4M4KA

Crystal structure of the drosphila beta,14galactosyltransferase 7 mutant d211n complex with manganese, udp-gal and xylobiose
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
238
structure length
238
Chain Sequence
VHKMALLVPFRDRFEELLQFVPHMTAFLKRQGVAHHIFVLNQVDRFRFNRASLINVGFQFASDVYDYIAMHDVDLLPLNDNLLYEYPSSLGPLHIAGPKLHPKYHYDNFVGGILLVRREHFKQMNGMSNQYWGWGLENDEFFVRIRDAGLQVTRPQNIKTGTNDTFSHIHNRYHRKRDTQKCFNQKEMTRKRDHKTGLDNVKYKILKVHEMLIDQVPVTILNILLDCDVNKTPWCDCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Beta-4-galactosyltransferase 7
publication title Crystal Structures of beta-1,4-Galactosyltransferase 7 Enzyme Reveal Conformational Changes and Substrate Binding.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 72
structure length 238
sequence length 238
ec nomenclature ec 2.4.1.-:
pdb deposition date 2013-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02709 Glyco_transf_7C N-terminal domain of galactosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4m4kA00
3D8VA 3T7MA 1FO8A 1ZJPA 4Y7FA 2D7IA 1ON6A 2VD4A 4D0TA 5C4CA 4DECA 5IFYA 3T7OA 2Y7AA 1G23A 3OH1A 3OH4A 3F1CA 1W77A 5CMFX 2X65A 2FY7A 1FWYA 3N9WA 1WSZA 1OQMB 5CMJA 2Q4JA 4JISA 1HV9A 1H4CA 2VS4A 1JV1A 1ZDFA 2Y4KA 1VZXA 3Q80A 4P00A 2JCOA 2YQJA 5CQOA 2AESA 2P73A 2QH5A 2FYCB 3DK5A 1JVDA 1W55A 4Y7TA 1NWGB 3V8YA 1R7UA 2O1GA 1ZJ1A 4FRMA 5FTSA 1VGWA 3PKQA 2V0JA 4C2SA 4EEMA 4J18A 2AECA 4K6RA 2WGZA 3U0YA 2RIZA 2PGVA 3CKJA 2D7RA 1Z90A 2AE7A 3I0KA 1QG8A 3SXAA 2NXVA 4DE7A 2W0VA 4LW3A 1O7OA 1QWJA 1TVYA 3PKPA 2RIXA 4G3QA 3U2TA 1LL0A 5J49A 4XWIA 2VSHA 4HCQA 1FR8A 5C4DA 5EJZA 2WVMA 4AAWA 3OH0A 2I5KA 3I0IX 2ZU7A 1WT2A 1VGUA 1E5KA 3TQDA 5C4FA 1V83A 3K8DA 2BO8A 3BCVA 1H7QA 2RJ6A 4IRQA 3ZF8A 5C49A 2YQCA 1HJLA 4FROA 1TZFA 3OKRA 5IDTA 4HO4A 4G87A 3U0XA 2RITA 1QGSA 5C3AA 1LZJA 4KC1A 3LW6A 3O3PA 4CJ8A 2YESA 2WAWA 3USQA 1K4VA 5CQMX 2UX8A 1G1LA 1ZCUA 5CMHA 5L6VA 3V91A 4B5BA 1HJJA 3ZGFA 2FYAA 2AH9A 1G95A 2WVKA 1R7YA 2Y4LA 2YQHA 2FFUA 4KC4A 1LZIA 1INJA 4E1KA 3SXGA 1KWSA 1JV3A 4Y62A 1ZI1A 2PGYA 2OI6A 1ON8A 3JUKA 2VXLA 5BXCA 1V82A 4D11A 2YQSA 3IOIA 4HO6A 1G2VA 4FRHA 1QGQA 3SX5A 1MP4A 1R7XA 4GBPA 5DDVA 1G3LA 4HO9A 4Y7GA 2DPWA 1WT1A 1ZIZA 4ZDQA 3BRKX 3SX7A 2MZBA 3CKQA 3CU0A 3V0LA 1LL3A 5C3BA 1GQ9A 1ZJ3A 4B4MA 2FFVA 1NMMB 2CU2A 1ZI5A 4NALA 4M28A 4B42A 1H7LA 2XWMA 2I7BA 1VGZA 1LVWA 1MP3A 1W57A 4BQHA 1VZTA 2GGQA 4DDZA 4Y64A 1H5SD 2ZU9A 2ICYA 4CVHA 2PA4A 4FRAA 4FCEA 1FO9A 3FOQA 4KNXA 1H5RA 4FRQA 1H3MA 1ZI3A 3FWWA 