1NKHB

Crystal structure of lactose synthase complex with udp and manganese
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
272
structure length
272
Chain Sequence
LTACPEESPLLVGPMLIEFNIPVDLKLVEQQNPKVKLGGRYTPMDCISPHKVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGESMFNRAKLLNVGFKEALKDYDYNCFVFSDVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLSINGFPNNYWGWGGEDDDIYNRLAFRGMSVSRPNAVIGKCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYMVLEVQRYPLYTKITVDIGTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase activator/transferase
molecule keywords ALPHA-LACTALBUMIN
publication title Crystal structure of lactose synthase reveals a large conformational change in its catalytic component, the beta-1,4-galactosyltransferase
pubmed doi rcsb
source organism Mus musculus
total genus 96
structure length 272
sequence length 272
chains with identical sequence D
ec nomenclature ec 2.4.1.22: Lactose synthase.
pdb deposition date 2003-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02709 Glyco_transf_7C N-terminal domain of galactosyltransferase
B PF13733 Glyco_transf_7N N-terminal region of glycosyl transferase group 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1nkhB00
1R7TA 1OQMB 3OC9A 1INJA 3I0DA 1S4OA 1HM9A 3OAMA 4XWIA 5CQLX 5L6SA 4FCUA 2YQHA 2RJ0A 1G8OA 3ZLKA 4M28A 4HCQA 4IRQA 1E5KA 4K6RA 4NAIA 1ZCYA 1LZIA 4LW3A 5C49A 4FQWA 2ZU9A 4GBPA 5FUHA 5C1GA 4JD0A 4P00A 2E3DA 5FTVA 2V0LA 2FY7A 1H7LA 2FYDB 1G93A 3I0IX 3USRA 1NKHB 1V82A 3OGZA 4B4BA 1FRWA 1G9RA 2JCJA 3CKJA 3JUKA 5FU0A 1VGUA 1WT0A 1W55A 2X5SA 1PZTA 4B4GA 4M2AA 3V8ZA 2V0KA 1WT1A 1R7UA 3SXBA 2WE9A 3DK5A 4G3QA 1H5SD 5CMHA 2PGYA 2RJ7A 1JVDA 3SXGA 4Y7FA 2OEGA 1JVGA 3JUJA 1XZ6A 2AGDA 1G0RA 1FZWA 3USQA 1QGQA 2AM4A 2XMHA 3U2XA 1W77A 1H5TB 3OH3A 4EEAA 1ZI1A 1H5RB 3RMWA 4HOCA 1VICA 2V0JA 2V0IA 4FROA 3DJ4A 4KNXA 1G97A 1FXJA 1TZFA 1VH3A 4G3PA 1ZI3A 5C4CA 1LL3A 1ZJOA 3V0PA 1ZJ3A 3I0EA 1H4DA 4Y7UA 3ZLLA 1MP3A 4Y9XA 2WVMA 1ZI4A 1H7HA 4R7PA 3SX3A 5CMIA 5FTSA 5C1HA 1NHEB 4FRHA 3U0YA 1OMXA 2XMEA 1QGSA 4Y7GA 1NMMB 2FYAA 1LL0A 2QH5A 4EVWA 2VS4A 3U2TA 2Y7AA 1FO9A 2RJ6A 4AYJA 3FOQA 2X65A 1GA8A 1ZJ1A 3I0FA 3SXCA 4KXOA 1S4PA 3RSBA 2VSIA 5CQOA 5EJZA 2ZU7A 1R80A 4CJ8A 4KPXA 3IOHA 3ZGFA 4M2BA 3T7MA 2BO6A 4KRVA 1FGGA 1O0RA 4YS8A 4FRPA 4KPZA 1LZ7A 3OH1A 3POLA 5HS2A 4FREA 2PA4A 5CMJA 3PNNA 2A8UA 2Q4JA 3V0LA 3V0OA 5L6VA 2E8BA 1LZ0A 3SX5A 1YROB 4NANA 1NF5B 5C38A 2V0HA 2BO8A 3IOJA 3D98A 1FR9A 1R7XA 4ASYA 1H7QA 3T7OA 5IDTA 2X5ZA 5C8RA 1NQIB 2BO7A 3IOIA 2AH9A 2RJ5A 1PZYB 2D7RA 2X60A 1O7QA 2RJ1A 2VS5A 1V84A 4AYLA 2O1GA 2Y4LA 1V83A 4CVHA 1O7OA 1K4VA 3V91A 2QKXA 2YC5A 4CJCA 2RIXA 1R7VA 3I0LA 4B4MA 1G23A 2D0JA 1GX0A 5DDVA 1S4NA 1VGWA 5IFYA 2UX8A 2JCLA 4D48A 1LL2A 4NAKA 4KT7A 3T7NA 3R3IA 2XWMA 5FU8A 5AJNA 3CKNA 2JCOA 5CQPA 2RJ9A 5C3BA 2O1FA 1WT2A 4ASJA 5J49A 2VXLA 4Y7TA 3V8YA 1H4EA 1ZJPA 2I7BA 1HJLA 3FWWA 3V0MA 4EEOA 1HJJA 4J18A 3EE5A 3N9WA 3RMVA 4ECMA 1VH1A 2ZU8A 1ZCVA 1ON8A 4BMAA 2OI6A 4Y64A 4HO0A 3CKQA 2YQCA 1VGZA 1FR8A 1VZTA 2FYCB 5FV9A 2YQSA 2GGOA 2FFVA 4UEGA 3E26A 1Z90A 4Y6NA 5EIYA 2P6WA 2YCMA 4KC1A 1SS9A 1FXOA 3BRKX 2NXVA 1HV9A 1ZCUA 4KC4A 4FRQA 1GWVA 4G87A 2RITA 2WGZA 3ZF8A 2JCKA 5EJ1A 1YP2A 2YC3A 3SXEA 3CKVA 3JTJA 2Y4KA 1GQCA 4C2SA 1VM8A 1MP4A 4FRLA 1ZJ2A 1R81A 1VZXA 1ZI5A 3F1YA 1ZDFA 1QG8A 2P73A 4LW6A 4B5BA 5DDTA 3Q80A 4IRPA 4P02A 3V0QA 3OKRA 2FYBA 3OH4A 1LZJA 1NWGB 2RJ8A 3NGWA 2ICXA 5I1FA 4HO4A 2CU2A 1ZCTA 2OI5A 3D5NA 4HG6A 4D0TA 3PKPA 3I0KA 2ICYA 1GQ9A 4E1KA 1O23B 2YESA 2MZBA 4HO9A 1IIMA 4B3UA 1MC3A 3I0GA 3R2WA 1JV3A 3V0NA 5CMFX 3SXDA 4JISA 4EE4A 