H A;  2VFZ A;  3RMV A;  2VS5 A;  2E3D A;  1GQ9 A;  2YC5 A;  1ZCY A;  4ARW A;  1IIM A;  3E25 A;  2XWN A;  1TW1 A;  2QKX A;  4M28 A;  4D0Z A;  4B2W A;  4FQW A;  1LVW A;  3V8Z A;  2BO6 A;  2X60 A;  4Y6U A;  4P00 A;  3SXG A;  2VXM A;  4Y6N A;  1R81 A;  1GWV A;  2MZB A;  1JVG A;  5CMF X;  1WT3 A;  3OAM A;  4Y7V A;  2XWM A;  2AEC A;  4EEA A;  3I0G A;  1R82 A;  1JYL A;  1TZF A;  3R2W A;  1VGU A;  4ZDQ A;  4HO8 A;  1G9R A;  2JCJ A;  3D5N A;  4NAI A;  2AM4 A;  3I0F A;  1MP5 A;  2BO8 A;  1H7E A;  4BQH A;  2Y4M A;  3DK5 A;  3Q4S A;  4G3Q A;  3TZT A;  1G1L A;  2V0H A;  2Q4J A;  3SXB A;  1ZI1 A;  5C49 A;  1H4D A;  2WEE A;  4FRB A;  1ZJ0 A;  1FGX A;  1OMZ A;  2JCO A;  1LL3 A;  5CQM X;  1QG8 A;  3D8V A;  4HO6 A;  4CJC A;  1JVD A;  1O0R A;  2A8U A;  2AE7 A;  2ICX A;  4KXO A;  1MP3 A;  4B4M A;  4ASY A;  1H4E A;  3U0X A;  2O1F A;  4L41 C;  2P6W A;  1R7U A;  3U2V A;  1FRW A;  2I7B A;  3HL3 A;  4Y7T A;  1HM9 A;  3V0M A;  1XHB A;  2NXV A;  4FRH A;  4BMA A;  3OH2 A;  1S4N A;  5C1G A;  5FU8 A;  1H7H A;  4CJB A;  5CQO A;  1ZJP A;  3USR A;  2VXL A;  2FYB A;  1H5S B;  2A8W A;  4EE4 A;  4NAK A;  1G93 A;  4IRQ A;  2V0J A;  1H7T A;  4HG6 A;  3T7O A;  2Y7A A;  1H5S C;  1H7F A;  2YQJ A;  3F1Y A;  4EEG A;  2GGO A;  3V0N A;  1S4O A;  3I0E A;  1NMM B;  5DDV A;  1ON6 A;  2JCL A;  1FWY A;  2Y4J A;  4HO4 A;  2FYD B;  2X5S A;  3KIA A;  2AM3 A;  1YRO B;  4FRA A;  1H3M A;  1FG5 N;  3LW6 A;  3K8E A;  3ZGF A;  1H4C A;  1ZDF A;  1ZJO A;  1VM8 A;  4B42 A;  1ZI4 A;  4MYB A;  4KPX A;  5C47 A;  2VD4 A;  1ZCU A;  3V0L A;  1H5T A;  1W57 A;  1MC3 A;  4UEG A;  2GGQ A;  1FR8 A;  4FCE A;  3IOJ A;  2P72 A;  1ZJ1 A;  3BRK X;  2W0W A;  2FFU A;  2WAW A;  1SS9 A;  1WSZ A;  4FRD A;  4CJ8 A;  1ZIZ A;  3Q7U A;  1ZCT A;  3SXA A;  4B3U A;  3I0I X;  4LW6 A;  5I1F A;  3CKV A;  1LL0 A;  3IOI A;  4DE7 A;  3PKP A;  1ZJ3 A;  3V91 A;  2XMH A;  1V82 A;  3CU0 A;  3DJ4 A;  4D11 C;  3PKQ A;  1H7G A;  1XZ6 A;  1YP2 A;  1LL2 A;  3V8Y A;  1GX0 A;  2RJ4 A;  2D7R A;  2AES A;  1G23 A;  2E8B A;  1MP4 A;  4Y63 A;  1QGQ A;  3I0K A;  1G95 A;  3CKJ A;  1NWG B;  2BO7 A;  3OH4 A;  3IOH A;  1H5R B;  5L6S A;  1GQC A; 
#chains in the Genus database with same CATH topology
