2XMHA

The x-ray structure of ctp:inositol-1-phosphate cytidylyltransferase from archaeoglobus fulgidus
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
205
structure length
196
Chain Sequence
IKLMKAVILAVPKPLVRVGGCEIILRTMKLLSPHVSEFIIVASRYADDIDAFLKDKGFNYKIVRHDRPEKGNGYSLLVAKNHVEDRFILTMGDHVYSQQFIEKAVRGEGVIADREPRFVDIGEATKIRVEDGRVAKIGKDLREFDCVDTGFFVLDDSIFEHAEKLRDREEIPLSEIVKLARLPVTYVDGELWMDVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CTP-INOSITOL-1-PHOSPHATE CYTIDYLYLTRANSFERASE
publication title Crystal structure of Archaeoglobus fulgidus CTP:inositol-1-phosphate cytidylyltransferase, a key enzyme for di-myo-inositol-phosphate synthesis in (hyper)thermophiles.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 59
structure length 196
sequence length 205
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.74: 1L-myo-inositol 1-phosphate cytidylyltransferase.
pdb deposition date 2010-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2xmhA00
5CMJA 2V0LA 4M28A 5C38A 2FYBA 4Y63A 4B2XA 4CJ8A 2D0JA 5C48A 3I0KA 1OMZA 4FROA 2W0WA 1W77A 1FRWA 4FRLA 4J18A 4FRDA 4HO4A 1ZI5A 4KT7A 1NKHB 1H5SA 2RIXA 4IRPA 3JUKA 1S4PA 1FXOA 5C3BA 2QKXA 5FYEA 2XWNA 1LVWA 4EE4A 4M4KA 5CMGX 4KC2A 2RJ1A 1G97A 4B4BA 4KRVA 2RJ9A 3OH0A 2Q4JA 3U2WA 1MP5A 3LW6A 2OEFA 1H4DA 3ZF8A 1NHEB 3V8YA 5FUHA 5CQMX 2YQCA 1TVYA 3N9WA 3CKVA 5C3AA 1W57A 3CKNA 2BO7A 2W0VA 4G3PA 4B4GA 1FG5N 2FY7A 3OKRA 1O0RA 1R7XA 4AYJA 2GGQA 1H7QA 1SS9A 1MP3A 2V0IA 3T7OA 1LZ0A 1YROB 1GX0A 3OH4A 3IOIA 4NALA 1VICA 3V0NA 1HJJA 3RMWA 3JTJA 3I0FA 4HO3A 1ZCTA 1H7TA 3SX7A 3V90A 1JV1A 3CGXA 3CU0A 2RJ8A 1S4OA 4DE7A 1XZ6A 4JD0A 3SX8A 3IOJA 2AE7A 4FCUA 2E8BA 1H3MA 1OMXA 1V83A 1V82A 1TW5A 4Y62A 1R80A 1ZCYA 1XHBA 1PZYB 2RJ0A 4G3QA 3U2VA 1ZDGA 1ZJ1A 1R7UA 3V0QA 2QGIA 4EEAA 2WE9A 4L41C 3CKQA 3I0LA 4D0ZA 1INJA 2FYDB 1IINA 1H4CA 1QGSA 3DUVA 1GQCA 2WVMA 1R7YA 2YC3A 3SXEA 3K8EA 1GQ9A 5C36A 4HG6A 3U2XA 1R7TA 1ZJPA 1VGZA 5EJ1A 3ZLKA 4Y64A 1G9RA 4Y7UA 2FFVA 4AAWA 3V0MA 5FTSA 2XWLA 4DECA 4P00A 1G23A 4Y6NA 3I0IX 5FU8A 3R2WA 4Y9XA 1ZJ3A 3I0GA 3OC9A 4E1KA 2X5ZA 1INIA 2V0JA 1ZCVA 3CKOA 1KWSA 1GX4A 2MZBA 3U0XA 1VGTA 4HCQA 4MYBA 1LL3A 4FRAA 4Y7GA 5C4FA 3ZGFA 3PKPA 2I5KA 5C47A 3Q7UA 2YC5A 4KPXA 3F1YA 3TZTA 1ON8A 2AECA 5CQNX 1FZWA 1ZJ2A 3SXAA 2VXMA 1LL2A 1ZJOA 3D98A 5L6SA 4KNRA 4MNDA 4UEGA 4HO8A 3USQA 2YCMA 3SXCA 2FYCB 2RITA 4KPZA 2RIYA 3D5NA 4B5BA 1IIMA 3DK5A 4D11C 4HO6A 1ZI3A 1NMMB 1LZ7A 4G87A 3T7MA 2P73A 1YP4A 4KNXA 5C3DA 2Y4MA 1H5TB 3KIAA 1GA8A 4D0TA 3I0HA 3I0CA 2CU2A 2Y4JA 3SXGA 2RJ7A 4FRBA 4FQWA 2PX7A 3ZGGA 3F1CA 1WT0A 4ECMA 4NAKA 2ZU7A 1H5RA 5JQQA 4B4MA 2WAWA 1G0RA 1FGXA 2VXLA 4D48A 4CJCA 1G1LA 2YQHA 5C4CA 3SX5A 2PGVA 5C1HA 2AM5A 2DPWA 1VZXA 5DDTA 1PZTA 4B42A 1FXJA 1TW1A 1QGQA 3FOQA 3V0OA 3V0PA 5HS2A 2XMEA 3ZLLA 3SXDA 3R3IA 3U2TA 3O3PA 1VH1A 4KC4A 1H5SB 2APCA 4XWIA 2AM3A 4FRMA 2YESA 4DDZA 2Y7AA 5C8RA 2OI6A 1JVGA 3V0LA 1O7OA 1LZIA 1G2VA 1G3LA 1WT2A 4G3SA 4Y7VA 2O1HA 1R81A 1LL0A 1QWJA 4KQLA 1H7EA 3Q80A 2V0HA 1MC3A 2OI7A 3USRA 4HO9A 2WVKA 2OI5A 5CQPA 1JYKA 1FR8A 5FV9A 1ZIZA 3E25A 5IDSA 1ZCUA 1K4VA 1FWYA 1YP3A 1Z90A 2Y6PA 2X60A 2ICXA 3V8ZA 2P6WA 2I7BA 2VS3A 3FWWA 4FRQA 3I0EA 3IOHA 2JCOA 2O1GA 4D11A 5EIYA 4Y7TA 3I0JA 3Q4SA 4ZDQA 2RIZA 4M2BA 1H7LA 2VSIA 4K6RA 1OQMB 4KXOA 2Y4KA 2V0KA 2BO8A 1LZJA 1ON6A 3RMVA 5AJNA 1ZHJA 2I5EA 2A8WA 1JVDA 4NANA 2BO6A 5L6VA 2X5SA 1VPAA 4JISA 2AH9A 1EZIA 1O7QA 5EJZA 2WGZA 1H5TA 2WVLA 3SPTA 1WT1A 5C1GA 1WT3A 2X65A 1H7HA 1FO9A 1I52A 2FYAA 4EVWA 1H7GA 4EEMA 3K8DA 1FGGA 2RJ4A 2VSHA 4M2AA 4HOCA 1EYRA 2P72A 3OH2A 2Z86A 3SX3A 4Y6UA 