3I0HA

Crystal structure of gtb c80s/c196s/c209s unliganded
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
274
structure length
274
Chain Sequence
PQPKVLTPSRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGAYKRWQDVSMRRMEMISDFSERRFLSEVDYLVSVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABO glycosyltransferase
publication title Cysteine-to-serine mutants dramatically reorder the active site of human ABO(H) blood group B glycosyltransferase without affecting activity: structural insights into cooperative substrate binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 94
structure length 274
sequence length 274
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2009-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3i0hA00
1PZTA 1FG5N 1ZCTA 4FRDA 5C47A 4KNXA 4B2WA 3FWWA 1FOAA 4KPXA 3JUJA 2WVMA 1LZ7A 5CMJA 1ZJ0A 1H5RA 5CQLX 4FCEA 1R7XA 2JCOA 2XWLA 1OMZA 3I0DA 4Y64A 1K4VA 5CQMX 2RJ9A 3SXDA 4EE4A 1O7QA 2BO6A 3ST8A 1HM9A 4L41C 2JCJA 2YC3A 2RIYA 2P6WA 4EEAA 4KC4A 1S4PA 3ZLKA 4LW3A 3CKOA 4Y7TA 1H5SA 3SX7A 1IINA 4HO5A 3V8YA 1YROB 1S4NA 1V84A 3CGXA 2I5EA 4HCQA 3RMWA 3I0FA 5C8RA 1LL3A 4ECMA 1VICA 1SS9A 2WE9A 2WEEA 2RJ8A 2AM5A 1ZCYA 5C49A 3DK5A 1O7OA 1G97A 5J49A 2FY7A 1QGSA 4P02A 2XWNA 2VS3A 3OAMA 5C4BA 5C4DA 1LZ0A 2OEFA 4B42A 5EIYA 4BMAA 2XMEA 5AJOA 2X5ZA 1JV1A 4NAKA 3ZGGA 1ZDGA 3BCVA 3E25A 5FV9A 3RSBA 3U2TA 1VGWA 4Y7VA 2GGQA 1ZJ3A 3RMVA 4ZDQA 4HO3A 3SX5A 4JISA 1HM0A 1PZYB 1QG8A 5IDSA 2O1HA 5C4FA 2RITA 5CQNX 4EEGA 5C1LA 3JUKA 1MP3A 4KPZA 3PKQA 1XZ6A 4HG6A 4KNRA 4AC3A 2AH9A 5CMHA 3D5NA 1G3LA 2UX8A 4G3QA 1G95A 1VZUA 4KXOA 5C38A 3PKPA 2O1FA 3I0GA 4E1KA 2V0HA 1JVGA 4NANA 1ZJ2A 2Y4MA 1LL0A 2WVKA 1VH3A 2BO4A 1QGQA 2BO7A 1FXJA 4KT7A 4C2SA 2WAWA 1R7TA 1VZTA 3I0LA 5C48A 2AECA 4CVHA 4FCUA 2VS5A 4B4MA 1W55A 2ICXA 2ZU7A 1GWVA 5C3DA 3ZGFA 3CKNA 4KC1A 5IDTA 5FUHA 1ZI5A 2W0VA 5HS2A 5CMFX 4FRQA 5L6SA 2W0WA 2X5SA 1IIMA 4M28A 4ASJA 1WT2A 3U0YA 3V8ZA 2RIXA 2PGVA 2V0KA 1FR8A 1H7FA 3HL3A 2RJ0A 4B5BA 1GX0A 2FYCB 3DUVA 1W57A 3I0KA 5FTVA 1H7QA 2QGIA 2WVLA 4FRBA 3OH4A 2X60A 1WVCA 3T7MA 3R3IA 2DPWA 5FTSA 1H5TB 3N9WA 1NHEB 3I0JA 2OI7A 1ZCUA 2ZU9A 1FO9A 3BRKX 2YQHA 3PNNA 4D0TA 3CU0A 4YS8A 3OH3A 3OKRA 1QWJA 3CKJA 1EYRA 4D11C 1Z90A 2Y4LA 2A8UA 1WT3A 3SPTA 3ZLLA 2Y4KA 2RJ1A 4B2XA 1MP5A 2YESA 1FZWA 3OGZA 1W77A 4J18A 3SX3A 1VPAA 4Y6NA 1NWGB 1JYKA 2YQCA 1O0RA 1FWYA 1XHBA 1GQCA 1H5SD 2RJ7A 5CMGX 2PGYA 4DECA 2FFVA 1ZI1A 1R7YA 1NQIB 2FYBA 4HO6A 2P72A 4R7PA 3T7OA 4G3SA 3Q7UA 1TZFA 4AAWA 2RJ4A 3V0PA 1H4DA 1WT1A 5DDVA 2GGOA 3V0OA 2OEGA 2VS4A 1JYLA 2JCKA 3OC9A 4EE5A 1TVYA 1R82A 3EE5A 1NMMB 1H7TA 3F1CA 1H3MA 2D7IA 4AYLA 1INIA 2CU2A 1ON6A 1VGZA 2NXVA 4B4GA 5EJZA 4GBPA 1V83A 1ZDFA 2FYAA 2A8WA 1G2VA 2YC5A 2WGZA 1HV9A 1FO8A 2QH5A 5JQQA 3LW6A 2AE7A 4Y7UA 4EEOA 4G87A 4AYJA 4LW6A 3R2WA 2VSIA 2YCMA 2E3DA 1H5RB 3KIAA 4NAIA 4FRPA 4B4BA 2RJ5A 2YQSA 2BO8A 2VSHA 1ZJ1A 2P73A 2Y6PA 2XMHA 3D98A 1WT0A 2FYDB 3O3PA 1KWSA 5C1GA 1HJJA 3CKVA 2VFZA 1H7GA 4CJCA 5C4CA 3TQDA 1H7HA 1ZI4A 5C3BA 1H7LA 3D8VA 1H7EA 2V0IA 1R81A 1H5SB 3I0IX 4KRVA 3V90A 1O23B 2I5KA 3CKQA 1HJLA 4Y6UA 3OH1A 1FR9A 5C36A 4HO0A 3IOJA 3I0HA 1ZCVA 3U2UA 5CMIA 1ZIZA 2FFUA 3JTJA 5AJNA 1G23A 4M4KA 4DE7A 3V0MA 5FYEA 1H5SC 2OI5A 2MZBA 4DDZA 1R80A 5IFYA 1WSZA 4KQLA 4B3UA 2Y4JA 2Z87A 3U2VA 1YP2A 1FGXA 1VH1A 5C4EA 1V82A 4ARWA 3SXAA 3GUEA 4D0ZA 2VD4A 4EEMA 1R7UA 3OH0A 3V0LA 1LL2A 2V0JA 4FROA 2ICYA 1EZIA 3SXBA 2PA4A 2YQJA 5FU8A 2AM4A 1YP3A 4MNDA 1NKHB 3E26A 3NGWA 4HO4A 5AJPA 4CJBA 1MC3A 5I1FA 1G1LA 3I0CA 1GA8A 4M2BA 3I0EA 1FRWA 3U2XA 