1JYKA 1YP3A 3TZTA 1I52A 2XWNA 2OEFA 1MP5A 2Y6PA 3I0JA 4Y62A 4DDZA 3SXAA 3U2VA 3OH2A 1H5SA 4FRDA 1WSZA 2VS3A 3K8EA 4AC3A 1H5SC 4DE7A 2WEEA 4HO8A 2W0WA 1G2VA 2W0VA 1ZDGA 1FWYA 2WVKA 2VFZA 3U2UA 1FO8A 5CMGX 4ZDQA 1WT3A 1H7EA 3DUVA 1H3MA 5C4EA 2D7IA 1VPAA 4FRBA 2I5EA 5CQMX 1GWWA 5CQNX 2I5KA 4D11A 5C47A 4D11C 2AECA 1OMZA 1ZHJA 4KNRA 1EYRA 1TVYA 2Y4JA 1IINA 5JQQA 3PKQA 3ST8A 2O1HA 2AM3A 3I0HA 1HM0A 2A8WA 4G3SA 3D8VA 1HM8A 2VD4A 5C4FA 1FGXA 4EEGA 5C4BA 4B2WA 2P72A 4L41C 5AJPA 2WVLA 3E25A 4FCEA 2AE7A 2VSHA 2RIYA 4HO3A 1YP4A 3CU0A 1EZIA 4EE3A 1TW1A 4EEMA 4Y6UA 4HO6A 4FRAA 1H7GA 4EE5A 3QVBA 5C4DA 3ZGGA 5C48A 4Y7VA 3KIAA 3SX7A 1VGTA 1H7FA 1ZJ0A 2PX7A 1ZIZA 2DPWA 1W57A 5C3AA 4FRMA 2QGIA 3HL3A 2FFUA 4ARWA 3OH0A 3Q7UA 1G3LA 4KQLA 1ON6A 3BCVA 5FYEA 2AM5A 1INIA 1FG5N 5IDSA 3TQDA 2BO4A 4MYBA 1H5TA 3O3PA 1H4CA 1H5RA 4HO5A 1R82A 4M4KA 4BQHA 1G95A 1LVWA 5BXCA 3U0XA 4AAWA 1G1LA 2Z87A 1QWJA 1TW5A 1JYLA 3F1CA 4B2XA 1R7YA 3CGXA 2Z86A 4DECA 2APCA 3K8DA 1WVCA 2RJ4A 2GGQA 2XWLA 2OI7A 4KC2A 5AJOA 3Q4SA 1JV1A 2WAWA 3U2WA 3SX8A 3LW6A 1XHBA 3I0CA 1VZUA 1H7TA 3CKOA 1H5SB 4D0ZA 1FOAA 4CJBA 3V90A 5C36A 1GX4A 2Y4MA 3SPTA 2PGVA 2RIZA 4NALA 2VXMA 2YQJA 4HO2A 4B42A 4MNDA 3GUEA 4Y63A 5C3DA 2AESA 5C1LA 1KWSA
chains in the Genus database with same CATH superfamily
1R7TA 1OQMB 3OC9A 1INJA 3I0DA 1S4OA 1HM9A 3OAMA 4XWIA 5CQLX 5L6SA 4FCUA 2YQHA 2RJ0A 1G8OA 3ZLKA 4M28A 4HCQA 4IRQA 1E5KA 4K6RA 4NAIA 1ZCYA 1LZIA 4LW3A 5C49A 4FQWA 2ZU9A 4GBPA 5FUHA 5C1GA 4JD0A 4P00A 2E3DA 5FTVA 2V0LA 2FY7A 1H7LA 2FYDB 2J0BA 1G93A 3I0IX 3USRA 1NKHB 1V82A 3OGZA 4B4BA 1FRWA 1G9RA 2JCJA 3CKJA 3JUKA 5FU0A 1VGUA 1WT0A 1W55A 2X5SA 1PZTA 4B4GA 4M2AA 3V8ZA 2V0KA 1WT1A 1R7UA 3SXBA 2WE9A 3DK5A 4G3QA 1H5SD 5CMHA 2PGYA 2RJ7A 1JVDA 3SXGA 4Y7FA 2OEGA 1JVGA 3JUJA 1XZ6A 2AGDA 1G0RA 1FZWA 3USQA 1QGQA 2AM4A 2XMHA 3U2XA 1W77A 1H5TB 3OH3A 4EEAA 1ZI1A 1H5RB 3RMWA 4HOCA 1VICA 2V0JA 2V0IA 4FROA 3DJ4A 4KNXA 1G97A 1FXJA 1TZFA 1VH3A 4G3PA 1ZI3A 5C4CA 1LL3A 1ZJOA 3V0PA 1ZJ3A 3I0EA 1H4DA 4Y7UA 3ZLLA 1MP3A 4Y9XA 2WVMA 1ZI4A 1H7HA 4R7PA 3SX3A 5CMIA 5FTSA 5C1HA 1NHEB 4FRHA 3U0YA 1OMXA 2XMEA 1QGSA 4Y7GA 1NMMB 2FYAA 1LL0A 2QH5A 4EVWA 2VS4A 3U2TA 2Y7AA 1FO9A 2RJ6A 4AYJA 3FOQA 2X65A 1GA8A 1ZJ1A 3I0FA 3SXCA 4KXOA 1S4PA 3RSBA 2VSIA 5CQOA 5EJZA 2ZU7A 4FIXA 1R80A 4CJ8A 4KPXA 3IOHA 3ZGFA 4M2BA 3T7MA 2BO6A 4KRVA 1FGGA 1O0RA 2J0AA 4YS8A 4FRPA 4KPZA 1LZ7A 3OH1A 3POLA 5HS2A 4FREA 2PA4A 4O6MA 5CMJA 3PNNA 2A8UA 2Q4JA 3V0LA 3V0OA 5L6VA 2E8BA 1LZ0A 3SX5A 1YROB 4NANA 1NF5B 5C38A 2V0HA 2BO8A 3IOJA 3D98A 1FR9A 1R7XA 4ASYA 1H7QA 3T7OA 5IDTA 2X5ZA 5C8RA 1NQIB 2BO7A 3IOIA 2AH9A 2RJ5A 1PZYB 2D7RA 2X60A 1O7QA 2RJ1A 2VS5A 1V84A 4AYLA 2O1GA 2Y4LA 1V83A 4CVHA 1O7OA 1K4VA 3V91A 2QKXA 2YC5A 4CJCA 2RIXA 1R7VA 3I0LA 4B4MA 1G23A 2D0JA 1GX0A 5DDVA 1S4NA 1VGWA 5IFYA 2UX8A 2JCLA 4D48A 1LL2A 4NAKA 4KT7A 3T7NA 3R3IA 2XWMA 5FU8A 5AJNA 3CKNA 2JCOA 5CQPA 2RJ9A 5C3BA 2O1FA 1WT2A 4ASJA 5J49A 2VXLA 4Y7TA 3V8YA 1H4EA 1ZJPA 2I7BA 1HJLA 3FWWA 3V0MA 4EEOA 1HJJA 4J18A 3EE5A 3N9WA 3RMVA 4ECMA 1VH1A 2ZU8A 1ZCVA 1ON8A 4BMAA 2OI6A 4Y64A 2VK9A 4HO0A 3CKQA 2YQCA 1VGZA 1FR8A 1VZTA 2FYCB 5FV9A 2YQSA 2GGOA 2FFVA 4UEGA 3E26A 1Z90A 4Y6NA 5EIYA 2P6WA 2YCMA 4KC1A 1SS9A 1FXOA 4O6NA 3BRKX 2NXVA 1HV9A 1ZCUA 4KC4A 4FRQA 1GWVA 4G87A 2RITA 2WGZA 3ZF8A 2JCKA 5EJ1A 1YP2A 2YC3A 3SXEA 3CKVA 3JTJA 2Y4KA 1GQCA 4C2SA 1VM8A 1MP4A 4FRLA 1ZJ2A 1R81A 1VZXA 1ZI5A 3F1YA 1ZDFA 1QG8A 2P73A 4LW6A 4B5BA 5DDTA 3Q80A 4IRPA 4P02A 3V0QA 3OKRA 2FYBA 3OH4A 1LZJA 1NWGB 2RJ8A 3NGWA 2ICXA 5I1FA 4HO4A 2CU2A 1ZCTA 2OI5A 3D5NA 4HG6A 4D0TA 3PKPA 3I0KA 2ICYA 1GQ9A 4E1KA 1O23B 2YESA 2MZBA 4HO9A 