3CKJA 5FTVA 4CJBA 1V84A 3OH3A 1R7VA 4C2SA 3OGZA 4CVHA 1NWGB 1G95A 1NF5B 1WVCA 1ZDFA 3EE5A 2VS5A 4AYLA 2WEEA 1VGUA 1VM8A 5I1FA 2YQSA 4AC3A 3PNNA 4HO2A 2AM4A 4ASJA 2D7RA 1FOAA 1MP4A 4B3UA 2D7IA 5IFYA 1FO8A 4EEGA 2AESA 2RJ5A 2BO4A 3TQDA 5AJOA 2XWMA 2UX8A 2VS4A 4NAIA 5C4BA 5C4EA 5BXCA 4FCEA 2PGYA 2FFUA 1R82A 1E5KA 1ZI1A 5IDTA 4BMAA 5CMFX 2E3DA 5C1LA 3DJ4A 4Y7FA 3JUJA 2PA4A 1HJLA 4LW6A 2XMHA 1H4EA 4EEOA 2A8UA 1G8OA 3ST8A 4EE5A 2Y4LA 3QVBA 2OEGA 3U0YA 5J49A 2Z87A 1G93A 4YS8A 1H5SC 5CMIA 2GGOA 1W55A 1H7FA 5C4DA 4HO0A 1O23B 2VD4A 5CQLX 5AJPA 1JV3A 3RSBA 2JCJA 4GBPA 1VZTA 1S4NA 5DDVA 3OH1A 4KC1A 3HL3A 1H5RB 2RJ6A 3U2UA 1TZFA 4P02A 2YQJA 4LW3A 1H5SD 1ZJ0A 2NXVA 5CMHA 3PKQA 4HO5A 3D8VA 1JYLA 4FRHA 1HM0A 2JCKA 1VGWA 1GWWA 4B2WA 3NGWA 5FU0A 1FR9A 1GWVA 3BRKX 2ZU8A 1HV9A 4BQHA 3T7NA 3OAMA 3V91A 1NQIB 3E26A 2ICYA 4FRPA 1VH3A 3GUEA 5C49A 3POLA 1WSZA 4ARWA 1VZUA 1ZI4A 3BCVA 2VFZA 4ASYA 4FREA 2JCLA 3SXBA 2AGDA 2O1FA 3I0DA 4R7PA 1HM8A 4IRQA 1YP2A 1HM9A 2QH5A 2ZU9A 4EE3A 1QG8A 5CQOA
chains in the Genus database with same CATH superfamily
5CMJA 2V0LA 4M28A 5C38A 2FYBA 4Y63A 4B2XA 4CJ8A 2D0JA 5C48A 3I0KA 1OMZA 4FROA 2W0WA 1W77A 1FRWA 4FRLA 4J18A 4FRDA 4HO4A 1ZI5A 4KT7A 1NKHB 1H5SA 2RIXA 4IRPA 3JUKA 1S4PA 1FXOA 5C3BA 2QKXA 5FYEA 2XWNA 1LVWA 4EE4A 4M4KA 5CMGX 4KC2A 2RJ1A 1G97A 4B4BA 4KRVA 2RJ9A 3OH0A 2Q4JA 3U2WA 1MP5A 3LW6A 2OEFA 1H4DA 3ZF8A 1NHEB 3V8YA 5FUHA 5CQMX 2YQCA 1TVYA 3N9WA 3CKVA 5C3AA 1W57A 3CKNA 2BO7A 2W0VA 4G3PA 4B4GA 1FG5N 2FY7A 3OKRA 1O0RA 1R7XA 4AYJA 2GGQA 1H7QA 1SS9A 1MP3A 2V0IA 3T7OA 1LZ0A 1YROB 5D91A 1GX0A 3OH4A 3IOIA 4NALA 1VICA 3V0NA 1HJJA 3RMWA 3JTJA 4O6MA 3I0FA 4HO3A 1ZCTA 1H7TA 3SX7A 3V90A 1JV1A 3CGXA 3CU0A 2RJ8A 1S4OA 4DE7A 1XZ6A 4JD0A 3SX8A 3IOJA 2AE7A 2VK9A 4FCUA 2E8BA 1H3MA 1OMXA 1V83A 1V82A 1TW5A 4Y62A 1R80A 1ZCYA 1XHBA 1PZYB 2RJ0A 4G3QA 3U2VA 1ZDGA 1ZJ1A 1R7UA 3V0QA 2QGIA 4EEAA 2WE9A 4L41C 3CKQA 3I0LA 4D0ZA 1INJA 2FYDB 1IINA 1H4CA 1QGSA 3DUVA 1GQCA 2WVMA 1R7YA 2YC3A 3SXEA 3K8EA 1GQ9A 5C36A 4HG6A 3U2XA 1R7TA 1ZJPA 1VGZA 5EJ1A 3ZLKA 4Y64A 1G9RA 4Y7UA 2FFVA 4AAWA 3V0MA 5FTSA 2XWLA 4DECA 4P00A 1G23A 4Y6NA 3I0IX 5FU8A 3R2WA 4Y9XA 1ZJ3A 3I0GA 3OC9A 4E1KA 2X5ZA 1INIA 2V0JA 1ZCVA 3CKOA 1KWSA 1GX4A 2MZBA 3U0XA 1VGTA 4HCQA 4MYBA 1LL3A 4FRAA 4Y7GA 5C4FA 3ZGFA 3PKPA 2I5KA 5C47A 3Q7UA 2YC5A 4KPXA 3F1YA 3TZTA 1ON8A 2AECA 5CQNX 1FZWA 1ZJ2A 3SXAA 2VXMA 1LL2A 1ZJOA 3D98A 2C0NA 5L6SA 4KNRA 4MNDA 4UEGA 4HO8A 3USQA 2YCMA 3SXCA 2FYCB 2RITA 4KPZA 2RIYA 3D5NA 4B5BA 1IIMA 3DK5A 4D11C 4HO6A 1ZI3A 1NMMB 1LZ7A 4G87A 3T7MA 2P73A 1YP4A 4KNXA 5C3DA 2Y4MA 1H5TB 3KIAA 1GA8A 4D0TA 3I0HA 3I0CA 2CU2A 2Y4JA 3SXGA 2RJ7A 4FRBA 4FQWA 2PX7A 3ZGGA 3F1CA 1WT0A 4ECMA 4NAKA 2ZU7A 1H5RA 5JQQA 4B4MA 2WAWA 1G0RA 1FGXA 2VXLA 4D48A 4CJCA 1G1LA 2YQHA 5C4CA 3SX5A 2PGVA 5C1HA 2AM5A 2DPWA 1VZXA 5DDTA 1PZTA 4B42A 1FXJA 1TW1A 1QGQA 3FOQA 3V0OA 3V0PA 5HS2A 2XMEA 3ZLLA 3SXDA 3R3IA 3U2TA 3O3PA 1VH1A 4KC4A 1H5SB 2APCA 4XWIA 2AM3A 4FRMA 2YESA 4DDZA 2Y7AA 5C8RA 2OI6A 1JVGA 3V0LA 1O7OA 1LZIA 1G2VA 1G3LA 1WT2A 4G3SA 4Y7VA 2O1HA 1R81A 1LL0A 1QWJA 4KQLA 1H7EA 4FIYA 3Q80A 2V0HA 1MC3A 2OI7A 3USRA 4HO9A 2WVKA 2OI5A 5CQPA 1JYKA 1FR8A 5FV9A 1ZIZA 3E25A 5IDSA 1ZCUA 1K4VA 1FWYA 1YP3A 1Z90A 2Y6PA 2X60A 2ICXA 3V8ZA 2P6WA 2I7BA 2VS3A 3FWWA 4FRQA 3I0EA 3IOHA 2JCOA 2O1GA 4D11A 5EIYA 4Y7TA 5D92A 3I0JA 3Q4SA 4ZDQA 2RIZA 4M2BA 1H7LA 2VSIA 4K6RA 1OQMB 4KXOA 2Y4KA 2V0KA 2BO8A 1LZJA 1ON6A 3RMVA 5AJNA 1ZHJA 2I5EA 2A8WA 2J0AA 1JVDA 4NANA 2BO6A 5L6VA 2X5SA 1VPAA 4JISA 2AH9A 1EZIA 1O7QA 4MIXA 5EJZA 2WGZA 1H5TA 2WVLA 3SPTA 1WT1A 5C1GA 1WT3A 2X65A 