2I7BA 2RJ6A 1GQ9A 4EVWA 3V0NA 2AESA 3SXGA 2E8BA 3Q4SA 4CJ8A 3SXCA 1ZHJA 1ON8A 4JD0A 1LZIA 1LZJA 1H4EA 4FRHA 1G8OA 4FRMA 4G3PA 2O1GA 1GWWA 3OH2A 1VGTA 4D11A 1FGGA 3U0XA 1G93A 3U2WA 4M2AA 3F1YA 4P00A 1E5KA 3USQA 2D7RA 2Y7AA 2OI6A 4Y63A 1H5TA 1JVDA 1ZI3A 4HO8A 2QKXA 4FREA 2AGDA 1G0RA 3K8EA 4K6RA 1INJA 1TW1A 2VXMA 4IRPA 1TW5A 2APCA 4XWIA 1OQMB 3QVBA 5DDTA 1VZXA 3USRA 3SXEA 5BXCA 1OMXA 2JCLA 1LVWA 3SX8A 1MP4A 4HOCA 5C1HA 4EE3A 3TZTA 4ASYA 2RIZA 2D0JA 4FQWA 3V0QA 4MYBA 1HM8A 4UEGA 2PX7A 2VXLA 4IRQA 3T7NA 3K8DA 2AM3A 5L6VA 5C3AA 4BQHA 3DJ4A 4NALA 4D48A 4FRLA 1S4OA 4KC2A 5CQOA 3ZF8A 4HO2A 4Y7FA 3Q80A 1I52A 2Q4JA 1ZJPA 1H4CA 2XWMA 3POLA 1ZJOA 1NF5B 2X65A 2Z86A 3V91A 1YP4A 4Y9XA 3IOIA 4Y62A 4Y7GA 1JV3A 5CQPA 3IOHA 1VM8A 1R7VA 1GX4A 1VGUA 2V0LA 1G9RA 2ZU8A 3FOQA 1FXOA 4FRAA 5EJ1A 4HO9A 5FU0A
chains in the Genus database with same CATH superfamily
1PZTA 4Q7CA 1FG5N 1ZCTA 4FRDA 5C47A 4KNXA 4B2WA 2C0NA 3FWWA 1FOAA 4KPXA 3JUJA 2WVMA 1LZ7A 5CMJA 1ZJ0A 1H5RA 5CQLX 4FCEA 1R7XA 4FIXA 2JCOA 2XWLA 1OMZA 3I0DA 4Y64A 1K4VA 5CQMX 2RJ9A 3SXDA 4EE4A 1O7QA 2BO6A 3ST8A 1HM9A 4L41C 2JCJA 2YC3A 2RIYA 2P6WA 4EEAA 4KC4A 1S4PA 3ZLKA 4LW3A 3CKOA 4Y7TA 1H5SA 3SX7A 1IINA 4HO5A 3V8YA 2VK9A 1YROB 1S4NA 1V84A 3CGXA 2I5EA 4HCQA 3RMWA 3I0FA 5C8RA 1LL3A 4ECMA 1VICA 1SS9A 2WE9A 2WEEA 2RJ8A 2AM5A 1ZCYA 5C49A 3DK5A 1O7OA 1G97A 5J49A 2FY7A 1QGSA 4MIXA 2XWNA 4P02A 2VS3A 3OAMA 5C4BA 5C4DA 1LZ0A 2OEFA 4B42A 5EIYA 4BMAA 2XMEA 5AJOA 2X5ZA 1JV1A 4NAKA 3ZGGA 1ZDGA 3BCVA 3E25A 5FV9A 3RSBA 3U2TA 1VGWA 4Y7VA 2GGQA 1ZJ3A 3RMVA 4ZDQA 4HO3A 3SX5A 4JISA 1HM0A 1PZYB 1QG8A 4O6NA 5IDSA 2O1HA 5C4FA 2RITA 5CQNX 4EEGA 5C1LA 3JUKA 1MP3A 4KPZA 3PKQA 1XZ6A 4HG6A 4KNRA 4AC3A 2AH9A 5CMHA 3D5NA 1G3LA 2UX8A 4G3QA 1G95A 1VZUA 4KXOA 5C38A 3PKPA 2O1FA 3I0GA 4E1KA 2V0HA 1JVGA 4NANA 1ZJ2A 2Y4MA 1LL0A 2WVKA 1VH3A 2BO4A 1QGQA 2BO7A 1FXJA 4KT7A 4C2SA 2WAWA 1R7TA 1VZTA 3I0LA 5C48A 2AECA 4CVHA 4FCUA 2VS5A 4B4MA 1W55A 2ICXA 2ZU7A 1GWVA 5C3DA 3ZGFA 3CKNA 4KC1A 5IDTA 5FUHA 1ZI5A 2W0VA 5HS2A 5CMFX 4FRQA 5L6SA 2W0WA 2X5SA 1IIMA 4M28A 4ASJA 1WT2A 3U0YA 3V8ZA 2RIXA 2PGVA 2V0KA 1FR8A 1H7FA 3HL3A 2RJ0A 4B5BA 1GX0A 2FYCB 3DUVA 1W57A 3I0KA 5FTVA 1H7QA 2QGIA 2WVLA 4FRBA 3OH4A 2X60A 1WVCA 3T7MA 3R3IA 2DPWA 5FTSA 1H5TB 3N9WA 1NHEB 3I0JA 2OI7A 1ZCUA 2ZU9A 1FO9A 3BRKX 2YQHA 3PNNA 4D0TA 3CU0A 4YS8A 3OH3A 3OKRA 1QWJA 3CKJA 1EYRA 4D11C 1Z90A 2Y4LA 2A8UA 1WT3A 3SPTA 3ZLLA 2Y4KA 2RJ1A 4B2XA 1MP5A 2YESA 1FZWA 3OGZA 1W77A 4J18A 2J0AA 3SX3A 1VPAA 4Y6NA 1NWGB 1JYKA 2YQCA 1O0RA 1FWYA 1XHBA 1GQCA 1H5SD 2RJ7A 5CMGX 2PGYA 4DECA 2FFVA 1ZI1A 1R7YA 1NQIB 2FYBA 4HO6A 2P72A 4R7PA 3T7OA 4G3SA 3Q7UA 1TZFA 4AAWA 2RJ4A 3V0PA 1H4DA 1WT1A 5DDVA 2GGOA 3V0OA 2OEGA 2VS4A 1JYLA 2JCKA 3OC9A 4EE5A 1TVYA 1R82A 3EE5A 1NMMB 1H7TA 3F1CA 1H3MA 2D7IA 4AYLA 1INIA 2CU2A 1ON6A 1VGZA 2NXVA 4B4GA 5EJZA 4GBPA 1V83A 1ZDFA 2FYAA 2A8WA 1G2VA 2YC5A 2WGZA 1HV9A 1FO8A 2QH5A 5JQQA 3LW6A 2AE7A 4Y7UA 4EEOA 4G87A 4AYJA 4LW6A 3R2WA 2VSIA 2YCMA 2E3DA 1H5RB 3KIAA 4NAIA 4FRPA 4B4BA 2RJ5A 2YQSA 2BO8A 2VSHA 1ZJ1A 2P73A 2Y6PA 2XMHA 3D98A 1WT0A 2FYDB 3O3PA 1KWSA 5C1GA 1HJJA 3CKVA 2VFZA 1H7GA 4CJCA 5C4CA 3TQDA 1H7HA 1ZI4A 5C3BA 1H7LA 3D8VA 1H7EA 2V0IA 1R81A 1H5SB 3I0IX 4KRVA 3V90A 1O23B 2I5KA 3CKQA 1HJLA 4Y6UA 3OH1A 1FR9A 5C36A 4HO0A 3IOJA 3I0HA 1ZCVA 3U2UA 5CMIA 1ZIZA 2FFUA 3JTJA 5AJNA 1G23A 4M4KA 4DE7A 3V0MA 5FYEA 1H5SC 2OI5A 2MZBA 4DDZA 1R80A 5IFYA 1WSZA 4KQLA 4B3UA 2Y4JA 2Z87A 3U2VA 1YP2A 1FGXA 1VH1A 5C4EA 1V82A 4ARWA 3SXAA 3GUEA 4D0ZA 2VD4A 4EEMA 1R7UA 3OH0A 3V0LA 1LL2A 2V0JA 4FROA 2ICYA 1EZIA 