1IIMA 4B3UA 1MC3A 3I0GA 3R2WA 1JV3A 3V0NA 5CMFX 3SXDA 4JISA 4EE4A 1JYKA 1YP3A 3TZTA 1I52A 2XWNA 2OEFA 1MP5A 2Y6PA 3I0JA 4Y62A 4DDZA 3SXAA 3U2VA 3OH2A 1H5SA 4FRDA 1WSZA 2VS3A 3K8EA 4AC3A 1H5SC 4DE7A 2WEEA 4HO8A 2W0WA 1G2VA 2W0VA 1ZDGA 1FWYA 2WVKA 2VFZA 3U2UA 1FO8A 5CMGX 4ZDQA 1WT3A 1H7EA 3DUVA 1H3MA 5C4EA 2D7IA 1VPAA 4FRBA 2I5EA 5CQMX 1GWWA 5CQNX 2I5KA 2C0NA 4D11A 5C47A 4D11C 2AECA 1OMZA 1ZHJA 4KNRA 4MIXA 1EYRA 1TVYA 2Y4JA 1IINA 5JQQA 3PKQA 3ST8A 2O1HA 2AM3A 3I0HA 1HM0A 2A8WA 4G3SA 3D8VA 1HM8A 2VD4A 5C4FA 1FGXA 4EEGA 5C4BA 4B2WA 2P72A 4L41C 5AJPA 2WVLA 3E25A 4FCEA 2AE7A 2VSHA 2RIYA 4HO3A 1YP4A 3CU0A 1EZIA 4EE3A 1TW1A 4EEMA 4Y6UA 4HO6A 4Q7CA 4FRAA 1H7GA 4EE5A 3QVBA 5C4DA 3ZGGA 5C48A 4Y7VA 3KIAA 3SX7A 1VGTA 1H7FA 1ZJ0A 2PX7A 1ZIZA 2DPWA 1W57A 5C3AA 4FRMA 2QGIA 3HL3A 2FFUA 4ARWA 3OH0A 3Q7UA 1G3LA 4KQLA 1ON6A 3BCVA 5FYEA 2AM5A 1INIA 1FG5N 5IDSA 3TQDA 2BO4A 4MYBA 1H5TA 3O3PA 1H4CA 1H5RA 4HO5A 1R82A 4M4KA 4BQHA 1G95A 1LVWA 5BXCA 3U0XA 4AAWA 1G1LA 2Z87A 1QWJA 1TW5A 1JYLA 3F1CA 4B2XA 1R7YA 3CGXA 2Z86A 4DECA 2APCA 3K8DA 1WVCA 2RJ4A 2GGQA 2XWLA 2OI7A 4KC2A 5D92A 5AJOA 3Q4SA 1JV1A 2WAWA 3U2WA 3SX8A 3LW6A 1XHBA 3I0CA 1VZUA 1H7TA 3CKOA 1H5SB 4D0ZA 1FOAA 4CJBA 3V90A 5C36A 1GX4A 2Y4MA 3SPTA 2PGVA 2RIZA 4NALA 2VXMA 2YQJA 4FIYA 4HO2A 5D91A 4B42A 4MNDA 3GUEA 4Y63A 5C3DA 2AESA 5C1LA 1KWSA
chains in the Genus database with same CATH topology
1R7TA 1OQMB 3OC9A 1INJA 3I0DA 1S4OA 1HM9A 3OAMA 4XWIA 5CQLX 5L6SA 4FCUA 2YQHA 2RJ0A 1G8OA 3ZLKA 4M28A 4HCQA 4IRQA 1E5KA 4K6RA 4NAIA 1ZCYA 1LZIA 4LW3A 5C49A 4FQWA 2ZU9A 4GBPA 5FUHA 5C1GA 4JD0A 4P00A 2E3DA 5FTVA 2V0LA 2FY7A 1H7LA 2FYDB 2J0BA 1G93A 3I0IX 3USRA 1NKHB 1V82A 3OGZA 4B4BA 1FRWA 1G9RA 2JCJA 3CKJA 3JUKA 5FU0A 1VGUA 1WT0A 1W55A 2X5SA 1PZTA 4B4GA 4M2AA 3V8ZA 2V0KA 1WT1A 1R7UA 3SXBA 2WE9A 3DK5A 4G3QA 1H5SD 5CMHA 2PGYA 2RJ7A 1JVDA 3SXGA 4Y7FA 2OEGA 1JVGA 3JUJA 1XZ6A 2AGDA 1G0RA 1FZWA 3USQA 1QGQA 2AM4A 2XMHA 3U2XA 1W77A 1H5TB 3OH3A 4EEAA 1ZI1A 1H5RB 3RMWA 4HOCA 1VICA 2V0JA 2V0IA 4FROA 3DJ4A 4KNXA 1G97A 1FXJA 1TZFA 1VH3A 4G3PA 1ZI3A 5C4CA 1LL3A 1ZJOA 3V0PA 1ZJ3A 3I0EA 1H4DA 4Y7UA 3ZLLA 1MP3A 4Y9XA 2WVMA 1ZI4A 1H7HA 4R7PA 3SX3A 5CMIA 5FTSA 5C1HA 1NHEB 4FRHA 3U0YA 1OMXA 2XMEA 1QGSA 4Y7GA 1NMMB 2FYAA 1LL0A 2QH5A 4EVWA 2VS4A 3U2TA 2Y7AA 1FO9A 2RJ6A 4AYJA 3FOQA 2X65A 1GA8A 1ZJ1A 3I0FA 3SXCA 4KXOA 1S4PA 3RSBA 2VSIA 5CQOA 5EJZA 2ZU7A 4FIXA 1R80A 4CJ8A 4KPXA 3IOHA 3ZGFA 4M2BA 3T7MA 2BO6A 4KRVA 1FGGA 1O0RA 2J0AA 4YS8A 4FRPA 4KPZA 1LZ7A 3OH1A 3POLA 5HS2A 4FREA 2PA4A 4O6MA 5CMJA 3PNNA 2A8UA 2Q4JA 3V0LA 3V0OA 5L6VA 2E8BA 1LZ0A 3SX5A 1YROB 4NANA 1NF5B 5C38A 2V0HA 2BO8A 3IOJA 3D98A 1FR9A 1R7XA 4ASYA 1H7QA 3T7OA 5IDTA 2X5ZA 5C8RA 1NQIB 2BO7A 3IOIA 2AH9A 2RJ5A 1PZYB 2D7RA 2X60A 1O7QA 2RJ1A 2VS5A 1V84A 4AYLA 2O1GA 2Y4LA 1V83A 4CVHA 1O7OA 1K4VA 3V91A 2QKXA 2YC5A 4CJCA 2RIXA 1R7VA 3I0LA 4B4MA 1G23A 2D0JA 1GX0A 5DDVA 1S4NA 1VGWA 5IFYA 2UX8A 2JCLA 4D48A 1LL2A 4NAKA 4KT7A 3T7NA 3R3IA 2XWMA 5FU8A 5AJNA 3CKNA 2JCOA 5CQPA 2RJ9A 5C3BA 2O1FA 1WT2A 4ASJA 5J49A 2VXLA 4Y7TA 3V8YA 1H4EA 1ZJPA 2I7BA 1HJLA 3FWWA 3V0MA 4EEOA 1HJJA 4J18A 3EE5A 3N9WA 3RMVA 4ECMA 1VH1A 2ZU8A 1ZCVA 1ON8A 4BMAA 2OI6A 4Y64A 2VK9A 4HO0A 3CKQA 2YQCA 1VGZA 1FR8A 1VZTA 2FYCB 5FV9A 2YQSA 2GGOA 2FFVA 4UEGA 3E26A 1Z90A 4Y6NA 5EIYA 2P6WA 2YCMA 4KC1A 1SS9A 1FXOA 4O6NA 3BRKX 2NXVA 1HV9A 1ZCUA 4KC4A 4FRQA 1GWVA 4G87A 2RITA 2WGZA 3ZF8A 2JCKA 5EJ1A 1YP2A 2YC3A 3SXEA 3CKVA 3JTJA 2Y4KA 1GQCA 4C2SA 1VM8A 1MP4A 4FRLA 1ZJ2A 1R81A 1VZXA 1ZI5A 3F1YA 1ZDFA 1QG8A 2P73A 4LW6A 4B5BA 5DDTA 3Q80A 4IRPA 4P02A 3V0QA 3OKRA 2FYBA 3OH4A 1LZJA 1NWGB 2RJ8A 3NGWA 