2RIYA 5C48A 4ASJA 5FUHA 1GA8A 3Q4SA 3CKVA 2VXMA 2YC5A 1GX0A 3K8EA 2P72A 4NAKA 4AYJA 1GX4A 2RJ4A 5FU0A 4HO2A 4MNDA 4CJBA 1H5SB 2JCJA 5C8RA 1IIMA 1LZ7A 4FRBA 2XMHA 3U2XA 2RJ9A 1YROB 4LW6A 3TZTA 5C1GA 4FQWA 5C1HA 2X5ZA 1OMXA 4FRLA 2XWLA 4G3PA 5L6SA 1H4EA 4G3SA 3U2VA 1HM8A 4KNRA 4FREA 1OMZA 1FXJA 1VICA 3RMWA 2A8WA 1YP2A 2O1FA 2WE9A 4UEGA 2V0IA 3V0QA 1EZIA 3SXBA 1VH3A 1VZUA 3I0JA 3NGWA 2QKXA 4B3UA 5CMIA 5I1FA 2V0KA 1MC3A 5C38A 1G93A 1H7FA 2D0JA 1ZJOA 1EYRA 1VGTA 1LL2A 4EEAA 3DJ4A 4NANA 2RJ7A 3JUJA 1H5RB 1NQIB 2JCLA 4KC2A 1S4NA 2Y6PA 4CJCA 3V8ZA 5AJOA 3Q7UA 4EE4A 2GGOA 4AC3A 2BO4A 2ICXA 2Y4MA 3CKNA 1S4OA 3D98A 3CGXA 3RSBA 2ZU8A 3I0DA 2QGIA 4FRPA 4IRPA 5CQPA 4M4KA 5C36A 3POLA 2BO7A 2OEFA 5HS2A 3SXDA 3V0MA 1JVGA 5C4EA 3R3IA 1FZWA 1JYLA 1G8OA 1ZHJA 5C1LA 5IDSA 4HO0A 5FTVA 4KPZA 1FGGA 3V90A 1H5TA 5C4BA 3ST8A 4EE3A 3I0CA 1LZ0A 4Y7VA 1ZJ0A 1GQCA 1H7HA 1YP3A 5EJ1A 1R80A 5AJPA 4EEGA 1IINA 4HOCA 1INIA 5FV9A 5JQQA 1TW5A 1G9RA 2AM5A 3U2WA 2OI5A 2XWNA 4B2WA 1GWWA 1TW1A 1ZCYA 3OGZA 1WVCA 2APCA 2OI7A 4HO3A 4L41C 1SS9A 4ECMA 4D0ZA 3SXCA 4EE5A 4M2BA 2OEGA 2RJ0A 4B4GA 4Y6NA 1PZTA 2A8UA 4NAIA 2V0LA 2W0WA 3U2UA 5AJNA 1ZCTA 1ZCVA 4MYBA 4FCUA 2O1HA 4D48A 5DDTA 2FYBA 3JTJA 4EEOA 1NF5B 2AGDA 2BO6A 4Y9XA 1O23B 4Y63A 4Y6UA 5CQNX 3ZLLA 5FU8A 2FYDB 3RMVA 2AM3A 4P02A 2E3DA 3D5NA 1FR9A 1H7TA 1XHBA 2Y4JA 4KT7A 3DUVA 2WEEA 3SXEA 4EVWA 5EIYA 4BMAA 1PZYB 1NHEB 1O7QA 2RJ8A 3IOJA 5CMGX 1H5TB 1WT0A 2RJ5A 1YP4A 3T7NA 3I0EA 3V0NA 2Z87A 3IOHA 2YC3A 1ZI4A 1R81A 4B4BA 1JYKA 1H7GA 3I0FA 3I0GA 1G0RA 3SX8A 3SPTA 5CQLX 3EE5A 1R7TA 1VM8A 2AM4A 3OC9A 2XMEA 2RJ1A 1H5SC 3V0PA 4FRDA 1FGXA 1FOAA 5C47A 3E26A 1H4DA 3R2WA 3OH3A 4D11C 2WVLA 1NKHB 4HG6A 1H7EA 2PX7A 3USRA 2P6WA 1O0RA 3OAMA 3KIAA 2YCMA 3CKOA 3F1YA 4KQLA 3ZGGA 1HM0A 3PNNA 1I52A 4Y7UA 4AYLA 1FXOA 1R82A 2VSIA 4KPXA 1G97A 2VFZA 5C3DA 1ZDGA 4YS8A 2E8BA 1FRWA 1FG5N 3QVBA 1H5SA 3V0OA 2JCKA 3ZLKA 2VS5A 4HO8A 1ZJ2A 1HM9A 2Z86A 3I0LA 3I0HA 5FYEA 4KRVA 2VS3A 4M2AA 1R7VA 4R7PA 4ARWA 1XZ6A 4ASYA 3OH2A 3HL3A 1MP5A 2X5SA 4JD0A 3SX3A 1GWVA 1VPAA 1WT3A 2V0HA 3E25A 4KXOA 2X60A 1VH1A 1V84A 3GUEA 4HO5A 1S4PA 4B2XA 2I5EA
chains in the Genus database with same CATH superfamily