3SXBA 2PA4A 2YQJA 5FU8A 2AM4A 1YP3A 4MNDA 1NKHB 3E26A 3NGWA 4HO4A 5AJPA 4O6MA 4CJBA 1MC3A 5I1FA 1G1LA 3I0CA 1GA8A 4M2BA 3I0EA 1FRWA 3U2XA 2I7BA 2RJ6A 1GQ9A 4EVWA 3V0NA 2AESA 3SXGA 2E8BA 3Q4SA 4CJ8A 3SXCA 1ZHJA 1ON8A 4JD0A 1LZIA 1LZJA 1H4EA 4FRHA 1G8OA 4FRMA 4G3PA 2O1GA 1GWWA 3OH2A 1VGTA 4D11A 1FGGA 3U0XA 1G93A 3U2WA 4M2AA 3F1YA 4P00A 1E5KA 3USQA 2J0BA 2D7RA 2Y7AA 2OI6A 4Y63A 1H5TA 5D92A 1JVDA 1ZI3A 4HO8A 2QKXA 4FREA 2AGDA 1G0RA 3K8EA 4K6RA 1INJA 1TW1A 2VXMA 4IRPA 1TW5A 2APCA 4XWIA 1OQMB 3QVBA 5DDTA 1VZXA 3USRA 3SXEA 5BXCA 1OMXA 2JCLA 1LVWA 3SX8A 1MP4A 4HOCA 5C1HA 4EE3A 3TZTA 4ASYA 2RIZA 2D0JA 4FQWA 3V0QA 4MYBA 1HM8A 4UEGA 2PX7A 2VXLA 4IRQA 3T7NA 3K8DA 2AM3A 5L6VA 5C3AA 4BQHA 3DJ4A 4NALA 4D48A 4FRLA 1S4OA 5D91A 4KC2A 5CQOA 3ZF8A 4HO2A 4Y7FA 3Q80A 1I52A 2Q4JA 1ZJPA 4FIYA 1H4CA 2XWMA 3POLA 1ZJOA 1NF5B 2X65A 2Z86A 3V91A 1YP4A 4Y9XA 3IOIA 4Y62A 4Y7GA 1JV3A 5CQPA 3IOHA 1VM8A 1R7VA 1GX4A 1VGUA 2V0LA 1G9RA 2ZU8A 3FOQA 1FXOA 4FRAA 5EJ1A 4HO9A 5FU0A
chains in the Genus database with same CATH topology
1PZTA 4Q7CA 1FG5N 1ZCTA 4FRDA 5C47A 4KNXA 4B2WA 2C0NA 3FWWA 1FOAA 4KPXA 3JUJA 2WVMA 1LZ7A 5CMJA 1ZJ0A 1H5RA 5CQLX 4FCEA 1R7XA 4FIXA 2JCOA 2XWLA 1OMZA 3I0DA 4Y64A 1K4VA 5CQMX 2RJ9A 3SXDA 4EE4A 1O7QA 2BO6A 3ST8A 1HM9A 4L41C 2JCJA 2YC3A 2RIYA 2P6WA 4EEAA 4KC4A 1S4PA 3ZLKA 4LW3A 3CKOA 4Y7TA 1H5SA 3SX7A 1IINA 4HO5A 3V8YA 2VK9A 1YROB 1S4NA 1V84A 3CGXA 2I5EA 4HCQA 3RMWA 3I0FA 5C8RA 1LL3A 4ECMA 1VICA 1SS9A 2WE9A 2WEEA 2RJ8A 2AM5A 1ZCYA 5C49A 3DK5A 1O7OA 1G97A 5J49A 2FY7A 1QGSA 4MIXA 2XWNA 4P02A 2VS3A 3OAMA 5C4BA 5C4DA 1LZ0A 2OEFA 4B42A 5EIYA 4BMAA 2XMEA 5AJOA 2X5ZA 1JV1A 4NAKA 3ZGGA 1ZDGA 3BCVA 3E25A 5FV9A 3RSBA 3U2TA 1VGWA 4Y7VA 2GGQA 1ZJ3A 3RMVA 4ZDQA 4HO3A 3SX5A 4JISA 1HM0A 1PZYB 1QG8A 4O6NA 5IDSA 2O1HA 5C4FA 2RITA 5CQNX 4EEGA 5C1LA 3JUKA 1MP3A 4KPZA 3PKQA 1XZ6A 4HG6A 4KNRA 4AC3A 2AH9A 5CMHA 3D5NA 1G3LA 2UX8A 4G3QA 1G95A 1VZUA 4KXOA 5C38A 3PKPA 2O1FA 3I0GA 4E1KA 2V0HA 1JVGA 4NANA 1ZJ2A 2Y4MA 1LL0A 2WVKA 1VH3A 2BO4A 1QGQA 2BO7A 1FXJA 4KT7A 4C2SA 2WAWA 1R7TA 1VZTA 3I0LA 5C48A 2AECA 4CVHA 4FCUA 2VS5A 4B4MA 1W55A 2ICXA 2ZU7A 1GWVA 5C3DA 3ZGFA 3CKNA 4KC1A 5IDTA 5FUHA 1ZI5A 2W0VA 5HS2A 5CMFX 4FRQA 5L6SA 2W0WA 2X5SA 1IIMA 4M28A 4ASJA 1WT2A 3U0YA 3V8ZA 2RIXA 2PGVA 2V0KA 1FR8A 1H7FA 3HL3A 2RJ0A 4B5BA 1GX0A 2FYCB 3DUVA 1W57A 3I0KA 5FTVA 1H7QA 2QGIA 2WVLA 4FRBA 3OH4A 2X60A 1WVCA 3T7MA 3R3IA 2DPWA 5FTSA 1H5TB 3N9WA 1NHEB 3I0JA 2OI7A 1ZCUA 2ZU9A 1FO9A 3BRKX 2YQHA 3PNNA 4D0TA 3CU0A 4YS8A 3OH3A 3OKRA 1QWJA 3CKJA 1EYRA 4D11C 1Z90A 2Y4LA 2A8UA 1WT3A 3SPTA 3ZLLA 2Y4KA 2RJ1A 4B2XA 1MP5A 2YESA 1FZWA 3OGZA 1W77A 4J18A 2J0AA 3SX3A 1VPAA 4Y6NA 1NWGB 1JYKA 2YQCA 1O0RA 1FWYA 1XHBA 1GQCA 1H5SD 2RJ7A 5CMGX 2PGYA 4DECA 2FFVA 1ZI1A 1R7YA 1NQIB 2FYBA 4HO6A 2P72A 4R7PA 3T7OA 4G3SA 3Q7UA 1TZFA 4AAWA 2RJ4A 3V0PA 1H4DA 1WT1A 5DDVA 2GGOA 3V0OA 2OEGA 2VS4A 1JYLA 2JCKA 3OC9A 4EE5A 1TVYA 1R82A 3EE5A 1NMMB 1H7TA 3F1CA 1H3MA 2D7IA 4AYLA 1INIA 2CU2A 1ON6A 1VGZA 2NXVA 4B4GA 5EJZA 4GBPA 1V83A 1ZDFA 2FYAA 2A8WA 1G2VA 2YC5A 2WGZA 1HV9A 1FO8A 2QH5A 5JQQA 3LW6A 2AE7A 4Y7UA 4EEOA 4G87A 4AYJA 4LW6A 3R2WA 2VSIA 2YCMA 2E3DA 1H5RB 3KIAA 4NAIA 4FRPA 4B4BA 2RJ5A 2YQSA 2BO8A 2VSHA 1ZJ1A 2P73A 2Y6PA 2XMHA 3D98A 1WT0A 2FYDB 3O3PA 1KWSA 5C1GA 1HJJA 3CKVA 2VFZA 1H7GA 4CJCA 5C4CA 3TQDA 1H7HA 1ZI4A 5C3BA 1H7LA 3D8VA 1H7EA 2V0IA 1R81A 1H5SB 3I0IX 4KRVA 3V90A 1O23B 2I5KA 3CKQA 1HJLA 4Y6UA 3OH1A 1FR9A 5C36A 4HO0A 3IOJA 3I0HA 1ZCVA 3U2UA 5CMIA 1ZIZA 2FFUA 3JTJA 5AJNA 1G23A 4M4KA 4DE7A 3V0MA 5FYEA 1H5SC 2OI5A 2MZBA 4DDZA 