2ICXA 5I1FA 4HO4A 2CU2A 1ZCTA 2OI5A 3D5NA 4HG6A 4D0TA 3PKPA 3I0KA 2ICYA 1GQ9A 4E1KA 1O23B 2YESA 2MZBA 4HO9A 1IIMA 4B3UA 1MC3A 3I0GA 3R2WA 1JV3A 3V0NA 5CMFX 3SXDA 4JISA 4EE4A 1JYKA 1YP3A 3TZTA 1I52A 2XWNA 2OEFA 1MP5A 2Y6PA 3I0JA 4Y62A 4DDZA 3SXAA 3U2VA 3OH2A 1H5SA 4FRDA 1WSZA 2VS3A 3K8EA 4AC3A 1H5SC 4DE7A 2WEEA 4HO8A 2W0WA 1G2VA 2W0VA 1ZDGA 1FWYA 2WVKA 2VFZA 3U2UA 1FO8A 5CMGX 4ZDQA 1WT3A 1H7EA 3DUVA 1H3MA 5C4EA 2D7IA 1VPAA 4FRBA 2I5EA 5CQMX 1GWWA 5CQNX 2I5KA 2C0NA 4D11A 5C47A 4D11C 2AECA 1OMZA 1ZHJA 4KNRA 4MIXA 1EYRA 1TVYA 2Y4JA 1IINA 5JQQA 3PKQA 3ST8A 2O1HA 2AM3A 3I0HA 1HM0A 2A8WA 4G3SA 3D8VA 1HM8A 2VD4A 5C4FA 1FGXA 4EEGA 5C4BA 4B2WA 2P72A 4L41C 5AJPA 2WVLA 3E25A 4FCEA 2AE7A 2VSHA 2RIYA 4HO3A 1YP4A 3CU0A 1EZIA 4EE3A 1TW1A 4EEMA 4Y6UA 4HO6A 4Q7CA 4FRAA 1H7GA 4EE5A 3QVBA 5C4DA 3ZGGA 5C48A 4Y7VA 3KIAA 3SX7A 1VGTA 1H7FA 1ZJ0A 2PX7A 1ZIZA 2DPWA 1W57A 5C3AA 4FRMA 2QGIA 3HL3A 2FFUA 4ARWA 3OH0A 3Q7UA 1G3LA 4KQLA 1ON6A 3BCVA 5FYEA 2AM5A 1INIA 1FG5N 5IDSA 3TQDA 2BO4A 4MYBA 1H5TA 3O3PA 1H4CA 1H5RA 4HO5A 1R82A 4M4KA 4BQHA 1G95A 1LVWA 5BXCA 3U0XA 4AAWA 1G1LA 2Z87A 1QWJA 1TW5A 1JYLA 3F1CA 4B2XA 1R7YA 3CGXA 2Z86A 4DECA 2APCA 3K8DA 1WVCA 2RJ4A 2GGQA 2XWLA 2OI7A 4KC2A 5D92A 5AJOA 3Q4SA 1JV1A 2WAWA 3U2WA 3SX8A 3LW6A 1XHBA 3I0CA 1VZUA 1H7TA 3CKOA 1H5SB 4D0ZA 1FOAA 4CJBA 3V90A 5C36A 1GX4A 2Y4MA 3SPTA 2PGVA 2RIZA 4NALA 2VXMA 2YQJA 4FIYA 4HO2A 5D91A 4B42A 4MNDA 3GUEA 4Y63A 5C3DA 2AESA 5C1LA 1KWSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R7T A;  1OQM B;  3OC9 A;  1INJ A;  3I0D A;  1S4O A;  1HM9 A;  3OAM A;  4XWI A;  5CQL X;  5L6S A;  4FCU A;  2YQH A;  2RJ0 A;  1G8O A;  3ZLK A;  4M28 A;  4HCQ A;  4IRQ A;  1E5K A;  4K6R A;  4NAI A;  1ZCY A;  1LZI A;  4LW3 A;  5C49 A;  4FQW A;  2ZU9 A;  4GBP A;  5FUH A;  5C1G A;  4JD0 A;  4P00 A;  2E3D A;  5FTV A;  2V0L A;  2FY7 A;  1H7L A;  2FYD B;  1G93 A;  3I0I X;  3USR A;  1NKH B;  1V82 A;  3OGZ A;  4B4B A;  1FRW A;  1G9R A;  2JCJ A;  3CKJ A;  3JUK A;  5FU0 A;  1VGU A;  1WT0 A;  1W55 A;  2X5S A;  1PZT A;  4B4G A;  4M2A A;  3V8Z A;  2V0K A;  1WT1 A;  1R7U A;  3SXB A;  2WE9 A;  3DK5 A;  4G3Q A;  1H5S D;  5CMH A;  2PGY A;  2RJ7 A;  1JVD A;  3SXG A;  4Y7F A;  2OEG A;  1JVG A;  3JUJ A;  1XZ6 A;  2AGD A;  1G0R A;  1FZW A;  3USQ A;  1QGQ A;  2AM4 A;  2XMH A;  3U2X A;  1W77 A;  1H5T B;  3OH3 A;  4EEA A;  1ZI1 A;  1H5R B;  3RMW A;  4HOC A;  1VIC A;  2V0J A;  2V0I A;  4FRO A;  3DJ4 A;  4KNX A;  1G97 A;  1FXJ A;  1TZF A;  1VH3 A;  4G3P A;  1ZI3 A;  5C4C A;  1LL3 A;  1ZJO A;  3V0P A;  1ZJ3 A;  3I0E A;  1H4D A;  4Y7U A;  3ZLL A;  1MP3 A;  4Y9X A;  2WVM A;  1ZI4 A;  1H7H A;  4R7P A;  3SX3 A;  5CMI A;  5FTS A;  5C1H A;  1NHE B;  4FRH A;  3U0Y A;  1OMX A;  2XME A;  1QGS A;  4Y7G A;  1NMM B;  2FYA A;  1LL0 A;  2QH5 A;  4EVW A;  2VS4 A;  3U2T A;  2Y7A A;  1FO9 A;  2RJ6 A;  4AYJ A;  3FOQ A;  2X65 A;  1GA8 A;  1ZJ1 A;  3I0F A;  3SXC A;  4KXO A;  1S4P A;  3RSB A;  2VSI A;  5CQO A;  5EJZ A;  2ZU7 A;  1R80 A;  4CJ8 A;  4KPX A;  3IOH A;  3ZGF A;  4M2B A;  3T7M A;  2BO6 A;  4KRV A;  1FGG A;  1O0R A;  4YS8 A;  4FRP A;  4KPZ A;  1LZ7 A;  3OH1 A;  3POL A;  5HS2 A;  4FRE A;  2PA4 A;  5CMJ A;  3PNN A;  2A8U A;  2Q4J A;  3V0L A;  3V0O A;  5L6V A;  2E8B A;  1LZ0 A;  3SX5 A;  1YRO B;  4NAN A;  1NF5 B;  5C38 A;  2V0H A;  2BO8 A;  3IOJ A;  3D98 A;  1FR9 A;  1R7X A;  4ASY A;  1H7Q A;  3T7O A;  5IDT A;  2X5Z A;  5C8R A;  1NQI B;  2BO7 A;  3IOI A;  2AH9 A;  2RJ5 A;  1PZY B;  2D7R A;  2X60 A;  1O7Q A;  2RJ1 A;  2VS5 A;  1V84 A;  4AYL A;  2O1G A;  2Y4L A;  1V83 A;  4CVH A;  1O7O A;  1K4V A;  3V91 A;  2QKX A;  2YC5 