3D8VA 3T7MA 1FO8A 1ZJPA 4Y7FA 2D7IA 1ON6A 2VD4A 4D0TA 5C4CA 4DECA 5IFYA 3T7OA 2Y7AA 1G23A 3OH1A 3OH4A 3F1CA 1W77A 5CMFX 2X65A 2FY7A 1FWYA 3N9WA 1WSZA 1OQMB 5CMJA 2Q4JA 4JISA 1HV9A 1H4CA 2VS4A 1JV1A 1ZDFA 2Y4KA 1VZXA 3Q80A 4P00A 2JCOA 2YQJA 5CQOA 2AESA 2P73A 2QH5A 2FYCB 3DK5A 1JVDA 1W55A 4Y7TA 1NWGB 3V8YA 1R7UA 2O1GA 1ZJ1A 4FRMA 5FTSA 1VGWA 3PKQA 2V0JA 4C2SA 4EEMA 4J18A 2AECA 4K6RA 2WGZA 3U0YA 2RIZA 2PGVA 3CKJA 2D7RA 1Z90A 2AE7A 3I0KA 1QG8A 3SXAA 2NXVA 4DE7A 2W0VA 4LW3A 1O7OA 1QWJA 1TVYA 3PKPA 2RIXA 4G3QA 4FIYA 3U2TA 1LL0A 5J49A 4XWIA 2VSHA 4HCQA 1FR8A 5C4DA 5EJZA 2WVMA 4AAWA 3OH0A 4O6NA 2I5KA 3I0IX 2ZU7A 1WT2A 1VGUA 1E5KA 3TQDA 5C4FA 1V83A 3K8DA 2BO8A 2C0NA 3BCVA 1H7QA 2RJ6A 4IRQA 3ZF8A 5C49A 2YQCA 1HJLA 4FROA 1TZFA 3OKRA 5IDTA 4HO4A 4G87A 3U0XA 2RITA 1QGSA 5C3AA 1LZJA 4KC1A 3LW6A 3O3PA 4CJ8A 2YESA 2WAWA 3USQA 1K4VA 5CQMX 2UX8A 1G1LA 1ZCUA 5CMHA 5L6VA 3V91A 4B5BA 1HJJA 3ZGFA 2FYAA 2AH9A 1G95A 2WVKA 1R7YA 2Y4LA 2YQHA 2FFUA 4KC4A 1LZIA 1INJA 4E1KA 3SXGA 1KWSA 1JV3A 4Y62A 1ZI1A 2PGYA 2OI6A 1ON8A 3JUKA 2VXLA 5BXCA 1V82A 4D11A 2YQSA 3IOIA 4HO6A 1G2VA 4FRHA 1QGQA 3SX5A 1MP4A 1R7XA 4GBPA 5DDVA 1G3LA 4HO9A 4Y7GA 2DPWA 1WT1A 1ZIZA 4ZDQA 3BRKX 3SX7A 2MZBA 3CKQA 3CU0A 3V0LA 1LL3A 5C3BA 1GQ9A 1ZJ3A 4B4MA 2FFVA 1NMMB 2CU2A 1ZI5A 4NALA 4M28A 4B42A 1H7LA 2XWMA 2I7BA 1VGZA 1LVWA 1MP3A 1W57A 4BQHA 1VZTA 2GGQA 4DDZA 4Y64A 1H5SD 2ZU9A 2ICYA 4CVHA 2PA4A 4FRAA 5D92A 4FCEA 1FO9A 3FOQA 4KNXA 1H5RA 4FRQA 1H3MA 1ZI3A 3FWWA 2RIYA 5C48A 4ASJA 5FUHA 1GA8A 3Q4SA 3CKVA 2VXMA 2YC5A 1GX0A 3K8EA 2P72A 4NAKA 4AYJA 1GX4A 2RJ4A 5FU0A 4HO2A 4MNDA 4CJBA 1H5SB 2JCJA 5C8RA 1IIMA 1LZ7A 4FRBA 2XMHA 3U2XA 2RJ9A 1YROB 4LW6A 3TZTA 5C1GA 4FQWA 5C1HA 2X5ZA 1OMXA 4FRLA 2XWLA 4G3PA 2J0AA 5L6SA 1H4EA 4G3SA 3U2VA 1HM8A 4KNRA 4FREA 1OMZA 1FXJA 1VICA 3RMWA 2A8WA 1YP2A 2O1FA 2WE9A 4UEGA 2V0IA 3V0QA 1EZIA 3SXBA 1VH3A 1VZUA 3I0JA 3NGWA 2QKXA 4B3UA 5CMIA 5I1FA 2V0KA 1MC3A 5C38A 1G93A 1H7FA 2D0JA 1ZJOA 1EYRA 1VGTA 1LL2A 4EEAA 3DJ4A 4NANA 2RJ7A 3JUJA 1H5RB 1NQIB 2JCLA 4KC2A 1S4NA 2VK9A 2Y6PA 4CJCA 3V8ZA 5AJOA 3Q7UA 4EE4A 2GGOA 4AC3A 2BO4A 2ICXA 2Y4MA 3CKNA 1S4OA 3D98A 3CGXA 3RSBA 2ZU8A 3I0DA 2QGIA 4FRPA 4IRPA 5CQPA 4M4KA 5C36A 3POLA 2BO7A 4FIXA 2OEFA 5HS2A 3SXDA 3V0MA 1JVGA 5C4EA 3R3IA 1FZWA 1JYLA 1G8OA 1ZHJA 5C1LA 5IDSA 4HO0A 5FTVA 4KPZA 1FGGA 3V90A 1H5TA 5C4BA 3ST8A 4EE3A 3I0CA 1LZ0A 4Y7VA 1ZJ0A 4Q7CA 1GQCA 1H7HA 1YP3A 5EJ1A 1R80A 5AJPA 4EEGA 1IINA 4HOCA 1INIA 5FV9A 5JQQA 1TW5A 1G9RA 2AM5A 3U2WA 2OI5A 2XWNA 4B2WA 1GWWA 1TW1A 1ZCYA 3OGZA 1WVCA 2APCA 2OI7A 4HO3A 4L41C 1SS9A 4ECMA 4D0ZA 3SXCA 4EE5A 4M2BA 2OEGA 2RJ0A 4B4GA 4Y6NA 1PZTA 2A8UA 4NAIA 2V0LA 2W0WA 3U2UA 5AJNA 4MIXA 1ZCTA 1ZCVA 4MYBA 4FCUA 2O1HA 4D48A 5DDTA 2FYBA 5D91A 3JTJA 4EEOA 1NF5B 2AGDA 2BO6A 4Y9XA 1O23B 4Y63A 4Y6UA 5CQNX 3ZLLA 5FU8A 