1H7HA 1FO9A 1I52A 2FYAA 4EVWA 1H7GA 4EEMA 3K8DA 1FGGA 2RJ4A 2VSHA 4M2AA 4HOCA 1EYRA 2P72A 3OH2A 2Z86A 3SX3A 4Y6UA 3CKJA 5FTVA 4CJBA 1V84A 3OH3A 1R7VA 4C2SA 3OGZA 4CVHA 1NWGB 1G95A 1NF5B 1WVCA 1ZDFA 3EE5A 2VS5A 4AYLA 2WEEA 1VGUA 1VM8A 5I1FA 2YQSA 4AC3A 3PNNA 4HO2A 2AM4A 4ASJA 2D7RA 1FOAA 1MP4A 4B3UA 2D7IA 5IFYA 1FO8A 4EEGA 2AESA 2RJ5A 2BO4A 3TQDA 5AJOA 2XWMA 2UX8A 2VS4A 4NAIA 5C4BA 5C4EA 5BXCA 4FCEA 2PGYA 2FFUA 1R82A 1E5KA 1ZI1A 5IDTA 4BMAA 5CMFX 2E3DA 5C1LA 3DJ4A 4Y7FA 3JUJA 2PA4A 1HJLA 4FIXA 4LW6A 2XMHA 1H4EA 4EEOA 2A8UA 1G8OA 3ST8A 4EE5A 2Y4LA 3QVBA 2OEGA 3U0YA 5J49A 2Z87A 1G93A 4YS8A 1H5SC 5CMIA 2GGOA 1W55A 1H7FA 4O6NA 5C4DA 4HO0A 1O23B 2VD4A 5CQLX 5AJPA 1JV3A 3RSBA 2JCJA 4GBPA 1VZTA 1S4NA 5DDVA 3OH1A 4KC1A 3HL3A 1H5RB 2RJ6A 3U2UA 1TZFA 4P02A 2YQJA 4LW3A 1H5SD 1ZJ0A 2NXVA 5CMHA 3PKQA 4HO5A 3D8VA 1JYLA 4FRHA 1HM0A 2JCKA 1VGWA 4Q7CA 1GWWA 4B2WA 3NGWA 5FU0A 1FR9A 1GWVA 3BRKX 2ZU8A 1HV9A 4BQHA 3T7NA 3OAMA 3V91A 1NQIB 2J0BA 3E26A 2ICYA 4FRPA 1VH3A 3GUEA 5C49A 3POLA 1WSZA 4ARWA 1VZUA 1ZI4A 3BCVA 2VFZA 4ASYA 4FREA 2JCLA 3SXBA 2AGDA 2O1FA 3I0DA 4R7PA 1HM8A 4IRQA 1YP2A 1HM9A 2QH5A 2ZU9A 4EE3A 1QG8A 5CQOA
chains in the Genus database with same CATH topology
5CMJA 2V0LA 4M28A 5C38A 2FYBA 4Y63A 4B2XA 4CJ8A 2D0JA 5C48A 3I0KA 1OMZA 4FROA 2W0WA 1W77A 1FRWA 4FRLA 4J18A 4FRDA 4HO4A 1ZI5A 4KT7A 1NKHB 1H5SA 2RIXA 4IRPA 3JUKA 1S4PA 1FXOA 5C3BA 2QKXA 5FYEA 2XWNA 1LVWA 4EE4A 4M4KA 5CMGX 4KC2A 2RJ1A 1G97A 4B4BA 4KRVA 2RJ9A 3OH0A 2Q4JA 3U2WA 1MP5A 3LW6A 2OEFA 1H4DA 3ZF8A 1NHEB 3V8YA 5FUHA 5CQMX 2YQCA 1TVYA 3N9WA 3CKVA 5C3AA 1W57A 3CKNA 2BO7A 2W0VA 4G3PA 4B4GA 1FG5N 2FY7A 3OKRA 1O0RA 1R7XA 4AYJA 2GGQA 1H7QA 1SS9A 1MP3A 2V0IA 3T7OA 1LZ0A 1YROB 5D91A 1GX0A 3OH4A 3IOIA 4NALA 1VICA 3V0NA 1HJJA 3RMWA 3JTJA 4O6MA 3I0FA 4HO3A 1ZCTA 1H7TA 3SX7A 3V90A 1JV1A 3CGXA 3CU0A 2RJ8A 1S4OA 4DE7A 1XZ6A 4JD0A 3SX8A 3IOJA 2AE7A 2VK9A 4FCUA 2E8BA 1H3MA 1OMXA 1V83A 1V82A 1TW5A 4Y62A 1R80A 1ZCYA 1XHBA 1PZYB 2RJ0A 4G3QA 3U2VA 1ZDGA 1ZJ1A 1R7UA 3V0QA 2QGIA 4EEAA 2WE9A 4L41C 3CKQA 3I0LA 4D0ZA 1INJA 2FYDB 1IINA 1H4CA 1QGSA 3DUVA 1GQCA 2WVMA 1R7YA 2YC3A 3SXEA 3K8EA 1GQ9A 5C36A 4HG6A 3U2XA 1R7TA 1ZJPA 1VGZA 5EJ1A 3ZLKA 4Y64A 1G9RA 4Y7UA 2FFVA 4AAWA 3V0MA 5FTSA 2XWLA 4DECA 4P00A 1G23A 4Y6NA 3I0IX 5FU8A 3R2WA 4Y9XA 1ZJ3A 3I0GA 3OC9A 4E1KA 2X5ZA 1INIA 2V0JA 1ZCVA 3CKOA 1KWSA 1GX4A 2MZBA 3U0XA 1VGTA 4HCQA 4MYBA 1LL3A 4FRAA 4Y7GA 5C4FA 3ZGFA 3PKPA 2I5KA 5C47A 3Q7UA 2YC5A 4KPXA 3F1YA 3TZTA 1ON8A 2AECA 5CQNX 1FZWA 1ZJ2A 3SXAA 2VXMA 1LL2A 1ZJOA 3D98A 2C0NA 5L6SA 4KNRA 4MNDA 4UEGA 4HO8A 3USQA 2YCMA 3SXCA 2FYCB 2RITA 4KPZA 2RIYA 3D5NA 4B5BA 1IIMA 3DK5A 4D11C 4HO6A 1ZI3A 1NMMB 1LZ7A 4G87A 3T7MA 2P73A 1YP4A 4KNXA 5C3DA 2Y4MA 1H5TB 3KIAA 1GA8A 4D0TA 3I0HA 3I0CA 2CU2A 2Y4JA 3SXGA 2RJ7A 4FRBA 4FQWA 2PX7A 3ZGGA 3F1CA 1WT0A 4ECMA 4NAKA 2ZU7A 1H5RA 5JQQA 4B4MA 2WAWA 1G0RA 1FGXA 2VXLA 4D48A 4CJCA 1G1LA 2YQHA 5C4CA 3SX5A 2PGVA 5C1HA 2AM5A 2DPWA 1VZXA 5DDTA 1PZTA 4B42A 1FXJA 1TW1A 1QGQA 3FOQA 3V0OA 3V0PA 5HS2A 2XMEA 3ZLLA 3SXDA 3R3IA 3U2TA 3O3PA 1VH1A 4KC4A 1H5SB 2APCA 4XWIA 2AM3A 4FRMA 2YESA 4DDZA 2Y7AA 5C8RA 2OI6A 1JVGA 3V0LA 1O7OA 1LZIA 1G2VA 1G3LA 1WT2A 4G3SA 4Y7VA 2O1HA 1R81A 1LL0A 1QWJA 4KQLA 1H7EA 4FIYA 3Q80A 2V0HA 1MC3A 2OI7A 3USRA 4HO9A 2WVKA 2OI5A 5CQPA 1JYKA 1FR8A 5FV9A 1ZIZA 3E25A 5IDSA 1ZCUA 1K4VA 1FWYA 1YP3A 1Z90A 2Y6PA 2X60A 2ICXA 3V8ZA 2P6WA 2I7BA 2VS3A 3FWWA 4FRQA 3I0EA 3IOHA 2JCOA 2O1GA 4D11A 5EIYA 4Y7TA 5D92A 3I0JA 3Q4SA 4ZDQA 2RIZA 4M2BA 1H7LA 2VSIA 4K6RA 1OQMB 4KXOA 2Y4KA 2V0KA 2BO8A 1LZJA 1ON6A 3RMVA 5AJNA 1ZHJA 2I5EA 