A;  4CJC A;  2RIX A;  1R7V A;  3I0L A;  4B4M A;  1G23 A;  2D0J A;  1GX0 A;  5DDV A;  1S4N A;  1VGW A;  5IFY A;  2UX8 A;  2JCL A;  4D48 A;  1LL2 A;  4NAK A;  4KT7 A;  3T7N A;  3R3I A;  2XWM A;  5FU8 A;  5AJN A;  3CKN A;  2JCO A;  5CQP A;  2RJ9 A;  5C3B A;  2O1F A;  1WT2 A;  4ASJ A;  5J49 A;  2VXL A;  4Y7T A;  3V8Y A;  1H4E A;  1ZJP A;  2I7B A;  1HJL A;  3FWW A;  3V0M A;  4EEO A;  1HJJ A;  4J18 A;  3EE5 A;  3N9W A;  3RMV A;  4ECM A;  1VH1 A;  2ZU8 A;  1ZCV A;  1ON8 A;  4BMA A;  2OI6 A;  4Y64 A;  4HO0 A;  3CKQ A;  2YQC A;  1VGZ A;  1FR8 A;  1VZT A;  2FYC B;  5FV9 A;  2YQS A;  2GGO A;  2FFV A;  4UEG A;  3E26 A;  1Z90 A;  4Y6N A;  5EIY A;  2P6W A;  2YCM A;  4KC1 A;  1SS9 A;  1FXO A;  3BRK X;  2NXV A;  1HV9 A;  1ZCU A;  4KC4 A;  4FRQ A;  1GWV A;  4G87 A;  2RIT A;  2WGZ A;  3ZF8 A;  2JCK A;  5EJ1 A;  1YP2 A;  2YC3 A;  3SXE A;  3CKV A;  3JTJ A;  2Y4K A;  1GQC A;  4C2S A;  1VM8 A;  1MP4 A;  4FRL A;  1ZJ2 A;  1R81 A;  1VZX A;  1ZI5 A;  3F1Y A;  1ZDF A;  1QG8 A;  2P73 A;  4LW6 A;  4B5B A;  5DDT A;  3Q80 A;  4IRP A;  4P02 A;  3V0Q A;  3OKR A;  2FYB A;  3OH4 A;  1LZJ A;  1NWG B;  2RJ8 A;  3NGW A;  2ICX A;  5I1F A;  4HO4 A;  2CU2 A;  1ZCT A;  2OI5 A;  3D5N A;  4HG6 A;  4D0T A;  3PKP A;  3I0K A;  2ICY A;  1GQ9 A;  4E1K A;  1O23 B;  2YES A;  2MZB A;  4HO9 A;  1IIM A;  4B3U A;  1MC3 A;  3I0G A;  3R2W A;  1JV3 A;  3V0N A;  5CMF X;  3SXD A;  4JIS A;  4EE4 A;  1JYK A;  1YP3 A;  3TZT A;  1I52 A;  2XWN A;  2OEF A;  1MP5 A;  2Y6P A;  3I0J A;  4Y62 A;  4DDZ A;  3SXA A;  3U2V A;  3OH2 A;  1H5S A;  4FRD A;  1WSZ A;  2VS3 A;  3K8E A;  4AC3 A;  1H5S C;  4DE7 A;  2WEE A;  4HO8 A;  2W0W A;  1G2V A;  2W0V A;  1ZDG A;  1FWY A;  2WVK A;  2VFZ A;  3U2U A;  1FO8 A;  5CMG X;  4ZDQ A;  1WT3 A;  1H7E A;  3DUV A;  1H3M A;  5C4E A;  2D7I A;  1VPA A;  4FRB A;  2I5E A;  5CQM X;  1GWW A;  5CQN X;  2I5K A;  4D11 A;  5C47 A;  4D11 C;  2AEC A;  1OMZ A;  1ZHJ A;  4KNR A;  1EYR A;  1TVY A;  2Y4J A;  1IIN A;  5JQQ A;  3PKQ A;  3ST8 A;  2O1H A;  2AM3 A;  3I0H A;  1HM0 A;  2A8W A;  4G3S A;  3D8V A;  1HM8 A;  2VD4 A;  5C4F A;  1FGX A;  4EEG A;  5C4B A;  4B2W A;  2P72 A;  4L41 C;  5AJP A;  2WVL A;  3E25 A;  4FCE A;  2AE7 A;  2VSH A;  2RIY A;  4HO3 A;  1YP4 A;  3CU0 A;  1EZI A;  4EE3 A;  1TW1 A;  4EEM A;  4Y6U A;  4HO6 A;  4FRA A;  1H7G A;  4EE5 A;  3QVB A;  5C4D A;  3ZGG A;  5C48 A;  4Y7V A;  3KIA A;  3SX7 A;  1VGT A;  1H7F A;  1ZJ0 A;  2PX7 A;  1ZIZ A;  2DPW A;  1W57 A;  5C3A A;  4FRM A;  2QGI A;  3HL3 A;  2FFU A;  4ARW A;  3OH0 A;  3Q7U A;  1G3L A;  4KQL A;  1ON6 A;  3BCV A;  5FYE A;  2AM5 A;  1INI A;  1FG5 N;  5IDS A;  3TQD A;  2BO4 A;  4MYB A;  1H5T A;  3O3P A;  1H4C A;  1H5R A;  4HO5 A;  1R82 A;  4M4K A;  4BQH A;  1G95 A;  1LVW A;  5BXC A;  3U0X A;  4AAW A;  1G1L A;  2Z87 A;  1QWJ A;  1TW5 A;  1JYL A;  3F1C A;  4B2X A;  1R7Y A;  3CGX A;  2Z86 A;  4DEC A;  2APC A;  3K8D A;  1WVC A;  2RJ4 A;  2GGQ A;  2XWL A;  2OI7 A;  4KC2 A;  5AJO A;  3Q4S A;  1JV1 A;  2WAW A;  3U2W A;  3SX8 A;  3LW6 A;  1XHB A;  3I0C A;  1VZU A;  1H7T A;  3CKO A;  1H5S B;  4D0Z A;  1FOA A;  4CJB A;  3V90 A;  5C36 A;  1GX4 A;  2Y4M A;  3SPT A;  2PGV A;  2RIZ A;  4NAL A;  2VXM A;  2YQJ A;  4HO2 A;  4B42 A;  4MND A;  3GUE A;  4Y63 A;  5C3D A;  2AES A;  5C1L A;  1KWS A; 
#chains in the Genus database with same CATH topology