1R80A 5IFYA 1WSZA 4KQLA 4B3UA 2Y4JA 2Z87A 3U2VA 1YP2A 1FGXA 1VH1A 5C4EA 1V82A 4ARWA 3SXAA 3GUEA 4D0ZA 2VD4A 4EEMA 1R7UA 3OH0A 3V0LA 1LL2A 2V0JA 4FROA 2ICYA 1EZIA 3SXBA 2PA4A 2YQJA 5FU8A 2AM4A 1YP3A 4MNDA 1NKHB 3E26A 3NGWA 4HO4A 5AJPA 4O6MA 4CJBA 1MC3A 5I1FA 1G1LA 3I0CA 1GA8A 4M2BA 3I0EA 1FRWA 3U2XA 2I7BA 2RJ6A 1GQ9A 4EVWA 3V0NA 2AESA 3SXGA 2E8BA 3Q4SA 4CJ8A 3SXCA 1ZHJA 1ON8A 4JD0A 1LZIA 1LZJA 1H4EA 4FRHA 1G8OA 4FRMA 4G3PA 2O1GA 1GWWA 3OH2A 1VGTA 4D11A 1FGGA 3U0XA 1G93A 3U2WA 4M2AA 3F1YA 4P00A 1E5KA 3USQA 2J0BA 2D7RA 2Y7AA 2OI6A 4Y63A 1H5TA 5D92A 1JVDA 1ZI3A 4HO8A 2QKXA 4FREA 2AGDA 1G0RA 3K8EA 4K6RA 1INJA 1TW1A 2VXMA 4IRPA 1TW5A 2APCA 4XWIA 1OQMB 3QVBA 5DDTA 1VZXA 3USRA 3SXEA 5BXCA 1OMXA 2JCLA 1LVWA 3SX8A 1MP4A 4HOCA 5C1HA 4EE3A 3TZTA 4ASYA 2RIZA 2D0JA 4FQWA 3V0QA 4MYBA 1HM8A 4UEGA 2PX7A 2VXLA 4IRQA 3T7NA 3K8DA 2AM3A 5L6VA 5C3AA 4BQHA 3DJ4A 4NALA 4D48A 4FRLA 1S4OA 5D91A 4KC2A 5CQOA 3ZF8A 4HO2A 4Y7FA 3Q80A 1I52A 2Q4JA 1ZJPA 4FIYA 1H4CA 2XWMA 3POLA 1ZJOA 1NF5B 2X65A 2Z86A 3V91A 1YP4A 4Y9XA 3IOIA 4Y62A 4Y7GA 1JV3A 5CQPA 3IOHA 1VM8A 1R7VA 1GX4A 1VGUA 2V0LA 1G9RA 2ZU8A 3FOQA 1FXOA 4FRAA 5EJ1A 4HO9A 5FU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PZT A;  1FG5 N;  1ZCT A;  4FRD A;  5C47 A;  4KNX A;  4B2W A;  3FWW A;  1FOA A;  4KPX A;  3JUJ A;  2WVM A;  1LZ7 A;  5CMJ A;  1ZJ0 A;  1H5R A;  5CQL X;  4FCE A;  1R7X A;  2JCO A;  2XWL A;  1OMZ A;  3I0D A;  4Y64 A;  1K4V A;  5CQM X;  2RJ9 A;  3SXD A;  4EE4 A;  1O7Q A;  2BO6 A;  3ST8 A;  1HM9 A;  4L41 C;  2JCJ A;  2YC3 A;  2RIY A;  2P6W A;  4EEA A;  4KC4 A;  1S4P A;  3ZLK A;  4LW3 A;  3CKO A;  4Y7T A;  1H5S A;  3SX7 A;  1IIN A;  4HO5 A;  3V8Y A;  1YRO B;  1S4N A;  1V84 A;  3CGX A;  2I5E A;  4HCQ A;  3RMW A;  3I0F A;  5C8R A;  1LL3 A;  4ECM A;  1VIC A;  1SS9 A;  2WE9 A;  2WEE A;  2RJ8 A;  2AM5 A;  1ZCY A;  5C49 A;  3DK5 A;  1O7O A;  1G97 A;  5J49 A;  2FY7 A;  1QGS A;  4P02 A;  2XWN A;  2VS3 A;  3OAM A;  5C4B A;  5C4D A;  1LZ0 A;  2OEF A;  4B42 A;  5EIY A;  4BMA A;  2XME A;  5AJO A;  2X5Z A;  1JV1 A;  4NAK A;  3ZGG A;  1ZDG A;  3BCV A;  3E25 A;  5FV9 A;  3RSB A;  3U2T A;  1VGW A;  4Y7V A;  2GGQ A;  1ZJ3 A;  3RMV A;  4ZDQ A;  4HO3 A;  3SX5 A;  4JIS A;  1HM0 A;  1PZY B;  1QG8 A;  5IDS A;  2O1H A;  5C4F A;  2RIT A;  5CQN X;  4EEG A;  5C1L A;  3JUK A;  1MP3 A;  4KPZ A;  3PKQ A;  1XZ6 A;  4HG6 A;  4KNR A;  4AC3 A;  2AH9 A;  5CMH A;  3D5N A;  1G3L A;  2UX8 A;  4G3Q A;  1G95 A;  1VZU A;  4KXO A;  5C38 A;  3PKP A;  2O1F A;  3I0G A;  4E1K A;  2V0H A;  1JVG A;  4NAN A;  1ZJ2 A;  2Y4M A;  1LL0 A;  2WVK A;  1VH3 A;  2BO4 A;  1QGQ A;  2BO7 A;  1FXJ A;  4KT7 A;  4C2S A;  2WAW A;  1R7T A;  1VZT A;  3I0L A;  5C48 A;  2AEC A;  4CVH A;  4FCU A;  2VS5 A;  4B4M A;  1W55 A;  2ICX A;  2ZU7 A;  1GWV A;  5C3D A;  3ZGF A;  3CKN A;  4KC1 A;  5IDT A;  5FUH A;  1ZI5 A;  2W0V A;  5HS2 A;  5CMF X;  4FRQ A;  5L6S A;  2W0W A;  2X5S A;  1IIM A;  4M28 A;  4ASJ A;  1WT2 A;  3U0Y A;  3V8Z A;  2RIX A;  2PGV A;  2V0K A;  1FR8 A;  1H7F A;  3HL3 A;  2RJ0 A;  4B5B A;  1GX0 A;  2FYC B;  3DUV A;  1W57 A;  3I0K A;  5FTV A;  1H7Q A;  2QGI A;  2WVL A;  4FRB A;  3OH4 A;  2X60 A;  1WVC A;  3T7M A;  3R3I A;  2DPW A;  5FTS A;  1H5T B;  3N9W A;  1NHE B;  3I0J A;  2OI7 A;  1ZCU A;  2ZU9 A;  1FO9 A;  3BRK X;  2YQH A;  3PNN A;  4D0T A;  3CU0 A;  4YS8 A;  3OH3 A;  3OKR A;  1QWJ A;  3CKJ A;  1EYR A;  4D11 C;  1Z90 A;  2Y4L A;  2A8U A;  1WT3 A;  3SPT A;  3ZLL A;  2Y4K A;  2RJ1 A;  4B2X A;  1MP5 A;  2YES A;  1FZW A;  3OGZ A;  1W77 A;  4J18 A;  3SX3 A;  1VPA A;  4Y6N A;  1NWG B;  1JYK A;  2YQC A;  1O0R A;  1FWY A;  1XHB A;  1GQC A;  1H5S D;  2RJ7 A;  5CMG X;  2PGY A;  4DEC A;  2FFV A;  1ZI1 A;  1R7Y A;  1NQI B;  2FYB A;  4HO6 A;  2P72 A;  4R7P A;  3T7O A;  4G3S A;  3Q7U A;  1TZF A;  4AAW A;  2RJ4 A;  3V0P A;  1H4D A;  1WT1 A;  5DDV A;  2GGO A;  3V0O A;  2OEG A;  2VS4 A;  1JYL A;  2JCK A;  3OC9 A;  4EE5 A;  1TVY A;  1R82 A;  3EE5 A;  1NMM B;  1H7T A;  3F1C A;  1H3M A;  2D7I A;  4AYL A;  1INI A;  2CU2 A;  1ON6 A;  1VGZ A;  2NXV A;  4B4G A;  5EJZ A;  4GBP A;  1V83 A;  1ZDF A;  2FYA A;  2A8W A;  1G2V A;  2YC5 A;  2WGZ A;  1HV9 A;  1FO8 A;  2QH5 A;  5JQQ A;  3LW6 A;  2AE7 A;  4Y7U A;  4EEO A;  4G87 A;  4AYJ A;  4LW6 A;  3R2W A;  2VSI A;  2YCM A;  2E3D A;  1H5R B;  3KIA A;  4NAI A;  4FRP A;  4B4B A;  2RJ5 A;  2YQS A;  2BO8 A;  2VSH A;  1ZJ1 A;  2P73 A;  2Y6P A;  2XMH A;  3D98 A;  1WT0 A;  2FYD B;  3O3P A;  1KWS A;  5C1G A;  1HJJ A;  3CKV A;  2VFZ A;  1H7G A;  4CJC A;  5C4C A;  3TQD A;  1H7H A;  1ZI4 A;  5C3B A;  1H7L A;  3D8V A;  1H7E A;  2V0I A;  1R81 A;  1H5S B;  3I0I X;  4KRV A;  3V90 A;  1O23 B;  2I5K A;  3CKQ A;  1HJL A;  4Y6U A;  3OH1 A;  1FR9 A;  5C36 A;  4HO0 A;  3IOJ A;  3I0H A;  1ZCV A;  3U2U A;  5CMI A;  1ZIZ A;  2FFU A;  3JTJ A;  5AJN A;  1G23 A;  4M4K A;  4DE7 A;  3V0M A;  5FYE A;  1H5S C;  2OI5 A;  2MZB A;  4DDZ A;  1R80 A;  5IFY A;  1WSZ A;  4KQL A;  4B3U A;  2Y4J A;  2Z87 A;  3U2V A;  1YP2 A;  1FGX A;  1VH1 A;  5C4E A;  1V82 A;  4ARW A;  3SXA A;  3GUE A;  4D0Z A;  2VD4 A;  4EEM A;  1R7U A;  3OH0 A;  3V0L A;  1LL2 A;  2V0J A;  4FRO A;  2ICY A;  1EZI A;  3SXB A;  2PA4 A;  2YQJ A;  5FU8 A;  2AM4 A;  1YP3 A;  4MND A;  1NKH B;  3E26 A;  3NGW A;  4HO4 A;  5AJP A;  4CJB A;  1MC3 A;  5I1F A;  1G1L A;  3I0C A;  1GA8 A;  4M2B A;  3I0E A;  1FRW A;  3U2X A;  2I7B A;  2RJ6 A;  1GQ9 A;  4EVW A;  3V0N A;  2AES A;  3SXG A;  2E8B A;  3Q4S A;  4CJ8 A;  3SXC A;  1ZHJ A;  1ON8 A;  4JD0 A;  1LZI A;  1LZJ A;  1H4E A;  4FRH A;  1G8O A;  4FRM A;  4G3P A;  2O1G A;  1GWW A;  3OH2 A;  1VGT A;  4D11 A;  1FGG A;  3U0X A;  1G93 A;  3U2W A;  4M2A A;  3F1Y A;  4P00 A;  1E5K A;  3USQ A;  2D7R A;  2Y7A A;  2OI6 A;  4Y63 A;  1H5T A;  1JVD A;  1ZI3 A;  4HO8 A;  2QKX A;  4FRE A;  2AGD A;  1G0R A;  3K8E A;  4K6R A;  1INJ A;  1TW1 A;  2VXM A;  4IRP A;  1TW5 A;  2APC A;  4XWI A;  1OQM B;  3QVB A;  5DDT A;  1VZX A;  3USR A;  3SXE A;  5BXC A;  1OMX A;  2JCL A;  1LVW A;  3SX8 A;  1MP4 A;  4HOC A;  5C1H A;  4EE3 A;  3TZT A;  4ASY A;  2RIZ A;  2D0J A;  4FQW A;  3V0Q A;  4MYB A;  1HM8 A;  4UEG A;  2PX7 A;  2VXL A;  4IRQ A;  3T7N A;  3K8D A;  2AM3 A;  5L6V A;  5C3A A;  4BQH A;  3DJ4 A;  4NAL A;  4D48 A;  4FRL A;  1S4O A;  4KC2 A;  5CQO A;  3ZF8 A;  4HO2 A;  4Y7F A;  3Q80 A;  1I52 A;  2Q4J A;  1ZJP A;  1H4C A;  2XWM A;  3POL A;  1ZJO A;  1NF5 B;  2X65 A;  2Z86 A;  3V91 A;  1YP4 A;  4Y9X A;  3IOI A;  4Y62 A;  4Y7G A;  1JV3 A;  5CQP A;  3IOH A;  1VM8 A;  1R7V A;  1GX4 A;  1VGU A;  2V0L A;  1G9R A;  2ZU8 A;  3FOQ A;  1FXO A;  4FRA A;  5EJ1 A;  4HO9 A;  5FU0 A; 
#chains in the Genus database with same CATH topology