2A8WA 2J0AA 1JVDA 4NANA 2BO6A 5L6VA 2X5SA 1VPAA 4JISA 2AH9A 1EZIA 1O7QA 4MIXA 5EJZA 2WGZA 1H5TA 2WVLA 3SPTA 1WT1A 5C1GA 1WT3A 2X65A 1H7HA 1FO9A 1I52A 2FYAA 4EVWA 1H7GA 4EEMA 3K8DA 1FGGA 2RJ4A 2VSHA 4M2AA 4HOCA 1EYRA 2P72A 3OH2A 2Z86A 3SX3A 4Y6UA 3CKJA 5FTVA 4CJBA 1V84A 3OH3A 1R7VA 4C2SA 3OGZA 4CVHA 1NWGB 1G95A 1NF5B 1WVCA 1ZDFA 3EE5A 2VS5A 4AYLA 2WEEA 1VGUA 1VM8A 5I1FA 2YQSA 4AC3A 3PNNA 4HO2A 2AM4A 4ASJA 2D7RA 1FOAA 1MP4A 4B3UA 2D7IA 5IFYA 1FO8A 4EEGA 2AESA 2RJ5A 2BO4A 3TQDA 5AJOA 2XWMA 2UX8A 2VS4A 4NAIA 5C4BA 5C4EA 5BXCA 4FCEA 2PGYA 2FFUA 1R82A 1E5KA 1ZI1A 5IDTA 4BMAA 5CMFX 2E3DA 5C1LA 3DJ4A 4Y7FA 3JUJA 2PA4A 1HJLA 4FIXA 4LW6A 2XMHA 1H4EA 4EEOA 2A8UA 1G8OA 3ST8A 4EE5A 2Y4LA 3QVBA 2OEGA 3U0YA 5J49A 2Z87A 1G93A 4YS8A 1H5SC 5CMIA 2GGOA 1W55A 1H7FA 4O6NA 5C4DA 4HO0A 1O23B 2VD4A 5CQLX 5AJPA 1JV3A 3RSBA 2JCJA 4GBPA 1VZTA 1S4NA 5DDVA 3OH1A 4KC1A 3HL3A 1H5RB 2RJ6A 3U2UA 1TZFA 4P02A 2YQJA 4LW3A 1H5SD 1ZJ0A 2NXVA 5CMHA 3PKQA 4HO5A 3D8VA 1JYLA 4FRHA 1HM0A 2JCKA 1VGWA 4Q7CA 1GWWA 4B2WA 3NGWA 5FU0A 1FR9A 1GWVA 3BRKX 2ZU8A 1HV9A 4BQHA 3T7NA 3OAMA 3V91A 1NQIB 2J0BA 3E26A 2ICYA 4FRPA 1VH3A 3GUEA 5C49A 3POLA 1WSZA 4ARWA 1VZUA 1ZI4A 3BCVA 2VFZA 4ASYA 4FREA 2JCLA 3SXBA 2AGDA 2O1FA 3I0DA 4R7PA 1HM8A 4IRQA 1YP2A 1HM9A 2QH5A 2ZU9A 4EE3A 1QG8A 5CQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CMJ A;  2V0L A;  4M28 A;  5C38 A;  2FYB A;  4Y63 A;  4B2X A;  4CJ8 A;  2D0J A;  5C48 A;  3I0K A;  1OMZ A;  4FRO A;  2W0W A;  1W77 A;  1FRW A;  4FRL A;  4J18 A;  4FRD A;  4HO4 A;  1ZI5 A;  4KT7 A;  1NKH B;  1H5S A;  2RIX A;  4IRP A;  3JUK A;  1S4P A;  1FXO A;  5C3B A;  2QKX A;  5FYE A;  2XWN A;  1LVW A;  4EE4 A;  4M4K A;  5CMG X;  4KC2 A;  2RJ1 A;  1G97 A;  4B4B A;  4KRV A;  2RJ9 A;  3OH0 A;  2Q4J A;  3U2W A;  1MP5 A;  3LW6 A;  2OEF A;  1H4D A;  3ZF8 A;  1NHE B;  3V8Y A;  5FUH A;  5CQM X;  2YQC A;  1TVY A;  3N9W A;  3CKV A;  5C3A A;  1W57 A;  3CKN A;  2BO7 A;  2W0V A;  4G3P A;  4B4G A;  1FG5 N;  2FY7 A;  3OKR A;  1O0R A;  1R7X A;  4AYJ A;  2GGQ A;  1H7Q A;  1SS9 A;  1MP3 A;  2V0I A;  3T7O A;  1LZ0 A;  1YRO B;  1GX0 A;  3OH4 A;  3IOI A;  4NAL A;  1VIC A;  3V0N A;  1HJJ A;  3RMW A;  3JTJ A;  3I0F A;  4HO3 A;  1ZCT A;  1H7T A;  3SX7 A;  3V90 A;  1JV1 A;  3CGX A;  3CU0 A;  2RJ8 A;  1S4O A;  4DE7 A;  1XZ6 A;  4JD0 A;  3SX8 A;  3IOJ A;  2AE7 A;  4FCU A;  2E8B A;  1H3M A;  1OMX A;  1V83 A;  1V82 A;  1TW5 A;  4Y62 A;  1R80 A;  1ZCY A;  1XHB A;  1PZY B;  2RJ0 A;  4G3Q A;  3U2V A;  1ZDG A;  1ZJ1 A;  1R7U A;  3V0Q A;  2QGI A;  4EEA A;  2WE9 A;  4L41 C;  3CKQ A;  3I0L A;  4D0Z A;  1INJ A;  2FYD B;  1IIN A;  1H4C A;  1QGS A;  3DUV A;  1GQC A;  2WVM A;  1R7Y A;  2YC3 A;  3SXE A;  3K8E A;  1GQ9 A;  5C36 A;  4HG6 A;  3U2X A;  1R7T A;  1ZJP A;  1VGZ A;  5EJ1 A;  3ZLK A;  4Y64 A;  1G9R A;  4Y7U A;  2FFV A;  4AAW A;  3V0M A;  5FTS A;  2XWL A;  4DEC A;  4P00 A;  1G23 A;  4Y6N A;  3I0I X;  5FU8 A;  3R2W A;  4Y9X A;  1ZJ3 A;  3I0G A;  3OC9 A;  4E1K A;  2X5Z A;  1INI A;  2V0J A;  1ZCV A;  3CKO A;  1KWS A;  1GX4 A;  2MZB A;  3U0X A;  1VGT A;  4HCQ A;  4MYB A;  1LL3 A;  4FRA A;  4Y7G A;  5C4F A;  3ZGF A;  3PKP A;  2I5K A;  5C47 A;  3Q7U A;  2YC5 A;  4KPX A;  3F1Y A;  3TZT A;  1ON8 A;  2AEC A;  5CQN X;  1FZW A;  1ZJ2 A;  3SXA A;  2VXM A;  1LL2 A;  1ZJO A;  3D98 A;  5L6S A;  4KNR A;  4MND A;  4UEG A;  4HO8 A;  3USQ A;  2YCM A;  3SXC A;  2FYC B;  2RIT A;  4KPZ A;  2RIY A;  3D5N A;  4B5B A;  1IIM A;  3DK5 A;  4D11 C;  4HO6 A;  1ZI3 A;  1NMM B;  1LZ7 A;  4G87 A;  3T7M A;  2P73 A;  1YP4 A;  4KNX A;  5C3D A;  2Y4M A;  1H5T