2FYDB 3RMVA 2AM3A 4P02A 2E3DA 3D5NA 1FR9A 1H7TA 1XHBA 2Y4JA 4KT7A 4O6MA 3DUVA 2WEEA 3SXEA 4EVWA 5EIYA 4BMAA 1PZYB 1NHEB 1O7QA 2RJ8A 3IOJA 5CMGX 1H5TB 1WT0A 2RJ5A 1YP4A 3T7NA 3I0EA 3V0NA 2Z87A 3IOHA 2YC3A 1ZI4A 1R81A 4B4BA 1JYKA 1H7GA 3I0FA 3I0GA 1G0RA 3SX8A 3SPTA 5CQLX 3EE5A 1R7TA 1VM8A 2AM4A 2J0BA 3OC9A 2XMEA 2RJ1A 1H5SC 3V0PA 4FRDA 1FGXA 1FOAA 5C47A 3E26A 1H4DA 3R2WA 3OH3A 4D11C 2WVLA 1NKHB 4HG6A 1H7EA 2PX7A 3USRA 2P6WA 1O0RA 3OAMA 3KIAA 2YCMA 3CKOA 3F1YA 4KQLA 3ZGGA 1HM0A 3PNNA 1I52A 4Y7UA 4AYLA 1FXOA 1R82A 2VSIA 4KPXA 1G97A 2VFZA 5C3DA 1ZDGA 4YS8A 2E8BA 1FRWA 1FG5N 3QVBA 1H5SA 3V0OA 2JCKA 3ZLKA 2VS5A 4HO8A 1ZJ2A 1HM9A 2Z86A 3I0LA 3I0HA 5FYEA 4KRVA 2VS3A 4M2AA 1R7VA 4R7PA 4ARWA 1XZ6A 4ASYA 3OH2A 3HL3A 1MP5A 2X5SA 4JD0A 3SX3A 1GWVA 1VPAA 1WT3A 2V0HA 3E25A 4KXOA 2X60A 1VH1A 1V84A 3GUEA 4HO5A 1S4PA 4B2XA 2I5EA
chains in the Genus database with same CATH topology
3D8VA 3T7MA 1FO8A 1ZJPA 4Y7FA 2D7IA 1ON6A 2VD4A 4D0TA 5C4CA 4DECA 5IFYA 3T7OA 2Y7AA 1G23A 3OH1A 3OH4A 3F1CA 1W77A 5CMFX 2X65A 2FY7A 1FWYA 3N9WA 1WSZA 1OQMB 5CMJA 2Q4JA 4JISA 1HV9A 1H4CA 2VS4A 1JV1A 1ZDFA 2Y4KA 1VZXA 3Q80A 4P00A 2JCOA 2YQJA 5CQOA 2AESA 2P73A 2QH5A 2FYCB 3DK5A 1JVDA 1W55A 4Y7TA 1NWGB 3V8YA 1R7UA 2O1GA 1ZJ1A 4FRMA 5FTSA 1VGWA 3PKQA 2V0JA 4C2SA 4EEMA 4J18A 2AECA 4K6RA 2WGZA 3U0YA 2RIZA 2PGVA 3CKJA 2D7RA 1Z90A 2AE7A 3I0KA 1QG8A 3SXAA 2NXVA 4DE7A 2W0VA 4LW3A 1O7OA 1QWJA 1TVYA 3PKPA 2RIXA 4G3QA 4FIYA 3U2TA 1LL0A 5J49A 4XWIA 2VSHA 4HCQA 1FR8A 5C4DA 5EJZA 2WVMA 4AAWA 3OH0A 4O6NA 2I5KA 3I0IX 2ZU7A 1WT2A 1VGUA 1E5KA 3TQDA 5C4FA 1V83A 3K8DA 2BO8A 2C0NA 3BCVA 1H7QA 2RJ6A 4IRQA 3ZF8A 5C49A 2YQCA 1HJLA 4FROA 1TZFA 3OKRA 5IDTA 4HO4A 4G87A 3U0XA 2RITA 1QGSA 5C3AA 1LZJA 4KC1A 3LW6A 3O3PA 4CJ8A 2YESA 2WAWA 3USQA 1K4VA 5CQMX 2UX8A 1G1LA 1ZCUA 5CMHA 5L6VA 3V91A 4B5BA 1HJJA 3ZGFA 2FYAA 2AH9A 1G95A 2WVKA 1R7YA 2Y4LA 2YQHA 2FFUA 4KC4A 1LZIA 1INJA 4E1KA 3SXGA 1KWSA 1JV3A 4Y62A 1ZI1A 2PGYA 2OI6A 1ON8A 3JUKA 2VXLA 5BXCA 1V82A 4D11A 2YQSA 3IOIA 4HO6A 1G2VA 4FRHA 1QGQA 3SX5A 1MP4A 1R7XA 4GBPA 5DDVA 1G3LA 4HO9A 4Y7GA 2DPWA 1WT1A 1ZIZA 4ZDQA 3BRKX 3SX7A 2MZBA 3CKQA 3CU0A 3V0LA 1LL3A 5C3BA 1GQ9A 1ZJ3A 4B4MA 2FFVA 1NMMB 2CU2A 1ZI5A 4NALA 4M28A 4B42A 1H7LA 2XWMA 2I7BA 1VGZA 1LVWA 1MP3A 1W57A 4BQHA 1VZTA 2GGQA 4DDZA 4Y64A 1H5SD 2ZU9A 2ICYA 4CVHA 2PA4A 4FRAA 5D92A 4FCEA 1FO9A 3FOQA 4KNXA 1H5RA 4FRQA 1H3MA 1ZI3A 3FWWA 2RIYA 5C48A 4ASJA 5FUHA 1GA8A 3Q4SA 3CKVA 2VXMA 2YC5A 1GX0A 3K8EA 2P72A 4NAKA 4AYJA 1GX4A 2RJ4A 