 1O7Q A;  4D48 A;  1JYK A;  4G3S A;  3CKO A;  1HJJ A;  1S4P A;  3I0L A;  4IRP A;  4D11 A;  4HO9 A;  5D92 A;  3T7M A;  2OI7 A;  1R7V A;  4KC4 A;  3T7N A;  2RIY A;  3N9W A;  4AC3 A;  5FV9 A;  1V84 A;  3FOQ A;  4MND A;  2YCM A;  1HJL A;  4FRL A;  1GX4 A;  2JCK A;  4KNX A;  5CQP A;  4FRM A;  5CMI A;  2RJ9 A;  4HO3 A;  1H7L A;  2RIX A;  1K4V A;  2OI6 A;  2FY7 A;  4J18 A;  4JIS A;  4NAN A;  5CMH A;  1WT0 A;  1R7Y A;  1FR9 A;  5L6V A;  5FUH A;  5C4B A;  1ZDG A;  5JQQ A;  4HO5 A;  3ZLL A;  3CKQ A;  2PA4 A;  1WT1 A;  4M2A A;  1WVC A;  4GBP A;  1G97 A;  1TVY A;  2O1G A;  3CGX A;  5EIY A;  4KRV A;  3U2W A;  1VH1 A;  4EEO A;  4HCQ A;  5FU0 A;  2PGY A;  2V0L A;  4NAL A;  4KC2 A;  3POL A;  5C4D A;  2PX7 A;  1R7T A;  5C38 A;  1FGG A;  5C3B A;  1EZI A;  1G0R A;  4KQL A;  1NQI B;  4B4B A;  1JV3 A;  3OGZ A;  4HOC A;  2APC A;  2Z87 A;  1FXO A;  2OEF A;  4AYJ A;  5AJN A;  5C4E A;  4C2S A;  1NHE B;  3U2U A;  3OH3 A;  4FRO A;  2YES A;  3SXD A;  1O23 B;  2RIT A;  1GA8 A;  1PZT A;  2OI5 A;  3U2X A;  1H5S D;  2YQS A;  1ZJ2 A;  4FRE A;  1IIN A;  3I0C A;  2Y4L A;  2C0N A;  2QGI A;  2X5Z A;  1HM8 A;  2D0J A;  1NKH B;  3SXC A;  3USQ A;  1H5S A;  1HV9 A;  3SXE A;  4ECM A;  3RSB A;  2FYA A;  1Z90 A;  1TW5 A;  2QH5 A;  2V0K A;  3QVB A;  3SX5 A;  1E5K A;  4B4G A;  5EJ1 A;  2WGZ A;  4KNR A;  4CVH A;  2RJ1 A;  3V0O A;  3U0Y A;  1ZHJ A;  1OMX A;  4EE3 A;  1VZT A;  3OH0 A;  3SX3 A;  2WVL A;  2P73 A;  3JUJ A;  4B5B A;  5CMJ A;  5BXC A;  4AAW A;  5AJP A;  4DEC A;  1FZW A;  4P02 A;  1O7O A;  5FTV A;  1ZCV A;  2XWL A;  2Z86 A;  1FXJ A;  2ICY A;  2ZU9 A;  4K6R A;  5AJO A;  2X65 A;  2VSI A;  2RJ6 A;  1G2V A;  2VS3 A;  1FO9 A;  4HO0 A;  1LZ7 A;  2D7I A;  5EJZ A;  1JV1 A;  2DPW A;  2FFV A;  3E26 A;  1VGW A;  1QWJ A;  4EE5 A;  1LZI A;  4KT7 A;  5C1L A;  2W0V A;  2YQC A;  5IDS A;  4KPZ A;  5C36 A;  2AH9 A;  3ZLK A;  4G87 A;  5C3D A;  3SX8 A;  2ZU7 A;  2RIZ A;  4FIY A;  1VIC A;  2OEG A;  4DDZ A;  3F1C A;  5CQL X;  4ASJ A;  4YS8 A;  1YP3 A;  2VK9 A;  4B2X A;  3GUE A;  5FYE A;  4FRQ A;  5IFY A;  3I0J A;  1VH3 A;  1FO8 A;  2VS4 A;  3PNN A;  5J49 A;  1W77 A;  2YC3 A;  4M2B A;  4Y7G A;  3OC9 A;  2Y4K A;  2ZU8 A;  4G3P A;  3V0P A;  1VZX A;  2UX8 