B;  3KIA A;  1GA8 A;  4D0T A;  3I0H A;  3I0C A;  2CU2 A;  2Y4J A;  3SXG A;  2RJ7 A;  4FRB A;  4FQW A;  2PX7 A;  3ZGG A;  3F1C A;  1WT0 A;  4ECM A;  4NAK A;  2ZU7 A;  1H5R A;  5JQQ A;  4B4M A;  2WAW A;  1G0R A;  1FGX A;  2VXL A;  4D48 A;  4CJC A;  1G1L A;  2YQH A;  5C4C A;  3SX5 A;  2PGV A;  5C1H A;  2AM5 A;  2DPW A;  1VZX A;  5DDT A;  1PZT A;  4B42 A;  1FXJ A;  1TW1 A;  1QGQ A;  3FOQ A;  3V0O A;  3V0P A;  5HS2 A;  2XME A;  3ZLL A;  3SXD A;  3R3I A;  3U2T A;  3O3P A;  1VH1 A;  4KC4 A;  1H5S B;  2APC A;  4XWI A;  2AM3 A;  4FRM A;  2YES A;  4DDZ A;  2Y7A A;  5C8R A;  2OI6 A;  1JVG A;  3V0L A;  1O7O A;  1LZI A;  1G2V A;  1G3L A;  1WT2 A;  4G3S A;  4Y7V A;  2O1H A;  1R81 A;  1LL0 A;  1QWJ A;  4KQL A;  1H7E A;  3Q80 A;  2V0H A;  1MC3 A;  2OI7 A;  3USR A;  4HO9 A;  2WVK A;  2OI5 A;  5CQP A;  1JYK A;  1FR8 A;  5FV9 A;  1ZIZ A;  3E25 A;  5IDS A;  1ZCU A;  1K4V A;  1FWY A;  1YP3 A;  1Z90 A;  2Y6P A;  2X60 A;  2ICX A;  3V8Z A;  2P6W A;  2I7B A;  2VS3 A;  3FWW A;  4FRQ A;  3I0E A;  3IOH A;  2JCO A;  2O1G A;  4D11 A;  5EIY A;  4Y7T A;  3I0J A;  3Q4S A;  4ZDQ A;  2RIZ A;  4M2B A;  1H7L A;  2VSI A;  4K6R A;  1OQM B;  4KXO A;  2Y4K A;  2V0K A;  2BO8 A;  1LZJ A;  1ON6 A;  3RMV A;  5AJN A;  1ZHJ A;  2I5E A;  2A8W A;  1JVD A;  4NAN A;  2BO6 A;  5L6V A;  2X5S A;  1VPA A;  4JIS A;  2AH9 A;  1EZI A;  1O7Q A;  5EJZ A;  2WGZ A;  1H5T A;  2WVL A;  3SPT A;  1WT1 A;  5C1G A;  1WT3 A;  2X65 A;  1H7H A;  1FO9 A;  1I52 A;  2FYA A;  4EVW A;  1H7G A;  4EEM A;  3K8D A;  1FGG A;  2RJ4 A;  2VSH A;  4M2A A;  4HOC A;  1EYR A;  2P72 A;  3OH2 A;  2Z86 A;  3SX3 A;  4Y6U A;  3CKJ A;  5FTV A;  4CJB A;  1V84 A;  3OH3 A;  1R7V A;  4C2S A;  3OGZ A;  4CVH A;  1NWG B;  1G95 A;  1NF5 B;  1WVC A;  1ZDF A;  3EE5 A;  2VS5 A;  4AYL A;  2WEE A;  1VGU A;  1VM8 A;  5I1F A;  2YQS A;  4AC3 A;  3PNN A;  4HO2 A;  2AM4 A;  4ASJ A;  2D7R A;  1FOA A;  1MP4 A;  4B3U A;  2D7I A;  5IFY A;  1FO8 A;  4EEG A;  2AES A;  2RJ5 A;  2BO4 A;  3TQD A;  5AJO A;  2XWM A;  2UX8 A;  2VS4 A;  4NAI A;  5C4B A;  5C4E A;  5BXC A;  4FCE A;  2PGY A;  2FFU A;  1R82 A;  1E5K A;  1ZI1 A;  5IDT A;  4BMA A;  5CMF X;  2E3D A;  5C1L A;  3DJ4 A;  4Y7F A;  3JUJ A;  2PA4 A;  1HJL A;  4LW6 A;  2XMH A;  1H4E A;  4EEO A;  2A8U A;  1G8O A;  3ST8 A;  4EE5 A;  2Y4L A;  3QVB A;  2OEG A;  3U0Y A;  5J49 A;  2Z87 A;  1G93 A;  4YS8 A;  1H5S C;  5CMI A;  2GGO A;  1W55 A;  1H7F A;  5C4D A;  4HO0 A;  1O23 B;  2VD4 A;  5CQL X;  5AJP A;  1JV3 A;  3RSB A;  2JCJ A;  4GBP A;  1VZT A;  1S4N A;  5DDV A;  3OH1 A;  4KC1 A;  3HL3 A;  1H5R B;  2RJ6 A;  3U2U A;  1TZF A;  4P02 A;  2YQJ A;  4LW3 A;  1H5S D;  1ZJ0 A;  2NXV A;  5CMH A;  3PKQ A;  4HO5 A;  3D8V A;  1JYL A;  4FRH A;  1HM0 A;  2JCK A;  1VGW A;  1GWW A;  4B2W A;  3NGW A;  5FU0 A;  1FR9 A;  1GWV A;  3BRK X;  2ZU8 A;  1HV9 A;  4BQH A;  3T7N A;  3OAM A;  3V91 A;  1NQI B;  3E26 A;  2ICY A;  4FRP A;  1VH3 A;  3GUE A;  5C49 A;  3POL A;  1WSZ A;  4ARW A;  1VZU A;  1ZI4 A;  3BCV A;  2VFZ A;  4ASY A;  4FRE A;  2JCL A;  3SXB A;  2AGD A;  2O1F A;  3I0D A;  4R7P A;  1HM8 A;  4IRQ A;  1YP2 A;  1HM9 A;  2QH5 A;  2ZU9 A;  4EE3 A;  1QG8 A;  5CQO A; 
#chains in the Genus database with same CATH topology