5FU0A 4HO2A 4MNDA 4CJBA 1H5SB 2JCJA 5C8RA 1IIMA 1LZ7A 4FRBA 2XMHA 3U2XA 2RJ9A 1YROB 4LW6A 3TZTA 5C1GA 4FQWA 5C1HA 2X5ZA 1OMXA 4FRLA 2XWLA 4G3PA 2J0AA 5L6SA 1H4EA 4G3SA 3U2VA 1HM8A 4KNRA 4FREA 1OMZA 1FXJA 1VICA 3RMWA 2A8WA 1YP2A 2O1FA 2WE9A 4UEGA 2V0IA 3V0QA 1EZIA 3SXBA 1VH3A 1VZUA 3I0JA 3NGWA 2QKXA 4B3UA 5CMIA 5I1FA 2V0KA 1MC3A 5C38A 1G93A 1H7FA 2D0JA 1ZJOA 1EYRA 1VGTA 1LL2A 4EEAA 3DJ4A 4NANA 2RJ7A 3JUJA 1H5RB 1NQIB 2JCLA 4KC2A 1S4NA 2VK9A 2Y6PA 4CJCA 3V8ZA 5AJOA 3Q7UA 4EE4A 2GGOA 4AC3A 2BO4A 2ICXA 2Y4MA 3CKNA 1S4OA 3D98A 3CGXA 3RSBA 2ZU8A 3I0DA 2QGIA 4FRPA 4IRPA 5CQPA 4M4KA 5C36A 3POLA 2BO7A 4FIXA 2OEFA 5HS2A 3SXDA 3V0MA 1JVGA 5C4EA 3R3IA 1FZWA 1JYLA 1G8OA 1ZHJA 5C1LA 5IDSA 4HO0A 5FTVA 4KPZA 1FGGA 3V90A 1H5TA 5C4BA 3ST8A 4EE3A 3I0CA 1LZ0A 4Y7VA 1ZJ0A 4Q7CA 1GQCA 1H7HA 1YP3A 5EJ1A 1R80A 5AJPA 4EEGA 1IINA 4HOCA 1INIA 5FV9A 5JQQA 1TW5A 1G9RA 2AM5A 3U2WA 2OI5A 2XWNA 4B2WA 1GWWA 1TW1A 1ZCYA 3OGZA 1WVCA 2APCA 2OI7A 4HO3A 4L41C 1SS9A 4ECMA 4D0ZA 3SXCA 4EE5A 4M2BA 2OEGA 2RJ0A 4B4GA 4Y6NA 1PZTA 2A8UA 4NAIA 2V0LA 2W0WA 3U2UA 5AJNA 4MIXA 1ZCTA 1ZCVA 4MYBA 4FCUA 2O1HA 4D48A 5DDTA 2FYBA 5D91A 3JTJA 4EEOA 1NF5B 2AGDA 2BO6A 4Y9XA 1O23B 4Y63A 4Y6UA 5CQNX 3ZLLA 5FU8A 2FYDB 3RMVA 2AM3A 4P02A 2E3DA 3D5NA 1FR9A 1H7TA 1XHBA 2Y4JA 4KT7A 4O6MA 3DUVA 2WEEA 3SXEA 4EVWA 5EIYA 4BMAA 1PZYB 1NHEB 1O7QA 2RJ8A 3IOJA 5CMGX 1H5TB 1WT0A 2RJ5A 1YP4A 3T7NA 3I0EA 3V0NA 2Z87A 3IOHA 2YC3A 1ZI4A 1R81A 4B4BA 1JYKA 1H7GA 3I0FA 3I0GA 1G0RA 3SX8A 3SPTA 5CQLX 3EE5A 1R7TA 1VM8A 2AM4A 2J0BA 3OC9A 2XMEA 2RJ1A 1H5SC 3V0PA 4FRDA 1FGXA 1FOAA 5C47A 3E26A 1H4DA 3R2WA 3OH3A 4D11C 2WVLA 1NKHB 4HG6A 1H7EA 2PX7A 3USRA 2P6WA 1O0RA 3OAMA 3KIAA 2YCMA 3CKOA 3F1YA 4KQLA 3ZGGA 1HM0A 3PNNA 1I52A 4Y7UA 4AYLA 1FXOA 1R82A 2VSIA 4KPXA 1G97A 2VFZA 5C3DA 1ZDGA 4YS8A 2E8BA 1FRWA 1FG5N 3QVBA 1H5SA 3V0OA 2JCKA 3ZLKA 2VS5A 4HO8A 1ZJ2A 1HM9A 2Z86A 3I0LA 3I0HA 5FYEA 4KRVA 2VS3A 4M2AA 1R7VA 4R7PA 4ARWA 1XZ6A 4ASYA 3OH2A 3HL3A 1MP5A 2X5SA 4JD0A 3SX3A 1GWVA 1VPAA 1WT3A 2V0HA 3E25A 4KXOA 2X60A 1VH1A 1V84A 3GUEA 4HO5A 1S4PA 4B2XA 2I5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D8V A;  3T7M A;  1FO8 A;  1ZJP A;  4Y7F A;  2D7I A;  1ON6 A;  2VD4 A;  4D0T A;  5C4C A;  4DEC A;  5IFY A;  3T7O A;  2Y7A A;  1G23 A;  3OH1 A;  3OH4 A;  3F1C A;  1W77 A;  5CMF X;  2X65 A;  2FY7 A;  1FWY A;  3N9W A;  1WSZ A;  1OQM B;  5CMJ A;  2Q4J A;  4JIS A;  1HV9 A;  1H4C A;  2VS4 A;  1JV1 A;  1ZDF A;  2Y4K A;  1VZX A;  3Q80 A;  4P00 A;  2JCO A;  2YQJ A;  5CQO A;  2AES A;  2P73 A;  2QH5 A;  2FYC B;  3DK5 A;  1JVD A;  1W55 A;  4Y7T A;  1NWG B;  3V8Y A;  1R7U A;  2O1G A;  1ZJ1 A;  4FRM A;  5FTS A;  1VGW A;  3PKQ A;  2V0J A;  4C2S A;  4EEM A;  4J18 A;  2AEC A;  4K6R A;  2WGZ A;  3U0Y A;  2RIZ A;  2PGV A;  3CKJ A;  2D7R A;  1Z90 A;  2AE7 A;  3I0K A;  1QG8 A;  3SXA A;  2NXV A;  4DE7 A;  2W0V A;  4LW3 A;  1O7O A;  1QWJ A;  1TVY A;  3PKP A;  2RIX A;  4G3Q A;  3U2T A;  1LL0 A;  5J49 A;  4XWI A;  2VSH A;  4HCQ A;  1FR8 A;  5C4D A;  5EJZ A;  2WVM A;  4AAW A;  3OH0 A;  2I5K A;  3I0I X;  2ZU7 A;  1WT2 A;  1VGU A;  1E5K A;  3TQD A;  5C4F A;  1V83 A;  3K8D A;  2BO8 A;  3BCV A;  1H7Q A;  2RJ6 A;  4IRQ A;  3ZF8 A;  5C49 A;  2YQC A;  1HJL A;  4FRO A;  1TZF A;  3OKR A;  5IDT A;  4HO4 A;  4G87 A;  3U0X A;  2RIT A;  1QGS A;  5C3A A;  1LZJ A;  4KC1 A;  3LW6 A;  3O3P A;  4CJ8 A;  2YES A;  2WAW A;  3USQ A;  1K4V A;  5CQM X;  2UX8 A;  1G1L A;  1ZCU A;  5CMH A;  5L6V A;  3V91 A;  4B5B A;  1HJJ A;  3ZGF A;  2FYA A;  2AH9 A;  1G95 A;  2WVK A;  1R7Y A;  2Y4L A;  2YQH A;  2FFU A;  4KC4 A;  1LZI A;  1INJ A;  4E1K A;  3SXG A;  1KWS A;  1JV3 A;  4Y62 A;  1ZI1 A;  2PGY A;  2OI6 A;  1ON8 A;  3JUK A;  2VXL A;  5BXC A;  1V82 A;  4D11 A;  2YQS A;  3IOI A;  4HO6 A;  1G2V A;  4FRH A;  1QGQ A;  3SX5 A;  1MP4 A;  1R7X A;  4GBP A;  5DDV A;  1G3L A;  4HO9 A;  4Y7G A;  2DPW A;  1WT1 A;  1ZIZ A;  4ZDQ A;  3BRK X;  3SX7 A;  2MZB A;  3CKQ A;  3CU0 A;  3V0L A;  1LL3 A;  5C3B A;  1GQ9 A;  1ZJ3 A;  4B4M A;  2FFV A;  1NMM B;  2CU2 A;  1ZI5 A;  4NAL A;  4M28 A;  4B42 A;  1H7L A;  2XWM A;  2I7B A;  1VGZ A;  1LVW A;  1MP3 A;  1W57 A;  4BQH A;  1VZT A;  2GGQ A;  4DDZ A;  4Y64 A;  1H5S D;  2ZU9 A;  2ICY A;  4CVH A;  2PA4 A;  4FRA A;  4FCE A;  1FO9 A;  3FOQ A;  4KNX A;  1H5R A;  4FRQ A;  1H3M A;  1ZI3 A;  3FWW A;  2RIY A;  5C48 A;  4ASJ A;  5FUH A;  1GA8 A;  3Q4S A;  3CKV A;  2VXM A;  2YC5 A;  1GX0 A;  3K8E A;  2P72 A;  4NAK A;  4AYJ A;  1GX4 A;  2RJ4 A;  5FU0 A;  4HO2 A;  4MND A;  4CJB A;  1H5S B;  2JCJ A;  5C8R A;  1IIM A;  1LZ7 A;  4FRB A;  2XMH A;  3U2X A;  2RJ9 A;  1YRO B;  4LW6 A;  3TZT A;  5C1G A;  4FQW A;  5C1H A;  2X5Z A;  1OMX A;  4FRL A;  2XWL A;  4G3P A;  5L6S A;  1H4E A;  4G3S A;  3U2V A;  1HM8 A;  4KNR A;  4FRE A;  1OMZ A;  1FXJ A;  1VIC A;  3RMW A;  2A8W A;  1YP2 A;  2O1F A;  2WE9 A;  4UEG A;  2V0I A;  3V0Q A;  1EZI A;  3SXB A;  1VH3 A;  1VZU A;  3I0J A;  3NGW A;  2QKX A;  4B3U A;  5CMI A;  5I1F A;  2V0K A;  1MC3 A;  5C38 A;  1G93 A;  1H7F