A;  4FRP A;  1VZU A;  1WT2 A;  5C1H A;  1QGS A;  3U2T A;  4Y9X A;  1H7Q A;  1W55 A;  2PGV A;  5FTS A;  4FCU A;  4XWI A;  1NF5 B;  4KC1 A;  2WVK A;  2RJ7 A;  4Y7F A;  1H5R A;  2RJ5 A;  4Y7U A;  3D98 A;  1V83 A;  1VGT A;  5IDT A;  5DDT A;  3ST8 A;  1VPA A;  5C8R A;  3FWW A;  5CQN X;  2O1H A;  1G8O A;  3ZF8 A;  3ZGG A;  1ON8 A;  2AM5 A;  3SPT A;  1LZJ A;  2I5K A;  4E1K A;  1FOA A;  1YP4 A;  2AGD A;  1OQM B;  3CKN A;  4HO2 A;  1G3L A;  1R7X A;  3NGW A;  3OKR A;  3V90 A;  1PZY B;  2I5E A;  3TQD A;  4AYL A;  2RJ0 A;  4EEM A;  1EYR A;  2CU2 A;  4D0T A;  2VSH A;  1KWS A;  1H5T B;  5CMG X;  1I52 A;  2Y6P A;  5C4C A;  1ZI3 A;  3SX7 A;  3OH1 A;  2YQH A;  3K8D A;  5C4F A;  1INI A;  4LW3 A;  2V0I A;  2RJ8 A;  4O6N A;  3JTJ A;  3BCV A;  3DUV A;  2WVM A;  2WE9 A;  1LZ0 A;  4Q7C A;  4R7P A;  4JD0 A;  5C3A A;  1GWW A;  3I0D A;  2BO4 A;  2FYC B;  1R80 A;  3EE5 A;  1INJ A;  3O3P A;  4M4K A;  2XME A;  5HS2 A;  3JUK A;  1VGZ A;  4Y64 A;  3V0Q A;  1ZI5 A;  5C48 A;  1HM0 A;  3Q80 A;  3RMW A;  4Y62 A;  3R3I A;  4EVW A;  3I0H A;  2VFZ A;  3RMV A;  2VS5 A;  2E3D A;  1GQ9 A;  2YC5 A;  1ZCY A;  4ARW A;  1IIM A;  3E25 A;  2XWN A;  1TW1 A;  2QKX A;  4M28 A;  4D0Z A;  4B2W A;  4FQW A;  1LVW A;  3V8Z A;  2BO6 A;  2X60 A;  4Y6U A;  4P00 A;  3SXG A;  2VXM A;  4Y6N A;  1R81 A;  1GWV A;  2MZB A;  1JVG A;  5CMF X;  1WT3 A;  3OAM A;  4Y7V A;  2XWM A;  2AEC A;  4EEA A;  3I0G A;  1R82 A;  1JYL A;  1TZF A;  3R2W A;  1VGU A;  4ZDQ A;  4HO8 A;  1G9R A;  2JCJ A;  3D5N A;  4NAI A;  2AM4 A;  3I0F A;  1MP5 A;  2BO8 A;  1H7E A;  4BQH A;  2Y4M A;  3DK5 A;  3Q4S A;  4G3Q A;  3TZT A;  1G1L A;  2V0H A;  2Q4J A;  3SXB A;  1ZI1 A;  5C49 A;  1H4D A;  2WEE A;  4FRB A;  1ZJ0 A;  1FGX A;  1OMZ A;  2JCO A;  1LL3 A;  5CQM X;  1QG8 A;  3D8V A;  4HO6 A;  4CJC A;  1JVD A;  1O0R A;  2A8U A;  2AE7 A;  2ICX A;  4KXO A;  1MP3 A;  4B4M A;  5D91 A;  4ASY A;  1H4E A;  3U0X A;  2O1F A;  4L41 C;  2P6W A;  1R7U A;  3U2V A;  1FRW A;  2I7B A;  3HL3 A;  4Y7T A;  1HM9 A;  3V0M A;  1XHB A;  2NXV A;  4FRH A;  4BMA A;  4MIX A;  3OH2 A;  1S4N A;  5C1G A;  5FU8 A;  1H7H A;  4CJB A;  5CQO A;  1ZJP A;  3USR A;  2VXL A;  2J0B A;  2FYB A;  1H5S B;  2A8W A;  4EE4 A;  4NAK A;  