 1PZT A;  4Q7C A;  1FG5 N;  1ZCT A;  4FRD A;  5C47 A;  4KNX A;  4B2W A;  2C0N A;  3FWW A;  1FOA A;  4KPX A;  3JUJ A;  2WVM A;  1LZ7 A;  5CMJ A;  1ZJ0 A;  1H5R A;  5CQL X;  4FCE A;  1R7X A;  4FIX A;  2JCO A;  2XWL A;  1OMZ A;  3I0D A;  4Y64 A;  1K4V A;  5CQM X;  2RJ9 A;  3SXD A;  4EE4 A;  1O7Q A;  2BO6 A;  3ST8 A;  1HM9 A;  4L41 C;  2JCJ A;  2YC3 A;  2RIY A;  2P6W A;  4EEA A;  4KC4 A;  1S4P A;  3ZLK A;  4LW3 A;  3CKO A;  4Y7T A;  1H5S A;  3SX7 A;  1IIN A;  4HO5 A;  3V8Y A;  2VK9 A;  1YRO B;  1S4N A;  1V84 A;  3CGX A;  2I5E A;  4HCQ A;  3RMW A;  3I0F A;  5C8R A;  1LL3 A;  4ECM A;  1VIC A;  1SS9 A;  2WE9 A;  2WEE A;  2RJ8 A;  2AM5 A;  1ZCY A;  5C49 A;  3DK5 A;  1O7O A;  1G97 A;  5J49 A;  2FY7 A;  1QGS A;  4MIX A;  2XWN A;  4P02 A;  2VS3 A;  3OAM A;  5C4B A;  5C4D A;  1LZ0 A;  2OEF A;  4B42 A;  5EIY A;  4BMA A;  2XME A;  5AJO A;  2X5Z A;  1JV1 A;  4NAK A;  3ZGG A;  1ZDG A;  3BCV A;  3E25 A;  5FV9 A;  3RSB A;  3U2T A;  1VGW A;  4Y7V A;  2GGQ A;  1ZJ3 A;  3RMV A;  4ZDQ A;  4HO3 A;  3SX5 A;  4JIS A;  1HM0 A;  1PZY B;  1QG8 A;  4O6N A;  5IDS A;  2O1H A;  5C4F A;  2RIT A;  5CQN X;  4EEG A;  5C1L A;  3JUK A;  1MP3 A;  4KPZ A;  3PKQ A;  1XZ6 A;  4HG6 A;  4KNR A;  4AC3 A;  2AH9 A;  5CMH A;  3D5N A;  1G3L A;  2UX8 A;  4G3Q A;  1G95 A;  1VZU A;  4KXO A;  5C38 A;  3PKP A;  2O1F A;  3I0G A;  4E1K A;  2V0H A;  1JVG A;  4NAN A;  1ZJ2 A;  2Y4M A;  1LL0 A;  2WVK A;  1VH3 A;  2BO4 A;  1QGQ A;  2BO7 A;  1FXJ A;  4KT7 A;  4C2S A;  2WAW A;  1R7T A;  1VZT A;  3I0L A;  5C48 A;  2AEC A;  4CVH A;  4FCU A;  2VS5 A;  4B4M A;  1W55 A;  2ICX A;  2ZU7 A;  1GWV A;  5C3D A;  3ZGF A;  3CKN A;  4KC1 A;  5IDT A;  5FUH A;  1ZI5 A;  2W0V A;  5HS2 A;  5CMF X;  4FRQ A;  5L6S A;  2W0W A;  2X5S A;  1IIM A;  4M28 A;  4ASJ A;  1WT2 A;  3U0Y A;  3V8Z A;  2RIX A;  2PGV A;  2V0K A;  1FR8 A;  1H7F A;  3HL3 A;  2RJ0 A;  4B5B A;  1GX0 A;  2FYC B;  3DUV A;  1W57 A;  3I0K A;  5FTV A;  1H7Q A;  2QGI A;  2WVL A;  4FRB A;  3OH4 A;  2X60 A;  1WVC A;  3T7M A;  3R3I A;  2DPW A;  5FTS A;  1H5T B;  3N9W A;  1NHE B;  3I0J A;  2OI7 A;  1ZCU A;  2ZU9 A;  1FO9 A;  3BRK X;  2YQH A;  3PNN A;  4D0T A;  3CU0 A;  4YS8 A;  3OH3 A;  3OKR A;  1QWJ A;  3CKJ A;  1EYR A;  4D11 C;  1Z90 A;  2Y4L A;  2A8U A;  1WT3 A;  3SPT A;  3ZLL A;  2Y4K A;  2RJ1 A;  4B2X A;  1MP5 A;  2YES A;  1FZW A;  3OGZ A;  1W77 A;  4J18 A;  2J0A A;  3SX3 A;  1VPA A;  4Y6N A;  1NWG B;  1JYK A;  2YQC A;  1O0R A;  1FWY A;  1XHB A;  1GQC A;  1H5S D;  2RJ7 A;  5CMG X;  2PGY A;  4DEC A;  2FFV A;  1ZI1 A;  1R7Y A;  1NQI B;  2FYB A;  4HO6 A;  2P72 A;  4R7P A;  3T7O A;  4G3S A;  3Q7U A;  1TZF A;  4AAW A;  2RJ4 A;  3V0P A;  1H4D A;  1WT1 A;  5DDV A;  2GGO A;  3V0O A;  2OEG A;  2VS4 A;  1JYL A;  2JCK A;  3OC9 A;  4EE5 A;  1TVY A;  1R82 A;  3EE5 A;  1NMM B;  1H7T A;  3F1C A;  1H3M A;  2D7I A;  4AYL A;  1INI A;  2CU2 A;  1ON6 A;  1VGZ A;  2NXV A;  4B4G A;  5EJZ A;  4GBP A;  1V83 A;  1ZDF A;  2FYA A;  2A8W A;  1G2V A;  2YC5 A;  2WGZ A;  1HV9 A;  1FO8 A;  2QH5 A;  5JQQ A;  3LW6 A;  2AE7 A;  4Y7U A;  4EEO A;  4G87 A;  4AYJ A;  4LW6 A;  3R2W A;  2VSI A;  2YCM A;  2E3D A;  1H5R B;  3KIA A;  4NAI A;  4FRP A;  4B4B A;  2RJ5 A;  2YQS A;  2BO8 A;  2VSH A;  1ZJ1 A;  2P73 A;  2Y6P A;  2XMH A;  3D98 A;  1WT0 A;  2FYD B;  3O3P A;  1KWS A;  5C1G A;  1HJJ A;  3CKV A;  2VFZ A;  1H7G A;  4CJC A;  5C4C A;  3TQD A;  1H7H A;  1ZI4 A;  5C3B A;  1H7L A;  3D8V A;  1H7E A;  2V0I A;  1R81 A;  1H5S B;  3I0I X;  4KRV A;  3V90 A;  1O23 B;  2I5K A;  3CKQ A;  1HJL A;  4Y6U A;  3OH1 A;  1FR9 A;  5C36 A;  4HO0 A;  3IOJ A;  3I0H A;  1ZCV A;  3U2U A;  5CMI A;  1ZIZ A;  2FFU A;  3JTJ A;  5AJN A;  1G23 A;  4M4K A;  4DE7 A;  3V0M A;  5FYE A;  1H5S C;  2OI5 A;  2MZB A;  4DDZ A;  1R80 A;  5IFY A;  1WSZ A;  4KQL A;  4B3U A;  2Y4J A;  2Z87 A;  3U2V A;  1YP2 A;  1FGX A;  1VH1 A;  5C4E A;  1V82 A;  4ARW A;  3SXA A;  3GUE A;  4D0Z A;  2VD4 A;  4EEM A;  1R7U A;  3OH0 A;  3V0L A;  1LL2 A;  2V0J A;  4FRO A;  2ICY A;  1EZI