A;  2D0J A;  1ZJO A;  1EYR A;  1VGT A;  1LL2 A;  4EEA A;  3DJ4 A;  4NAN A;  2RJ7 A;  3JUJ A;  1H5R B;  1NQI B;  2JCL A;  4KC2 A;  1S4N A;  2Y6P A;  4CJC A;  3V8Z A;  5AJO A;  3Q7U A;  4EE4 A;  2GGO A;  4AC3 A;  2BO4 A;  2ICX A;  2Y4M A;  3CKN A;  1S4O A;  3D98 A;  3CGX A;  3RSB A;  2ZU8 A;  3I0D A;  2QGI A;  4FRP A;  4IRP A;  5CQP A;  4M4K A;  5C36 A;  3POL A;  2BO7 A;  2OEF A;  5HS2 A;  3SXD A;  3V0M A;  1JVG A;  5C4E A;  3R3I A;  1FZW A;  1JYL A;  1G8O A;  1ZHJ A;  5C1L A;  5IDS A;  4HO0 A;  5FTV A;  4KPZ A;  1FGG A;  3V90 A;  1H5T A;  5C4B A;  3ST8 A;  4EE3 A;  3I0C A;  1LZ0 A;  4Y7V A;  1ZJ0 A;  1GQC A;  1H7H A;  1YP3 A;  5EJ1 A;  1R80 A;  5AJP A;  4EEG A;  1IIN A;  4HOC A;  1INI A;  5FV9 A;  5JQQ A;  1TW5 A;  1G9R A;  2AM5 A;  3U2W A;  2OI5 A;  2XWN A;  4B2W A;  1GWW A;  1TW1 A;  1ZCY A;  3OGZ A;  1WVC A;  2APC A;  2OI7 A;  4HO3 A;  4L41 C;  1SS9 A;  4ECM A;  4D0Z A;  3SXC A;  4EE5 A;  4M2B A;  2OEG A;  2RJ0 A;  4B4G A;  4Y6N A;  1PZT A;  2A8U A;  4NAI A;  2V0L A;  2W0W A;  3U2U A;  5AJN A;  1ZCT A;  1ZCV A;  4MYB A;  4FCU A;  2O1H A;  4D48 A;  5DDT A;  2FYB A;  3JTJ A;  4EEO A;  1NF5 B;  2AGD A;  2BO6 A;  4Y9X A;  1O23 B;  4Y63 A;  4Y6U A;  5CQN X;  3ZLL A;  5FU8 A;  2FYD B;  3RMV A;  2AM3 A;  4P02 A;  2E3D A;  3D5N A;  1FR9 A;  1H7T A;  1XHB A;  2Y4J A;  4KT7 A;  3DUV A;  2WEE A;  3SXE A;  4EVW A;  5EIY A;  4BMA A;  1PZY B;  1NHE B;  1O7Q A;  2RJ8 A;  3IOJ A;  5CMG X;  1H5T B;  1WT0 A;  2RJ5 A;  1YP4 A;  3T7N A;  3I0E A;  3V0N A;  2Z87 A;  3IOH A;  2YC3 A;  1ZI4 A;  1R81 A;  4B4B A;  1JYK A;  1H7G A;  3I0F A;  3I0G A;  1G0R A;  3SX8 A;  3SPT A;  5CQL X;  3EE5 A;  1R7T A;  1VM8 A;  2AM4 A;  3OC9 A;  2XME A;  2RJ1 A;  1H5S C;  3V0P A;  4FRD A;  1FGX A;  1FOA A;  5C47 A;  3E26 A;  1H4D A;  3R2W A;  3OH3 A;  4D11 C;  2WVL A;  1NKH B;  4HG6 A;  1H7E A;  2PX7 A;  3USR A;  2P6W A;  1O0R A;  3OAM A;  3KIA A;  2YCM A;  3CKO A;  3F1Y A;  4KQL A;  3ZGG A;  1HM0 A;  3PNN A;  1I52 A;  4Y7U A;  4AYL A;  1FXO A;  1R82 A;  2VSI A;  4KPX A;  1G97 A;  2VFZ A;  5C3D A;  1ZDG A;  4YS8 A;  2E8B A;  1FRW A;  1FG5 N;  3QVB A;  1H5S A;  3V0O A;  2JCK A;  3ZLK A;  2VS5 A;  4HO8 A;  1ZJ2 A;  1HM9 A;  2Z86 A;  3I0L A;  3I0H A;  5FYE A;  4KRV A;  2VS3 A;  4M2A A;  1R7V A;  4R7P A;  4ARW A;  1XZ6 A;  4ASY A;  3OH2 A;  3HL3 A;  1MP5 A;  2X5S A;  4JD0 A;  3SX3 A;  1GWV A;  1VPA A;  1WT3 A;  2V0H A;  3E25 A;  4KXO A;  2X60 A;  1VH1 A;  1V84 A;  3GUE A;  4HO5 A;  1S4P A;  4B2X A;  2I5E A; 