 1R7T A;  1OQM B;  3OC9 A;  1INJ A;  3I0D A;  1S4O A;  1HM9 A;  3OAM A;  4XWI A;  5CQL X;  5L6S A;  4FCU A;  2YQH A;  2RJ0 A;  1G8O A;  3ZLK A;  4M28 A;  4HCQ A;  4IRQ A;  1E5K A;  4K6R A;  4NAI A;  1ZCY A;  1LZI A;  4LW3 A;  5C49 A;  4FQW A;  2ZU9 A;  4GBP A;  5FUH A;  5C1G A;  4JD0 A;  4P00 A;  2E3D A;  5FTV A;  2V0L A;  2FY7 A;  1H7L A;  2FYD B;  2J0B A;  1G93 A;  3I0I X;  3USR A;  1NKH B;  1V82 A;  3OGZ A;  4B4B A;  1FRW A;  1G9R A;  2JCJ A;  3CKJ A;  3JUK A;  5FU0 A;  1VGU A;  1WT0 A;  1W55 A;  2X5S A;  1PZT A;  4B4G A;  4M2A A;  3V8Z A;  2V0K A;  1WT1 A;  1R7U A;  3SXB A;  2WE9 A;  3DK5 A;  4G3Q A;  1H5S D;  5CMH A;  2PGY A;  2RJ7 A;  1JVD A;  3SXG A;  4Y7F A;  2OEG A;  1JVG A;  3JUJ A;  1XZ6 A;  2AGD A;  1G0R A;  1FZW A;  3USQ A;  1QGQ A;  2AM4 A;  2XMH A;  3U2X A;  1W77 A;  1H5T B;  3OH3 A;  4EEA A;  1ZI1 A;  1H5R B;  3RMW A;  4HOC A;  1VIC A;  2V0J A;  2V0I A;  4FRO A;  3DJ4 A;  4KNX A;  1G97 A;  1FXJ A;  1TZF A;  1VH3 A;  4G3P A;  1ZI3 A;  5C4C A;  1LL3 A;  1ZJO A;  3V0P A;  1ZJ3 A;  3I0E A;  1H4D A;  4Y7U A;  3ZLL A;  1MP3 A;  4Y9X A;  2WVM A;  1ZI4 A;  1H7H A;  4R7P A;  3SX3 A;  5CMI A;  5FTS A;  5C1H A;  1NHE B;  4FRH A;  3U0Y A;  1OMX A;  2XME A;  1QGS A;  4Y7G A;  1NMM B;  2FYA A;  1LL0 A;  2QH5 A;  4EVW A;  2VS4 A;  3U2T A;  2Y7A A;  1FO9 A;  2RJ6 A;  4AYJ A;  3FOQ A;  2X65 A;  1GA8 A;  1ZJ1 A;  3I0F A;  3SXC A;  4KXO A;  1S4P A;  3RSB A;  2VSI A;  5CQO A;  5EJZ A;  2ZU7 A;  4FIX A;  1R80 A;  4CJ8 A;  4KPX A;  3IOH A;  3ZGF A;  4M2B A;  3T7M A;  2BO6 A;  4KRV A;  1FGG A;  1O0R A;  2J0A A;  4YS8 A;  4FRP A;  4KPZ A;  1LZ7 A;  3OH1 A;  3POL A;  5HS2 A;  4FRE A;  2PA4 A;  4O6M A;  5CMJ A;  3PNN A;  2A8U A;  2Q4J A;  3V0L A;  3V0O A;  5L6V A;  2E8B A;  1LZ0 A;  3SX5 A;  1YRO B;  4NAN A;  1NF5 B;  5C38 A;  2V0H A;  2BO8 A;  3IOJ A;  3D98 A;  1FR9 A;  1R7X A;  4ASY A;  1H7Q A;  3T7O A;  5IDT A;  2X5Z A;  5C8R A;  1NQI B;  2BO7 A;  3IOI A;  2AH9 A;  2RJ5 A;  1PZY B;  2D7R A;  2X60 A;  1O7Q A;  2RJ1 A;  2VS5 A;  1V84 A;  4AYL A;  2O1G A;  2Y4L A;  1V83 A;  4CVH A;  1O7O A;  1K4V A;  3V91 A;  2QKX A;  2YC5 A;  4CJC A;  2RIX A;  1R7V A;  3I0L A;  4B4M A;  1G23 A;  2D0J A;  1GX0 A;  5DDV A;  1S4N A;  1VGW A;  5IFY A;  2UX8 A;  2JCL A;  4D48 A;  1LL2 A;  4NAK A;  4KT7 A;  3T7N A;  3R3I A;  2XWM A;  5FU8 A;  5AJN A;  3CKN A;  2JCO A;  5CQP A;  2RJ9 A;  5C3B A;  2O1F A;  1WT2 A;  4ASJ A;  5J49 A;  2VXL A;  4Y7T A;  3V8Y A;  1H4E A;  1ZJP A;  2I7B A;  1HJL A;  3FWW A;  3V0M A;  4EEO A;  1HJJ A;  4J18 A;  3EE5 A;  3N9W A;  3RMV A;  4ECM A;  1VH1 A;  2ZU8 A;  1ZCV A;  1ON8 A;  4BMA A;  2OI6 A;  4Y64 A;  2VK9 A;  4HO0 A;  3CKQ A;  2YQC A;  1VGZ A;  1FR8 A;  1VZT A;  2FYC B;  5FV9 A;  2YQS A;  2GGO A;  2FFV A;  4UEG A;  3E26 A;  1Z90 A;  4Y6N A;  5EIY A;  2P6W A;  2YCM A;  4KC1 A;  1SS9 A;  1FXO A;  4O6N A;  3BRK X;  2NXV A;  1HV9 A;  1ZCU A;  4KC4 A;  4FRQ A;  1GWV A;  4G87 A;  2RIT A;  2WGZ A;  3ZF8 A;  2JCK A;  5EJ1 A;  1YP2 A;  2YC3 A;  3SXE A;  3CKV A;  3JTJ A;  2Y4K A;  1GQC A;  4C2S A;  1VM8 A;  1MP4 A;  4FRL A;  1ZJ2 A;  1R81 A;  1VZX A;  1ZI5 A;  3F1Y A;  1ZDF A;  1QG8 A;  2P73 A;  4LW6 A;  4B5B A;  5DDT A;  3Q80 A;  4IRP A;  4P02 A;  3V0Q A;  3OKR A;  2FYB A;  3OH4 A;  1LZJ A;  1NWG B;  2RJ8 A;  3NGW A;  2ICX A;  5I1F A;  4HO4 A;  2CU2 A;  1ZCT A;  2OI5 A;  3D5N A;  4HG6 A;  4D0T A;  3PKP A;  3I0K A;  2ICY A;  1GQ9 A;  4E1K A;  1O23 B;  2YES A;  2MZB A;  4HO9 A;  1IIM A;  4B3U A;  1MC3 A;  3I0G A;  3R2W A;  1JV3 A;  3V0N A;  5CMF X;  3SXD A;  4JIS A;  4EE4 A;  1JYK A;  1YP3 A;  3TZT A;  1I52 A;  2XWN A;  2OEF A;  1MP5 A;  2Y6P A;  3I0J A;  4Y62 A;  4DDZ A;  3SXA A;  3U2V A;  3OH2 A;  1H5S A;  4FRD A;  1WSZ A;  2VS3 A;  3K8E A;  4AC3 A;  1H5S C;  4DE7 A;  2WEE A;  4HO8 A;  2W0W A;  1G2V A;  2W0V A;  1ZDG A;  1FWY A;  2WVK A;  2VFZ A;  3U2U A;  