 5CMJ A;  2V0L A;  4M28 A;  5C38 A;  2FYB A;  4Y63 A;  4B2X A;  4CJ8 A;  2D0J A;  5C48 A;  3I0K A;  1OMZ A;  4FRO A;  2W0W A;  1W77 A;  1FRW A;  4FRL A;  4J18 A;  4FRD A;  4HO4 A;  1ZI5 A;  4KT7 A;  1NKH B;  1H5S A;  2RIX A;  4IRP A;  3JUK A;  1S4P A;  1FXO A;  5C3B A;  2QKX A;  5FYE A;  2XWN A;  1LVW A;  4EE4 A;  4M4K A;  5CMG X;  4KC2 A;  2RJ1 A;  1G97 A;  4B4B A;  4KRV A;  2RJ9 A;  3OH0 A;  2Q4J A;  3U2W A;  1MP5 A;  3LW6 A;  2OEF A;  1H4D A;  3ZF8 A;  1NHE B;  3V8Y A;  5FUH A;  5CQM X;  2YQC A;  1TVY A;  3N9W A;  3CKV A;  5C3A A;  1W57 A;  3CKN A;  2BO7 A;  2W0V A;  4G3P A;  4B4G A;  1FG5 N;  2FY7 A;  3OKR A;  1O0R A;  1R7X A;  4AYJ A;  2GGQ A;  1H7Q A;  1SS9 A;  1MP3 A;  2V0I A;  3T7O A;  1LZ0 A;  1YRO B;  5D91 A;  1GX0 A;  3OH4 A;  3IOI A;  4NAL A;  1VIC A;  3V0N A;  1HJJ A;  3RMW A;  3JTJ A;  4O6M A;  3I0F A;  4HO3 A;  1ZCT A;  1H7T A;  3SX7 A;  3V90 A;  1JV1 A;  3CGX A;  3CU0 A;  2RJ8 A;  1S4O A;  4DE7 A;  1XZ6 A;  4JD0 A;  3SX8 A;  3IOJ A;  2AE7 A;  2VK9 A;  4FCU A;  2E8B A;  1H3M A;  1OMX A;  1V83 A;  1V82 A;  1TW5 A;  4Y62 A;  1R80 A;  1ZCY A;  1XHB A;  1PZY B;  2RJ0 A;  4G3Q A;  3U2V A;  1ZDG A;  1ZJ1 A;  1R7U A;  3V0Q A;  2QGI A;  4EEA A;  2WE9 A;  4L41 C;  3CKQ A;  3I0L A;  4D0Z A;  1INJ A;  2FYD B;  1IIN A;  1H4C A;  1QGS A;  3DUV A;  1GQC A;  2WVM A;  1R7Y A;  2YC3 A;  3SXE A;  3K8E A;  1GQ9 A;  5C36 A;  4HG6 A;  3U2X A;  1R7T A;  1ZJP A;  1VGZ A;  5EJ1 A;  3ZLK A;  4Y64 A;  1G9R A;  4Y7U A;  2FFV A;  4AAW A;  3V0M A;  5FTS A;  2XWL A;  4DEC A;  4P00 A;  1G23 A;  4Y6N A;  3I0I X;  5FU8 A;  3R2W A;  4Y9X A;  1ZJ3 A;  3I0G A;  3OC9 A;  4E1K A;  2X5Z A;  1INI A;  2V0J A;  1ZCV A;  3CKO A;  1KWS A;  1GX4 A;  2MZB A;  3U0X A;  1VGT A;  4HCQ A;  4MYB A;  1LL3 A;  4FRA A;  4Y7G A;  5C4F A;  3ZGF A;  3PKP A;  2I5K A;  5C47 A;  3Q7U A;  2YC5 A;  4KPX A;  3F1Y A;  3TZT A;  1ON8 A;  2AEC A;  5CQN X;  1FZW A;  1ZJ2 A;  3SXA A;  2VXM A;  1LL2 A;  1ZJO A;  3D98 A;  2C0N A;  5L6S A;  4KNR A;  4MND A;  4UEG A;  4HO8 A;  3USQ A;  2YCM A;  3SXC A;  2FYC B;  2RIT A;  4KPZ A;  2RIY A;  3D5N A;  4B5B A;  1IIM A;  3DK5 A;  4D11 C;  4HO6 A;  1ZI3 A;  1NMM B;  1LZ7 A;  4G87 A;  3T7M A;  2P73 A;  1YP4 A;  4KNX A;  5C3D A;  2Y4M A;  1H5T B;  3KIA A;  1GA8 A;  4D0T A;  3I0H A;  3I0C A;  2CU2 A;  2Y4J A;  3SXG A;  2RJ7 A;  4FRB A;  4FQW A;  2PX7 A;  3ZGG A;  3F1C A;  1WT0 A;  4ECM A;  4NAK A;  2ZU7 A;  1H5R A;  5JQQ A;  4B4M A;  2WAW A;  1G0R A;  1FGX A;  2VXL A;  4D48 A;  4CJC A;  1G1L A;  2YQH A;  5C4C A;  3SX5 A;  2PGV A;  5C1H A;  2AM5 A;  2DPW A;  1VZX A;  5DDT A;  1PZT A;  4B42 A;  1FXJ A;  1TW1 A;  1QGQ A;  3FOQ A;  3V0O A;  3V0P A;  5HS2 A;  2XME A;  3ZLL A;  3SXD A;  3R3I A;  3U2T A;  3O3P A;  1VH1 A;  4KC4 A;  1H5S B;  2APC A;  4XWI A;  2AM3 A;  4FRM A;  2YES A;  4DDZ A;  2Y7A A;  5C8R A;  2OI6 A;  1JVG A;  3V0L A;  1O7O A;  1LZI A;  1G2V A;  1G3L A;  1WT2 A;  4G3S A;  4Y7V A;  2O1H A;  1R81 A;  1LL0 A;  1QWJ A;  4KQL A;  1H7E A;  4FIY A;  3Q80 A;  2V0H A;  1MC3 A;  2OI7 A;  3USR A;  4HO9 A;  2WVK A;  2OI5 A;  5CQP A;  1JYK A;  1FR8 A;  5FV9 A;  1ZIZ A;  3E25 A;  5IDS A;  1ZCU A;  1K4V A;  1FWY A;  1YP3 A;  1Z90 A;  2Y6P A;  2X60 A;  2ICX A;  3V8Z A;  2P6W A;  2I7B A;  2VS3 A;  3FWW A;  4FRQ A;  3I0E A;  3IOH A;  2JCO A;  2O1G A;  4D11 A;  5EIY A;  4Y7T A;  5D92 A;  3I0J A;  3Q4S A;  4ZDQ A;  2RIZ A;  4M2B A;  1H7L A;  2VSI A;  4K6R A;  1OQM B;  4KXO A;  2Y4K A;  2V0K A;  2BO8 A;  1LZJ A;  1ON6 A;  3RMV A;  5AJN A;  1ZHJ A;  2I5E A;  2A8W A;  2J0A A;  1JVD A;  4NAN A;  2BO6 A;  5L6V A;  2X5S A;  1VPA A;  4JIS A;  2AH9 A;  1EZI A;  1O7Q A;  4MIX A;  5EJZ A;  2WGZ A;  1H5T A;  2WVL A;  3SPT A;  1WT1 A;  5C1G A;  1WT3 A;  2X65 A;  1H7H A;  1FO9 A;  1I52 A;  2FYA A;  4EVW A;  1H7G A;  4EEM A;  3K8D A;  1FGG A;  2RJ4 A;  2VSH A;  4M2A A;  4HOC A;  1EYR A;  2P72 A;  3OH2 A;  2Z86 A;  3SX3 A;  4Y6U A;  3CKJ A;  5FTV