A;  3SXB A;  2PA4 A;  2YQJ A;  5FU8 A;  2AM4 A;  1YP3 A;  4MND A;  1NKH B;  3E26 A;  3NGW A;  4HO4 A;  5AJP A;  4O6M A;  4CJB A;  1MC3 A;  5I1F A;  1G1L A;  3I0C A;  1GA8 A;  4M2B A;  3I0E A;  1FRW A;  3U2X A;  2I7B A;  2RJ6 A;  1GQ9 A;  4EVW A;  3V0N A;  2AES A;  3SXG A;  2E8B A;  3Q4S A;  4CJ8 A;  3SXC A;  1ZHJ A;  1ON8 A;  4JD0 A;  1LZI A;  1LZJ A;  1H4E A;  4FRH A;  1G8O A;  4FRM A;  4G3P A;  2O1G A;  1GWW A;  3OH2 A;  1VGT A;  4D11 A;  1FGG A;  3U0X A;  1G93 A;  3U2W A;  4M2A A;  3F1Y A;  4P00 A;  1E5K A;  3USQ A;  2J0B A;  2D7R A;  2Y7A A;  2OI6 A;  4Y63 A;  1H5T A;  5D92 A;  1JVD A;  1ZI3 A;  4HO8 A;  2QKX A;  4FRE A;  2AGD A;  1G0R A;  3K8E A;  4K6R A;  1INJ A;  1TW1 A;  2VXM A;  4IRP A;  1TW5 A;  2APC A;  4XWI A;  1OQM B;  3QVB A;  5DDT A;  1VZX A;  3USR A;  3SXE A;  5BXC A;  1OMX A;  2JCL A;  1LVW A;  3SX8 A;  1MP4 A;  4HOC A;  5C1H A;  4EE3 A;  3TZT A;  4ASY A;  2RIZ A;  2D0J A;  4FQW A;  3V0Q A;  4MYB A;  1HM8 A;  4UEG A;  2PX7 A;  2VXL A;  4IRQ A;  3T7N A;  3K8D A;  2AM3 A;  5L6V A;  5C3A A;  4BQH A;  3DJ4 A;  4NAL A;  4D48 A;  4FRL A;  1S4O A;  5D91 A;  4KC2 A;  5CQO A;  3ZF8 A;  4HO2 A;  4Y7F A;  3Q80 A;  1I52 A;  2Q4J A;  1ZJP A;  4FIY A;  1H4C A;  2XWM A;  3POL A;  1ZJO A;  1NF5 B;  2X65 A;  2Z86 A;  3V91 A;  1YP4 A;  4Y9X A;  3IOI A;  4Y62 A;  4Y7G A;  1JV3 A;  5CQP A;  3IOH A;  1VM8 A;  1R7V A;  1GX4 A;  1VGU A;  2V0L A;  1G9R A;  2ZU8 A;  3FOQ A;  1FXO A;  4FRA A;  5EJ1 A;  4HO9 A;  5FU0 A; 
#chains in the Genus database with same CATH homology
 1PZT A;  4Q7C A;  1FG5 N;  1ZCT A;  4FRD A;  5C47 A;  4KNX A;  4B2W A;  2C0N A;  3FWW A;  1FOA A;  4KPX A;  3JUJ A;  2WVM A;  1LZ7 A;  5CMJ A;  1ZJ0 A;  1H5R A;  5CQL X;  4FCE A;  1R7X A;  4FIX A;  2JCO A;  2XWL A;  1OMZ A;  3I0D A;  4Y64 A;  1K4V A;  5CQM X;  2RJ9 A;  3SXD A;  4EE4 A;  1O7Q A;  2BO6 A;  3ST8 A;  1HM9 A;  4L41 C;  2JCJ A;  2YC3 A;  2RIY A;  2P6W A;  4EEA A;  4KC4 A;  1S4P A;  3ZLK A;  4LW3 A;  3CKO A;  4Y7T A;  1H5S A;  3SX7 A;  1IIN A;  4HO5 A;  3V8Y A;  2VK9 A;  1YRO B;  1S4N A;  1V84 A;  3CGX A;  2I5E A;  4HCQ A;  3RMW A;  3I0F A;  5C8R A;  1LL3 A;  4ECM A;  1VIC A;  1SS9 A;  2WE9 A;  2WEE A;  2RJ8 A;  2AM5 A;  1ZCY A;  5C49 A;  3DK5 A;  1O7O A;  1G97 A;  5J49 A;  2FY7 A;  1QGS A;  4MIX A;  2XWN A;  4P02 A;  2VS3 A;  3OAM A;  5C4B A;  5C4D A;  1LZ0 A;  2OEF A;  4B42 A;  5EIY A;  4BMA A;  2XME A;  5AJO A;  2X5Z A;  1JV1 A;  4NAK A;  3ZGG A;  1ZDG A;  3BCV A;  3E25 A;  5FV9 A;  3RSB A;  3U2T A;  1VGW A;  4Y7V A;  2GGQ A;  1ZJ3 A;  3RMV A;  4ZDQ A;  4HO3 A;  3SX5 A;  4JIS A;  1HM0 A;  1PZY B;  1QG8 A;  4O6N A;  5IDS A;  2O1H A;  5C4F A;  2RIT A;  5CQN X;  4EEG A;  5C1L A;  3JUK A;  1MP3 A;  4KPZ A;  3PKQ A;  1XZ6 A;  4HG6 A;  4KNR A;  4AC3 A;  2AH9 A;  5CMH A;  3D5N A;  1G3L A;  2UX8 A;  4G3Q A;  1G95 A;  1VZU A;  4KXO A;  5C38 A;  3PKP A;  2O1F A;  3I0G A;  4E1K A;  2V0H A;  1JVG A;  4NAN A;  1ZJ2 A;  2Y4M A;  1LL0 A;  2WVK A;  1VH3 A;  2BO4 A;  1QGQ A;  2BO7 A;  1FXJ A;  4KT7 A;  4C2S A;  2WAW A;  1R7T A;  1VZT A;  3I0L A;  5C48 A;  2AEC A;  4CVH A;  4FCU A;  2VS5 A;  4B4M A;  1W55 A;  2ICX A;  2ZU7 A;  1GWV A;  5C3D A;  3ZGF A;  3CKN A;  4KC1 A;  5IDT A;  5FUH A;  1ZI5 A;  2W0V A;  5HS2 A;  5CMF X;  4FRQ A;  5L6S A;  2W0W A;  2X5S A;  1IIM A;  4M28 A;  4ASJ A;  1WT2 A;  3U0Y A;  3V8Z A;  2RIX A;  2PGV A;  2V0K A;  1FR8 A;  1H7F A;  3HL3 A;  2RJ0 A;  4B5B A;  1GX0 A;  2FYC B;  3DUV A;  1W57 A;  3I0K A;  5FTV A;  1H7Q A;  2QGI A;  2WVL A;  4FRB A;  3OH4 A;  2X60 