1FO8 A;  5CMG X;  4ZDQ A;  1WT3 A;  1H7E A;  3DUV A;  1H3M A;  5C4E A;  2D7I A;  1VPA A;  4FRB A;  2I5E A;  5CQM X;  1GWW A;  5CQN X;  2I5K A;  2C0N A;  4D11 A;  5C47 A;  4D11 C;  2AEC A;  1OMZ A;  1ZHJ A;  4KNR A;  4MIX A;  1EYR A;  1TVY A;  2Y4J A;  1IIN A;  5JQQ A;  3PKQ A;  3ST8 A;  2O1H A;  2AM3 A;  3I0H A;  1HM0 A;  2A8W A;  4G3S A;  3D8V A;  1HM8 A;  2VD4 A;  5C4F A;  1FGX A;  4EEG A;  5C4B A;  4B2W A;  2P72 A;  4L41 C;  5AJP A;  2WVL A;  3E25 A;  4FCE A;  2AE7 A;  2VSH A;  2RIY A;  4HO3 A;  1YP4 A;  3CU0 A;  1EZI A;  4EE3 A;  1TW1 A;  4EEM A;  4Y6U A;  4HO6 A;  4Q7C A;  4FRA A;  1H7G A;  4EE5 A;  3QVB A;  5C4D A;  3ZGG A;  5C48 A;  4Y7V A;  3KIA A;  3SX7 A;  1VGT A;  1H7F A;  1ZJ0 A;  2PX7 A;  1ZIZ A;  2DPW A;  1W57 A;  5C3A A;  4FRM A;  2QGI A;  3HL3 A;  2FFU A;  4ARW A;  3OH0 A;  3Q7U A;  1G3L A;  4KQL A;  1ON6 A;  3BCV A;  5FYE A;  2AM5 A;  1INI A;  1FG5 N;  5IDS A;  3TQD A;  2BO4 A;  4MYB A;  1H5T A;  3O3P A;  1H4C A;  1H5R A;  4HO5 A;  1R82 A;  4M4K A;  4BQH A;  1G95 A;  1LVW A;  5BXC A;  3U0X A;  4AAW A;  1G1L A;  2Z87 A;  1QWJ A;  1TW5 A;  1JYL A;  3F1C A;  4B2X A;  1R7Y A;  3CGX A;  2Z86 A;  4DEC A;  2APC A;  3K8D A;  1WVC A;  2RJ4 A;  2GGQ A;  2XWL A;  2OI7 A;  4KC2 A;  5D92 A;  5AJO A;  3Q4S A;  1JV1 A;  2WAW A;  3U2W A;  3SX8 A;  3LW6 A;  1XHB A;  3I0C A;  1VZU A;  1H7T A;  3CKO A;  1H5S B;  4D0Z A;  1FOA A;  4CJB A;  3V90 A;  5C36 A;  1GX4 A;  2Y4M A;  3SPT A;  2PGV A;  2RIZ A;  4NAL A;  2VXM A;  2YQJ A;  4FIY A;  4HO2 A;  5D91 A;  4B42 A;  4MND A;  3GUE A;  4Y63 A;  5C3D A;  2AES A;  5C1L A;  1KWS A; 
#chains in the Genus database with same CATH homology
 1R7T A;  1OQM B;  3OC9 A;  1INJ A;  3I0D A;  1S4O A;  1HM9 A;  3OAM A;  4XWI A;  5CQL X;  5L6S A;  4FCU A;  2YQH A;  2RJ0 A;  1G8O A;  3ZLK A;  4M28 A;  4HCQ A;  4IRQ A;  1E5K A;  4K6R A;  4NAI A;  1ZCY A;  1LZI A;  4LW3 A;  5C49 A;  4FQW A;  2ZU9 A;  4GBP A;  5FUH A;  5C1G A;  4JD0 A;  4P00 A;  2E3D A;  5FTV A;  2V0L A;  2FY7 A;  1H7L A;  2FYD B;  2J0B A;  1G93 A;  3I0I X;  3USR A;  1NKH B;  1V82 A;  3OGZ A;  4B4B A;  1FRW A;  1G9R A;  2JCJ A;  3CKJ A;  3JUK A;  5FU0 A;  1VGU A;  1WT0 A;  1W55 A;  2X5S A;  1PZT A;  4B4G A;  4M2A A;  3V8Z A;  2V0K A;  1WT1 A;  1R7U A;  3SXB A;  2WE9 A;  3DK5 A;  4G3Q A;  1H5S D;  5CMH A;  2PGY A;  2RJ7 A;  1JVD A;  3SXG A;  4Y7F A;  2OEG A;  1JVG A;  3JUJ A;  1XZ6 A;  2AGD A;  1G0R A;  1FZW A;  3USQ A;  1QGQ A;  2AM4 A;  2XMH A;  3U2X A;  1W77 A;  1H5T B;  3OH3 A;  4EEA A;  1ZI1 A;  1H5R B;  3RMW A;  4HOC A;  1VIC A;  2V0J A;  2V0I A;  4FRO A;  3DJ4 A;  4KNX A;  1G97 A;  1FXJ A;  1TZF A;  1VH3 A;  4G3P A;  1ZI3 A;  5C4C A;  1LL3 A;  1ZJO A;  3V0P A;  1ZJ3 A;  3I0E A;  1H4D A;  4Y7U A;  3ZLL A;  1MP3 A;  4Y9X A;  2WVM A;  1ZI4 A;  1H7H A;  4R7P A;  3SX3 A;  5CMI A;  5FTS A;  5C1H A;  1NHE B;  4FRH A;  3U0Y A;  1OMX A;  2XME A;  1QGS A;  4Y7G A;  1NMM B;  2FYA A;  1LL0 A;  2QH5 A;  4EVW A;  2VS4 A;  3U2T A;  2Y7A A;  1FO9 A;  2RJ6 A;  4AYJ A;  3FOQ A;  2X65 A;  1GA8 A;  1ZJ1 A;  3I0F A;  3SXC A;  4KXO A;  1S4P A;  3RSB A;  2VSI A;  5CQO A;  5EJZ A;  2ZU7 A;  4FIX A;  1R80 A;  4CJ8 A;  4KPX A;  3IOH A;  3ZGF A;  4M2B A;  3T7M A;  2BO6 A;  4KRV A;  1FGG A;  1O0R A;  2J0A A;  4YS8 A;  4FRP A;  4KPZ A;  1LZ7 A;  3OH1 A;  3POL A;  5HS2 A;  4FRE A;  2PA4 A;  4O6M A;  5CMJ A;  3PNN A;  2A8U A;  2Q4J A;  3V0L A;  3V0O A;  5L6V A;  2E8B A;  1LZ0 A;  3SX5 A;  1YRO B;  4NAN A;  1NF5 B;  5C38 A;  2V0H A;  2BO8 A;  3IOJ A;  3D98 A;  1FR9 A;  1R7X A;  4ASY A;  1H7Q A;  3T7O A;  5IDT A;  2X5Z A;  5C8R A;  1NQI