1G93 A;  4IRQ A;  2V0J A;  1H7T A;  4HG6 A;  3T7O A;  2Y7A A;  1H5S C;  1H7F A;  2YQJ A;  3F1Y A;  4EEG A;  2GGO A;  3V0N A;  1S4O A;  2J0A A;  3I0E A;  1NMM B;  5DDV A;  1ON6 A;  2JCL A;  1FWY A;  2Y4J A;  4HO4 A;  2FYD B;  2X5S A;  3KIA A;  2AM3 A;  1YRO B;  4FRA A;  1H3M A;  1FG5 N;  3LW6 A;  3K8E A;  3ZGF A;  1H4C A;  1ZDF A;  1ZJO A;  1VM8 A;  4B42 A;  1ZI4 A;  4MYB A;  4KPX A;  5C47 A;  2VD4 A;  1ZCU A;  3V0L A;  1H5T A;  1W57 A;  1MC3 A;  4UEG A;  2GGQ A;  1FR8 A;  4FCE A;  3IOJ A;  2P72 A;  1ZJ1 A;  3BRK X;  2W0W A;  2FFU A;  2WAW A;  4FIX A;  1SS9 A;  1WSZ A;  4FRD A;  4CJ8 A;  1ZIZ A;  3Q7U A;  1ZCT A;  3SXA A;  4B3U A;  3I0I X;  4LW6 A;  5I1F A;  3CKV A;  1LL0 A;  3IOI A;  4DE7 A;  3PKP A;  1ZJ3 A;  3V91 A;  2XMH A;  1V82 A;  3CU0 A;  3DJ4 A;  4D11 C;  3PKQ A;  1H7G A;  1XZ6 A;  1YP2 A;  1LL2 A;  3V8Y A;  1GX0 A;  2RJ4 A;  2D7R A;  2AES A;  1G23 A;  2E8B A;  1MP4 A;  4Y63 A;  1QGQ A;  3I0K A;  1G95 A;  4O6M A;  3CKJ A;  1NWG B;  2BO7 A;  3OH4 A;  3IOH A;  1H5R B;  5L6S A;  1GQC A; 
#chains in the Genus database with same CATH homology
 1O7Q A;  4D48 A;  1JYK A;  4G3S A;  3CKO A;  1HJJ A;  1S4P A;  3I0L A;  4IRP A;  4D11 A;  4HO9 A;  5D92 A;  3T7M A;  2OI7 A;  1R7V A;  4KC4 A;  3T7N A;  2RIY A;  3N9W A;  4AC3 A;  5FV9 A;  1V84 A;  3FOQ A;  4MND A;  2YCM A;  1HJL A;  4FRL A;  1GX4 A;  2JCK A;  4KNX A;  5CQP A;  4FRM A;  5CMI A;  2RJ9 A;  4HO3 A;  1H7L A;  2RIX A;  1K4V A;  2OI6 A;  2FY7 A;  4J18 A;  4JIS A;  4NAN A;  5CMH A;  1WT0 A;  1R7Y A;  1FR9 A;  5L6V A;  5FUH A;  5C4B A;  1ZDG A;  5JQQ A;  4HO5 A;  3ZLL A;  3CKQ A;  2PA4 A;  1WT1 A;  4M2A A;  1WVC A;  4GBP A;  1G97 A;  1TVY A;  2O1G A;  3CGX A;  5EIY A;  4KRV A;  3U2W A;  1VH1 A;  4EEO A;  4HCQ A;  5FU0 A;  2PGY A;  2V0L A;  4NAL A;  4KC2 A;  3POL A;  5C4D A;  2PX7 A;  1R7T A;  5C38 A;  1FGG A;  5C3B A;  1EZI A;  1G0R A;  4KQL A;  1NQI B;  4B4B A;  1JV3 A;  3OGZ A;  4HOC A;  2APC A;  2Z87 A;  1FXO A;  2OEF A;  4AYJ A;  5AJN A;  5C4E A;  4C2S A;  1NHE B;  3U2U A;  3OH3 A;  4FRO A;  2YES A;  3SXD A;  1O23 B;  2RIT A;  1GA8 A;  1PZT A;  2OI5 A;  3U2X A;  1H5S D;  2YQS A;  1ZJ2 A;  4FRE A;  1IIN A;  3I0C A;  2Y4L A;  2C0N A;  