A;  4CJB A;  1V84 A;  3OH3 A;  1R7V A;  4C2S A;  3OGZ A;  4CVH A;  1NWG B;  1G95 A;  1NF5 B;  1WVC A;  1ZDF A;  3EE5 A;  2VS5 A;  4AYL A;  2WEE A;  1VGU A;  1VM8 A;  5I1F A;  2YQS A;  4AC3 A;  3PNN A;  4HO2 A;  2AM4 A;  4ASJ A;  2D7R A;  1FOA A;  1MP4 A;  4B3U A;  2D7I A;  5IFY A;  1FO8 A;  4EEG A;  2AES A;  2RJ5 A;  2BO4 A;  3TQD A;  5AJO A;  2XWM A;  2UX8 A;  2VS4 A;  4NAI A;  5C4B A;  5C4E A;  5BXC A;  4FCE A;  2PGY A;  2FFU A;  1R82 A;  1E5K A;  1ZI1 A;  5IDT A;  4BMA A;  5CMF X;  2E3D A;  5C1L A;  3DJ4 A;  4Y7F A;  3JUJ A;  2PA4 A;  1HJL A;  4FIX A;  4LW6 A;  2XMH A;  1H4E A;  4EEO A;  2A8U A;  1G8O A;  3ST8 A;  4EE5 A;  2Y4L A;  3QVB A;  2OEG A;  3U0Y A;  5J49 A;  2Z87 A;  1G93 A;  4YS8 A;  1H5S C;  5CMI A;  2GGO A;  1W55 A;  1H7F A;  4O6N A;  5C4D A;  4HO0 A;  1O23 B;  2VD4 A;  5CQL X;  5AJP A;  1JV3 A;  3RSB A;  2JCJ A;  4GBP A;  1VZT A;  1S4N A;  5DDV A;  3OH1 A;  4KC1 A;  3HL3 A;  1H5R B;  2RJ6 A;  3U2U A;  1TZF A;  4P02 A;  2YQJ A;  4LW3 A;  1H5S D;  1ZJ0 A;  2NXV A;  5CMH A;  3PKQ A;  4HO5 A;  3D8V A;  1JYL A;  4FRH A;  1HM0 A;  2JCK A;  1VGW A;  4Q7C A;  1GWW A;  4B2W A;  3NGW A;  5FU0 A;  1FR9 A;  1GWV A;  3BRK X;  2ZU8 A;  1HV9 A;  4BQH A;  3T7N A;  3OAM A;  3V91 A;  1NQI B;  2J0B A;  3E26 A;  2ICY A;  4FRP A;  1VH3 A;  3GUE A;  5C49 A;  3POL A;  1WSZ A;  4ARW A;  1VZU A;  1ZI4 A;  3BCV A;  2VFZ A;  4ASY A;  4FRE A;  2JCL A;  3SXB A;  2AGD A;  2O1F A;  3I0D A;  4R7P A;  1HM8 A;  4IRQ A;  1YP2 A;  1HM9 A;  2QH5 A;  2ZU9 A;  4EE3 A;  1QG8 A;  5CQO A; 
#chains in the Genus database with same CATH homology
 5CMJ A;  2V0L A;  4M28 A;  5C38 A;  2FYB A;  4Y63 A;  4B2X A;  4CJ8 A;  2D0J A;  5C48 A;  3I0K A;  1OMZ A;  4FRO A;  2W0W A;  1W77 A;  1FRW A;  4FRL A;  4J18 A;  4FRD A;  4HO4 A;  1ZI5 A;  4KT7 A;  1NKH B;  1H5S A;  2RIX A;  4IRP A;  3JUK A;  1S4P A;  1FXO A;  5C3B A;  2QKX A;  5FYE A;  2XWN A;  1LVW A;  4EE4 A;  4M4K A;  5CMG X;  4KC2 A;  2RJ1 A;  1G97 A;  4B4B A;  4KRV A;  2RJ9 A;  3OH0 A;  2Q4J A;  3U2W A;  1MP5 A;  3LW6 A;  2OEF A;  1H4D A;  3ZF8 A;  1NHE B;  3V8Y A;  5FUH A;  5CQM X;  2YQC A;  1TVY A;  3N9W A;  3CKV A;  5C3A A;  1W57 A;  3CKN A;  2BO7 A;  2W0V A;  4G3P A;  4B4G A;  1FG5 N;  2FY7 A;  3OKR A;  1O0R A;  1R7X A;  4AYJ A;  2GGQ A;  1H7Q A;  1SS9 A;  1MP3 A;  2V0I A;  3T7O A;  1LZ0 A;  1YRO B;  5D91 A;  1GX0 A;  3OH4 A;  3IOI A;  4NAL A;  1VIC A;  3V0N A;  1HJJ A;  3RMW A;  3JTJ A;  4O6M A;  3I0F A;  4HO3 A;  1ZCT A;  1H7T A;  3SX7 A;  3V90 A;  1JV1 A;  3CGX A;  3CU0 A;  2RJ8 A;  1S4O A;  4DE7 A;  1XZ6 A;  4JD0 A;  3SX8 A;  3IOJ A;  2AE7 A;  2VK9 A;  4FCU A;  2E8B A;  1H3M A;  1OMX A;  1V83 A;  1V82 A;  1TW5 A;  4Y62 A;  1R80 A;  1ZCY A;  1XHB A;  1PZY B;  2RJ0 A;  4G3Q A;  3U2V A;  1ZDG A;  1ZJ1 A;  1R7U A;  3V0Q A;  2QGI A;  4EEA A;  2WE9 A;  4L41 C;  3CKQ A;  3I0L A;  4D0Z A;  1INJ A;  2FYD B;  1IIN A;  1H4C A;  1QGS A;  3DUV A;  1GQC A;  2WVM A;  1R7Y A;  2YC3 A;  3SXE A;  3K8E A;  1GQ9 A;  5C36 A;  4HG6 A;  3U2X A;  1R7T A;  1ZJP A;  1VGZ A;  5EJ1 A;  3ZLK A;  4Y64 A;  1G9R A;  4Y7U A;  2FFV A;  4AAW A;  3V0M A;  5FTS A;  2XWL A;  4DEC A;  4P00 A;  1G23 A;  4Y6N A;  3I0I X;  5FU8 A;  3R2W A;  4Y9X A;  1ZJ3 A;  3I0G A;  3OC9 A;  4E1K A;  2X5Z A;  1INI A;  2V0J A;  1ZCV A;  3CKO A;  1KWS A;  1GX4 A;  2MZB A;  3U0X A;  1VGT A;  4HCQ A;  4MYB A;  1LL3 A;  4FRA A;  4Y7G A;  5C4F A;  3ZGF A;  3PKP A;  2I5K A;  5C47 A;  3Q7U A;  2YC5 A;  4KPX A;  3F1Y A;  3TZT A;  1ON8 A;  2AEC A;  5CQN X;  1FZW A;  1ZJ2 A;  3SXA A;  2VXM A;  1LL2 A;  1ZJO