B;  2BO7 A;  3IOI A;  2AH9 A;  2RJ5 A;  1PZY B;  2D7R A;  2X60 A;  1O7Q A;  2RJ1 A;  2VS5 A;  1V84 A;  4AYL A;  2O1G A;  2Y4L A;  1V83 A;  4CVH A;  1O7O A;  1K4V A;  3V91 A;  2QKX A;  2YC5 A;  4CJC A;  2RIX A;  1R7V A;  3I0L A;  4B4M A;  1G23 A;  2D0J A;  1GX0 A;  5DDV A;  1S4N A;  1VGW A;  5IFY A;  2UX8 A;  2JCL A;  4D48 A;  1LL2 A;  4NAK A;  4KT7 A;  3T7N A;  3R3I A;  2XWM A;  5FU8 A;  5AJN A;  3CKN A;  2JCO A;  5CQP A;  2RJ9 A;  5C3B A;  2O1F A;  1WT2 A;  4ASJ A;  5J49 A;  2VXL A;  4Y7T A;  3V8Y A;  1H4E A;  1ZJP A;  2I7B A;  1HJL A;  3FWW A;  3V0M A;  4EEO A;  1HJJ A;  4J18 A;  3EE5 A;  3N9W A;  3RMV A;  4ECM A;  1VH1 A;  2ZU8 A;  1ZCV A;  1ON8 A;  4BMA A;  2OI6 A;  4Y64 A;  2VK9 A;  4HO0 A;  3CKQ A;  2YQC A;  1VGZ A;  1FR8 A;  1VZT A;  2FYC B;  5FV9 A;  2YQS A;  2GGO A;  2FFV A;  4UEG A;  3E26 A;  1Z90 A;  4Y6N A;  5EIY A;  2P6W A;  2YCM A;  4KC1 A;  1SS9 A;  1FXO A;  4O6N A;  3BRK X;  2NXV A;  1HV9 A;  1ZCU A;  4KC4 A;  4FRQ A;  1GWV A;  4G87 A;  2RIT A;  2WGZ A;  3ZF8 A;  2JCK A;  5EJ1 A;  1YP2 A;  2YC3 A;  3SXE A;  3CKV A;  3JTJ A;  2Y4K A;  1GQC A;  4C2S A;  1VM8 A;  1MP4 A;  4FRL A;  1ZJ2 A;  1R81 A;  1VZX A;  1ZI5 A;  3F1Y A;  1ZDF A;  1QG8 A;  2P73 A;  4LW6 A;  4B5B A;  5DDT A;  3Q80 A;  4IRP A;  4P02 A;  3V0Q A;  3OKR A;  2FYB A;  3OH4 A;  1LZJ A;  1NWG B;  2RJ8 A;  3NGW A;  2ICX A;  5I1F A;  4HO4 A;  2CU2 A;  1ZCT A;  2OI5 A;  3D5N A;  4HG6 A;  4D0T A;  3PKP A;  3I0K A;  2ICY A;  1GQ9 A;  4E1K A;  1O23 B;  2YES A;  2MZB A;  4HO9 A;  1IIM A;  4B3U A;  1MC3 A;  3I0G A;  3R2W A;  1JV3 A;  3V0N A;  5CMF X;  3SXD A;  4JIS A;  4EE4 A;  1JYK A;  1YP3 A;  3TZT A;  1I52 A;  2XWN A;  2OEF A;  1MP5 A;  2Y6P A;  3I0J A;  4Y62 A;  4DDZ A;  3SXA A;  3U2V A;  3OH2 A;  1H5S A;  4FRD A;  1WSZ A;  2VS3 A;  3K8E A;  4AC3 A;  1H5S C;  4DE7 A;  2WEE A;  4HO8 A;  2W0W A;  1G2V A;  2W0V A;  1ZDG A;  1FWY A;  2WVK A;  2VFZ A;  3U2U A;  1FO8 A;  5CMG X;  4ZDQ A;  1WT3 A;  1H7E A;  3DUV A;  1H3M A;  5C4E A;  2D7I A;  1VPA A;  4FRB A;  2I5E A;  5CQM X;  1GWW A;  5CQN X;  2I5K A;  2C0N A;  4D11 A;  5C47 A;  4D11 C;  2AEC A;  1OMZ A;  1ZHJ A;  4KNR A;  4MIX A;  1EYR A;  1TVY A;  2Y4J A;  1IIN A;  5JQQ A;  3PKQ A;  3ST8 A;  2O1H A;  2AM3 A;  3I0H A;  1HM0 A;  2A8W A;  4G3S A;  3D8V A;  1HM8 A;  2VD4 A;  5C4F A;  1FGX A;  4EEG A;  5C4B A;  4B2W A;  2P72 A;  4L41 C;  5AJP A;  2WVL A;  3E25 A;  4FCE A;  2AE7 A;  2VSH A;  2RIY A;  4HO3 A;  1YP4 A;  3CU0 A;  1EZI A;  4EE3 A;  1TW1 A;  4EEM A;  4Y6U A;  4HO6 A;  4Q7C A;  4FRA A;  1H7G A;  4EE5 A;  3QVB A;  5C4D A;  3ZGG A;  5C48 A;  4Y7V A;  3KIA A;  3SX7 A;  1VGT A;  1H7F A;  1ZJ0 A;  2PX7 A;  1ZIZ A;  2DPW A;  1W57 A;  5C3A A;  4FRM A;  2QGI A;  3HL3 A;  2FFU A;  4ARW A;  3OH0 A;  3Q7U A;  1G3L A;  4KQL A;  1ON6 A;  3BCV A;  5FYE A;  2AM5 A;  1INI A;  1FG5 N;  5IDS A;  3TQD A;  2BO4 A;  4MYB A;  1H5T A;  3O3P A;  1H4C A;  1H5R A;  4HO5 A;  1R82 A;  4M4K A;  4BQH A;  1G95 A;  1LVW A;  5BXC A;  3U0X A;  4AAW A;  1G1L A;  2Z87 A;  1QWJ A;  1TW5 A;  1JYL A;  3F1C A;  4B2X A;  1R7Y A;  3CGX A;  2Z86 A;  4DEC A;  2APC A;  3K8D A;  1WVC A;  2RJ4 A;  2GGQ A;  2XWL A;  2OI7 A;  4KC2 A;  5D92 A;  5AJO A;  3Q4S A;  1JV1 A;  2WAW A;  3U2W A;  3SX8 A;  3LW6 A;  1XHB A;  3I0C A;  1VZU A;  1H7T A;  3CKO A;  1H5S B;  4D0Z A;  1FOA A;  4CJB A;  3V90 A;  5C36 A;  1GX4 A;  2Y4M A;  3SPT A;  2PGV A;  2RIZ A;  4NAL A;  2VXM A;  2YQJ A;  4FIY A;  4HO2 A;  5D91 A;  4B42 A;  4MND A;  3GUE A;  4Y63 A;  5C3D A;  2AES A;  5C1L A;  1KWS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...