A;  1WVC A;  3T7M A;  3R3I A;  2DPW A;  5FTS A;  1H5T B;  3N9W A;  1NHE B;  3I0J A;  2OI7 A;  1ZCU A;  2ZU9 A;  1FO9 A;  3BRK X;  2YQH A;  3PNN A;  4D0T A;  3CU0 A;  4YS8 A;  3OH3 A;  3OKR A;  1QWJ A;  3CKJ A;  1EYR A;  4D11 C;  1Z90 A;  2Y4L A;  2A8U A;  1WT3 A;  3SPT A;  3ZLL A;  2Y4K A;  2RJ1 A;  4B2X A;  1MP5 A;  2YES A;  1FZW A;  3OGZ A;  1W77 A;  4J18 A;  2J0A A;  3SX3 A;  1VPA A;  4Y6N A;  1NWG B;  1JYK A;  2YQC A;  1O0R A;  1FWY A;  1XHB A;  1GQC A;  1H5S D;  2RJ7 A;  5CMG X;  2PGY A;  4DEC A;  2FFV A;  1ZI1 A;  1R7Y A;  1NQI B;  2FYB A;  4HO6 A;  2P72 A;  4R7P A;  3T7O A;  4G3S A;  3Q7U A;  1TZF A;  4AAW A;  2RJ4 A;  3V0P A;  1H4D A;  1WT1 A;  5DDV A;  2GGO A;  3V0O A;  2OEG A;  2VS4 A;  1JYL A;  2JCK A;  3OC9 A;  4EE5 A;  1TVY A;  1R82 A;  3EE5 A;  1NMM B;  1H7T A;  3F1C A;  1H3M A;  2D7I A;  4AYL A;  1INI A;  2CU2 A;  1ON6 A;  1VGZ A;  2NXV A;  4B4G A;  5EJZ A;  4GBP A;  1V83 A;  1ZDF A;  2FYA A;  2A8W A;  1G2V A;  2YC5 A;  2WGZ A;  1HV9 A;  1FO8 A;  2QH5 A;  5JQQ A;  3LW6 A;  2AE7 A;  4Y7U A;  4EEO A;  4G87 A;  4AYJ A;  4LW6 A;  3R2W A;  2VSI A;  2YCM A;  2E3D A;  1H5R B;  3KIA A;  4NAI A;  4FRP A;  4B4B A;  2RJ5 A;  2YQS A;  2BO8 A;  2VSH A;  1ZJ1 A;  2P73 A;  2Y6P A;  2XMH A;  3D98 A;  1WT0 A;  2FYD B;  3O3P A;  1KWS A;  5C1G A;  1HJJ A;  3CKV A;  2VFZ A;  1H7G A;  4CJC A;  5C4C A;  3TQD A;  1H7H A;  1ZI4 A;  5C3B A;  1H7L A;  3D8V A;  1H7E A;  2V0I A;  1R81 A;  1H5S B;  3I0I X;  4KRV A;  3V90 A;  1O23 B;  2I5K A;  3CKQ A;  1HJL A;  4Y6U A;  3OH1 A;  1FR9 A;  5C36 A;  4HO0 A;  3IOJ A;  3I0H A;  1ZCV A;  3U2U A;  5CMI A;  1ZIZ A;  2FFU A;  3JTJ A;  5AJN A;  1G23 A;  4M4K A;  4DE7 A;  3V0M A;  5FYE A;  1H5S C;  2OI5 A;  2MZB A;  4DDZ A;  1R80 A;  5IFY A;  1WSZ A;  4KQL A;  4B3U A;  2Y4J A;  2Z87 A;  3U2V A;  1YP2 A;  1FGX A;  1VH1 A;  5C4E A;  1V82 A;  4ARW A;  3SXA A;  3GUE A;  4D0Z A;  2VD4 A;  4EEM A;  1R7U A;  3OH0 A;  3V0L A;  1LL2 A;  2V0J A;  4FRO A;  2ICY A;  1EZI A;  3SXB A;  2PA4 A;  2YQJ A;  5FU8 A;  2AM4 A;  1YP3 A;  4MND A;  1NKH B;  3E26 A;  3NGW A;  4HO4 A;  5AJP A;  4O6M A;  4CJB A;  1MC3 A;  5I1F A;  1G1L A;  3I0C A;  1GA8 A;  4M2B A;  3I0E A;  1FRW A;  3U2X A;  2I7B A;  2RJ6 A;  1GQ9 A;  4EVW A;  3V0N A;  2AES A;  3SXG A;  2E8B A;  3Q4S A;  4CJ8 A;  3SXC A;  1ZHJ A;  1ON8 A;  4JD0 A;  1LZI A;  1LZJ A;  1H4E A;  4FRH A;  1G8O A;  4FRM A;  4G3P A;  2O1G A;  1GWW A;  3OH2 A;  1VGT A;  4D11 A;  1FGG A;  3U0X A;  1G93 A;  3U2W A;  4M2A A;  3F1Y A;  4P00 A;  1E5K A;  3USQ A;  2J0B A;  2D7R A;  2Y7A A;  2OI6 A;  4Y63 A;  1H5T A;  5D92 A;  1JVD A;  1ZI3 A;  4HO8 A;  2QKX A;  4FRE A;  2AGD A;  1G0R A;  3K8E A;  4K6R A;  1INJ A;  1TW1 A;  2VXM A;  4IRP A;  1TW5 A;  2APC A;  4XWI A;  1OQM B;  3QVB A;  5DDT A;  1VZX A;  3USR A;  3SXE A;  5BXC A;  1OMX A;  2JCL A;  1LVW A;  3SX8 A;  1MP4 A;  4HOC A;  5C1H A;  4EE3 A;  3TZT A;  4ASY A;  2RIZ A;  2D0J A;  4FQW A;  3V0Q A;  4MYB A;  1HM8 A;  4UEG A;  2PX7 A;  2VXL A;  4IRQ A;  3T7N A;  3K8D A;  2AM3 A;  5L6V A;  5C3A A;  4BQH A;  3DJ4 A;  4NAL A;  4D48 A;  4FRL A;  1S4O A;  5D91 A;  4KC2 A;  5CQO A;  3ZF8 A;  4HO2 A;  4Y7F A;  3Q80 A;  1I52 A;  2Q4J A;  1ZJP A;  4FIY A;  1H4C A;  2XWM A;  3POL A;  1ZJO A;  1NF5 B;  2X65 A;  2Z86 A;  3V91 A;  1YP4 A;  4Y9X A;  3IOI A;  4Y62 A;  4Y7G A;  1JV3 A;  5CQP A;  3IOH A;  1VM8 A;  1R7V A;  1GX4 A;  1VGU A;  2V0L A;  1G9R A;  2ZU8 A;  3FOQ A;  1FXO A;  4FRA A;  5EJ1 A;  4HO9 A;  5FU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...