2QGI A;  2X5Z A;  1HM8 A;  2D0J A;  1NKH B;  3SXC A;  3USQ A;  1H5S A;  1HV9 A;  3SXE A;  4ECM A;  3RSB A;  2FYA A;  1Z90 A;  1TW5 A;  2QH5 A;  2V0K A;  3QVB A;  3SX5 A;  1E5K A;  4B4G A;  5EJ1 A;  2WGZ A;  4KNR A;  4CVH A;  2RJ1 A;  3V0O A;  3U0Y A;  1ZHJ A;  1OMX A;  4EE3 A;  1VZT A;  3OH0 A;  3SX3 A;  2WVL A;  2P73 A;  3JUJ A;  4B5B A;  5CMJ A;  5BXC A;  4AAW A;  5AJP A;  4DEC A;  1FZW A;  4P02 A;  1O7O A;  5FTV A;  1ZCV A;  2XWL A;  2Z86 A;  1FXJ A;  2ICY A;  2ZU9 A;  4K6R A;  5AJO A;  2X65 A;  2VSI A;  2RJ6 A;  1G2V A;  2VS3 A;  1FO9 A;  4HO0 A;  1LZ7 A;  2D7I A;  5EJZ A;  1JV1 A;  2DPW A;  2FFV A;  3E26 A;  1VGW A;  1QWJ A;  4EE5 A;  1LZI A;  4KT7 A;  5C1L A;  2W0V A;  2YQC A;  5IDS A;  4KPZ A;  5C36 A;  2AH9 A;  3ZLK A;  4G87 A;  5C3D A;  3SX8 A;  2ZU7 A;  2RIZ A;  4FIY A;  1VIC A;  2OEG A;  4DDZ A;  3F1C A;  5CQL X;  4ASJ A;  4YS8 A;  1YP3 A;  2VK9 A;  4B2X A;  3GUE A;  5FYE A;  4FRQ A;  5IFY A;  3I0J A;  1VH3 A;  1FO8 A;  2VS4 A;  3PNN A;  5J49 A;  1W77 A;  2YC3 A;  4M2B A;  4Y7G A;  3OC9 A;  2Y4K A;  2ZU8 A;  4G3P A;  3V0P A;  1VZX A;  2UX8 A;  4FRP A;  1VZU A;  1WT2 A;  5C1H A;  1QGS A;  3U2T A;  4Y9X A;  1H7Q A;  1W55 A;  2PGV A;  5FTS A;  4FCU A;  4XWI A;  1NF5 B;  4KC1 A;  2WVK A;  2RJ7 A;  4Y7F A;  1H5R A;  2RJ5 A;  4Y7U A;  3D98 A;  1V83 A;  1VGT A;  5IDT A;  5DDT A;  3ST8 A;  1VPA A;  5C8R A;  3FWW A;  5CQN X;  2O1H A;  1G8O A;  3ZF8 A;  3ZGG A;  1ON8 A;  2AM5 A;  3SPT A;  1LZJ A;  2I5K A;  4E1K A;  1FOA A;  1YP4 A;  2AGD A;  1OQM B;  3CKN A;  4HO2 A;  1G3L A;  1R7X A;  3NGW A;  3OKR A;  3V90 A;  1PZY B;  2I5E A;  3TQD A;  4AYL A;  2RJ0 A;  4EEM A;  1EYR A;  2CU2 A;  4D0T A;  2VSH A;  1KWS A;  1H5T B;  5CMG X;  1I52 A;  2Y6P A;  5C4C A;  1ZI3 A;  3SX7 A;  3OH1 A;  2YQH A;  3K8D A;  5C4F A;  1INI A;  4LW3 A;  2V0I A;  2RJ8 A;  4O6N A;  3JTJ A;  3BCV A;  3DUV A;  2WVM A;  2WE9 A;  1LZ0 A;  4Q7C A;  4R7P A;  4JD0 A;  5C3A A;  1GWW A;  3I0D A;  2BO4 A;  2FYC B;  1R80 A;  3EE5 A;  1INJ A;  3O3P A;  4M4K A;  2XME A;  5HS2 A;  3JUK A;  1VGZ A;  4Y64 A;  3V0Q A;  1ZI5 A;  5C48 A;  1HM0 A;  3Q80 A;  3RMW A;  4Y62 A;  3R3I A;  4EVW A;  3I0H A;  2VFZ A;  3RMV A;  2VS5 A;  2E3D A;  1GQ9 