A;  3D98 A;  2C0N A;  5L6S A;  4KNR A;  4MND A;  4UEG A;  4HO8 A;  3USQ A;  2YCM A;  3SXC A;  2FYC B;  2RIT A;  4KPZ A;  2RIY A;  3D5N A;  4B5B A;  1IIM A;  3DK5 A;  4D11 C;  4HO6 A;  1ZI3 A;  1NMM B;  1LZ7 A;  4G87 A;  3T7M A;  2P73 A;  1YP4 A;  4KNX A;  5C3D A;  2Y4M A;  1H5T B;  3KIA A;  1GA8 A;  4D0T A;  3I0H A;  3I0C A;  2CU2 A;  2Y4J A;  3SXG A;  2RJ7 A;  4FRB A;  4FQW A;  2PX7 A;  3ZGG A;  3F1C A;  1WT0 A;  4ECM A;  4NAK A;  2ZU7 A;  1H5R A;  5JQQ A;  4B4M A;  2WAW A;  1G0R A;  1FGX A;  2VXL A;  4D48 A;  4CJC A;  1G1L A;  2YQH A;  5C4C A;  3SX5 A;  2PGV A;  5C1H A;  2AM5 A;  2DPW A;  1VZX A;  5DDT A;  1PZT A;  4B42 A;  1FXJ A;  1TW1 A;  1QGQ A;  3FOQ A;  3V0O A;  3V0P A;  5HS2 A;  2XME A;  3ZLL A;  3SXD A;  3R3I A;  3U2T A;  3O3P A;  1VH1 A;  4KC4 A;  1H5S B;  2APC A;  4XWI A;  2AM3 A;  4FRM A;  2YES A;  4DDZ A;  2Y7A A;  5C8R A;  2OI6 A;  1JVG A;  3V0L A;  1O7O A;  1LZI A;  1G2V A;  1G3L A;  1WT2 A;  4G3S A;  4Y7V A;  2O1H A;  1R81 A;  1LL0 A;  1QWJ A;  4KQL A;  1H7E A;  4FIY A;  3Q80 A;  2V0H A;  1MC3 A;  2OI7 A;  3USR A;  4HO9 A;  2WVK A;  2OI5 A;  5CQP A;  1JYK A;  1FR8 A;  5FV9 A;  1ZIZ A;  3E25 A;  5IDS A;  1ZCU A;  1K4V A;  1FWY A;  1YP3 A;  1Z90 A;  2Y6P A;  2X60 A;  2ICX A;  3V8Z A;  2P6W A;  2I7B A;  2VS3 A;  3FWW A;  4FRQ A;  3I0E A;  3IOH A;  2JCO A;  2O1G A;  4D11 A;  5EIY A;  4Y7T A;  5D92 A;  3I0J A;  3Q4S A;  4ZDQ A;  2RIZ A;  4M2B A;  1H7L A;  2VSI A;  4K6R A;  1OQM B;  4KXO A;  2Y4K A;  2V0K A;  2BO8 A;  1LZJ A;  1ON6 A;  3RMV A;  5AJN A;  1ZHJ A;  2I5E A;  2A8W A;  2J0A A;  1JVD A;  4NAN A;  2BO6 A;  5L6V A;  2X5S A;  1VPA A;  4JIS A;  2AH9 A;  1EZI A;  1O7Q A;  4MIX A;  5EJZ A;  2WGZ A;  1H5T A;  2WVL A;  3SPT A;  1WT1 A;  5C1G A;  1WT3 A;  2X65 A;  1H7H A;  1FO9 A;  1I52 A;  2FYA A;  4EVW A;  1H7G A;  4EEM A;  3K8D A;  1FGG A;  2RJ4 A;  2VSH A;  4M2A A;  4HOC A;  1EYR A;  2P72 A;  3OH2 A;  2Z86 A;  3SX3 A;  4Y6U A;  3CKJ A;  5FTV A;  4CJB A;  1V84 A;  3OH3 A;  1R7V A;  4C2S A;  3OGZ A;  4CVH A;  1NWG B;  1G95 A;  1NF5 B;  1WVC A;  1ZDF A;  3EE5 A;  2VS5 A;  4AYL A;  2WEE A;  1VGU A;  1VM8 A;  5I1F A;  2YQS A;  4AC3 A;  3PNN A;  4HO2 A;  2AM4 A;  4ASJ A;  2D7R A;  1FOA A;  1MP4 A;  4B3U A;  2D7I A;  5IFY A;  1FO8 A;  4EEG A;  2AES A;  2RJ5 A;  2BO4 A;  3TQD A;  5AJO A;  2XWM A;  2UX8 A;  2VS4 A;  4NAI A;  5C4B A;  5C4E A;  5BXC A;  4FCE A;  2PGY A;  2FFU A;  1R82 A;  1E5K A;  1ZI1 A;  5IDT A;  4BMA A;  5CMF X;  2E3D A;  5C1L A;  3DJ4 A;  4Y7F A;  3JUJ A;  2PA4 A;  1HJL A;  4FIX A;  4LW6 A;  2XMH A;  1H4E A;  4EEO A;  2A8U A;  1G8O A;  3ST8 A;  4EE5 A;  2Y4L A;  3QVB A;  2OEG A;  3U0Y A;  5J49 A;  2Z87 A;  1G93 A;  4YS8 A;  1H5S C;  5CMI A;  2GGO A;  1W55 A;  1H7F A;  4O6N A;  5C4D A;  4HO0 A;  1O23 B;  2VD4 A;  5CQL X;  5AJP A;  1JV3 A;  3RSB A;  2JCJ A;  4GBP A;  1VZT A;  1S4N A;  5DDV A;  3OH1 A;  4KC1 A;  3HL3 A;  1H5R B;  2RJ6 A;  3U2U A;  1TZF A;  4P02 A;  2YQJ A;  4LW3 A;  1H5S D;  1ZJ0 A;  2NXV A;  5CMH A;  3PKQ A;  4HO5 A;  3D8V A;  1JYL A;  4FRH A;  1HM0 A;  2JCK A;  1VGW A;  4Q7C A;  1GWW A;  4B2W A;  3NGW A;  5FU0 A;  1FR9 A;  1GWV A;  3BRK X;  2ZU8 A;  1HV9 A;  4BQH A;  3T7N A;  3OAM A;  3V91 A;  1NQI B;  2J0B A;  3E26 A;  2ICY A;  4FRP A;  1VH3 A;  3GUE A;  5C49 A;  3POL A;  1WSZ A;  4ARW A;  1VZU A;  1ZI4 A;  3BCV A;  2VFZ A;  4ASY A;  4FRE A;  2JCL A;  3SXB A;  2AGD A;  2O1F A;  3I0D A;  4R7P A;  1HM8 A;  4IRQ A;  1YP2 A;  1HM9 A;  2QH5 A;  2ZU9 A;  4EE3 A;  1QG8 A;  5CQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...