A;  2YC5 A;  1ZCY A;  4ARW A;  1IIM A;  3E25 A;  2XWN A;  1TW1 A;  2QKX A;  4M28 A;  4D0Z A;  4B2W A;  4FQW A;  1LVW A;  3V8Z A;  2BO6 A;  2X60 A;  4Y6U A;  4P00 A;  3SXG A;  2VXM A;  4Y6N A;  1R81 A;  1GWV A;  2MZB A;  1JVG A;  5CMF X;  1WT3 A;  3OAM A;  4Y7V A;  2XWM A;  2AEC A;  4EEA A;  3I0G A;  1R82 A;  1JYL A;  1TZF A;  3R2W A;  1VGU A;  4ZDQ A;  4HO8 A;  1G9R A;  2JCJ A;  3D5N A;  4NAI A;  2AM4 A;  3I0F A;  1MP5 A;  2BO8 A;  1H7E A;  4BQH A;  2Y4M A;  3DK5 A;  3Q4S A;  4G3Q A;  3TZT A;  1G1L A;  2V0H A;  2Q4J A;  3SXB A;  1ZI1 A;  5C49 A;  1H4D A;  2WEE A;  4FRB A;  1ZJ0 A;  1FGX A;  1OMZ A;  2JCO A;  1LL3 A;  5CQM X;  1QG8 A;  3D8V A;  4HO6 A;  4CJC A;  1JVD A;  1O0R A;  2A8U A;  2AE7 A;  2ICX A;  4KXO A;  1MP3 A;  4B4M A;  5D91 A;  4ASY A;  1H4E A;  3U0X A;  2O1F A;  4L41 C;  2P6W A;  1R7U A;  3U2V A;  1FRW A;  2I7B A;  3HL3 A;  4Y7T A;  1HM9 A;  3V0M A;  1XHB A;  2NXV A;  4FRH A;  4BMA A;  4MIX A;  3OH2 A;  1S4N A;  5C1G A;  5FU8 A;  1H7H A;  4CJB A;  5CQO A;  1ZJP A;  3USR A;  2VXL A;  2J0B A;  2FYB A;  1H5S B;  2A8W A;  4EE4 A;  4NAK A;  1G93 A;  4IRQ A;  2V0J A;  1H7T A;  4HG6 A;  3T7O A;  2Y7A A;  1H5S C;  1H7F A;  2YQJ A;  3F1Y A;  4EEG A;  2GGO A;  3V0N A;  1S4O A;  2J0A A;  3I0E A;  1NMM B;  5DDV A;  1ON6 A;  2JCL A;  1FWY A;  2Y4J A;  4HO4 A;  2FYD B;  2X5S A;  3KIA A;  2AM3 A;  1YRO B;  4FRA A;  1H3M A;  1FG5 N;  3LW6 A;  3K8E A;  3ZGF A;  1H4C A;  1ZDF A;  1ZJO A;  1VM8 A;  4B42 A;  1ZI4 A;  4MYB A;  4KPX A;  5C47 A;  2VD4 A;  1ZCU A;  3V0L A;  1H5T A;  1W57 A;  1MC3 A;  4UEG A;  2GGQ A;  1FR8 A;  4FCE A;  3IOJ A;  2P72 A;  1ZJ1 A;  3BRK X;  2W0W A;  2FFU A;  2WAW A;  4FIX A;  1SS9 A;  1WSZ A;  4FRD A;  4CJ8 A;  1ZIZ A;  3Q7U A;  1ZCT A;  3SXA A;  4B3U A;  3I0I X;  4LW6 A;  5I1F A;  3CKV A;  1LL0 A;  3IOI A;  4DE7 A;  3PKP A;  1ZJ3 A;  3V91 A;  2XMH A;  1V82 A;  3CU0 A;  3DJ4 A;  4D11 C;  3PKQ A;  1H7G A;  1XZ6 A;  1YP2 A;  1LL2 A;  3V8Y A;  1GX0 A;  2RJ4 A;  2D7R A;  2AES A;  1G23 A;  2E8B A;  1MP4 A;  4Y63 A;  1QGQ A;  3I0K A;  1G95 A;  4O6M A;  3CKJ A;  1NWG B;  2BO7 A;  3OH4 A;  3IOH A;  1H5R B;  5L6S A;  1GQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...