#chains in the Genus database with same CATH topology
 3D8V A;  3T7M A;  1FO8 A;  1ZJP A;  4Y7F A;  2D7I A;  1ON6 A;  2VD4 A;  4D0T A;  5C4C A;  4DEC A;  5IFY A;  3T7O A;  2Y7A A;  1G23 A;  3OH1 A;  3OH4 A;  3F1C A;  1W77 A;  5CMF X;  2X65 A;  2FY7 A;  1FWY A;  3N9W A;  1WSZ A;  1OQM B;  5CMJ A;  2Q4J A;  4JIS A;  1HV9 A;  1H4C A;  2VS4 A;  1JV1 A;  1ZDF A;  2Y4K A;  1VZX A;  3Q80 A;  4P00 A;  2JCO A;  2YQJ A;  5CQO A;  2AES A;  2P73 A;  2QH5 A;  2FYC B;  3DK5 A;  1JVD A;  1W55 A;  4Y7T A;  1NWG B;  3V8Y A;  1R7U A;  2O1G A;  1ZJ1 A;  4FRM A;  5FTS A;  1VGW A;  3PKQ A;  2V0J A;  4C2S A;  4EEM A;  4J18 A;  2AEC A;  4K6R A;  2WGZ A;  3U0Y A;  2RIZ A;  2PGV A;  3CKJ A;  2D7R A;  1Z90 A;  2AE7 A;  3I0K A;  1QG8 A;  3SXA A;  2NXV A;  4DE7 A;  2W0V A;  4LW3 A;  1O7O A;  1QWJ A;  1TVY A;  3PKP A;  2RIX A;  4G3Q A;  4FIY A;  3U2T A;  1LL0 A;  5J49 A;  4XWI A;  2VSH A;  4HCQ A;  1FR8 A;  5C4D A;  5EJZ A;  2WVM A;  4AAW A;  3OH0 A;  4O6N A;  2I5K A;  3I0I X;  2ZU7 A;  1WT2 A;  1VGU A;  1E5K A;  3TQD A;  5C4F A;  1V83 A;  3K8D A;  2BO8 A;  2C0N A;  3BCV A;  1H7Q A;  2RJ6 A;  4IRQ A;  3ZF8 A;  5C49 A;  2YQC A;  1HJL A;  4FRO A;  1TZF A;  3OKR A;  5IDT A;  4HO4 A;  4G87 A;  3U0X A;  2RIT A;  1QGS A;  5C3A A;  1LZJ A;  4KC1 A;  3LW6 A;  3O3P A;  4CJ8 A;  2YES A;  2WAW A;  3USQ A;  1K4V A;  5CQM X;  2UX8 A;  1G1L A;  1ZCU A;  5CMH A;  5L6V A;  3V91 A;  4B5B A;  1HJJ A;  3ZGF A;  2FYA A;  2AH9 A;  1G95 A;  2WVK A;  1R7Y A;  2Y4L A;  2YQH A;  2FFU A;  4KC4 A;  1LZI A;  1INJ A;  4E1K A;  3SXG A;  1KWS A;  1JV3 A;  4Y62 A;  1ZI1 A;  2PGY A;  2OI6 A;  1ON8 A;  3JUK A;  2VXL A;  5BXC A;  1V82 A;  4D11 A;  2YQS A;  3IOI A;  4HO6 A;  1G2V A;  4FRH A;  1QGQ A;  3SX5 A;  1MP4 A;  1R7X A;  4GBP A;  5DDV A;  1G3L A;  4HO9 A;  4Y7G A;  2DPW A;  1WT1 A;  1ZIZ A;  4ZDQ A;  3BRK X;  3SX7 A;  2MZB A;  3CKQ A;  3CU0 A;  3V0L A;  1LL3 A;  5C3B A;  1GQ9 A;  1ZJ3 A;  4B4M A;  2FFV A;  1NMM B;  2CU2 A;  1ZI5 A;  4NAL A;  4M28 A;  4B42 A;  1H7L A;  2XWM A;  2I7B A;  1VGZ A;  1LVW A;  1MP3 A;  1W57 A;  4BQH A;  1VZT A;  2GGQ A;  4DDZ A;  4Y64 A;  1H5S D;  2ZU9 A;  2ICY A;  4CVH A;  2PA4 A;  4FRA A;  5D92 A;  4FCE A;  1FO9 A;  3FOQ A;  4KNX A;  1H5R A;  4FRQ A;  1H3M A;  1ZI3 A;  3FWW A;  2RIY A;  5C48 A;  4ASJ A;  5FUH A;  1GA8 A;  3Q4S A;  3CKV A;  2VXM A;  2YC5 A;  1GX0 A;  3K8E A;  2P72 A;  4NAK A;  4AYJ A;  1GX4 A;  2RJ4 A;  5FU0 A;  4HO2 A;  4MND A;  4CJB A;  1H5S B;  2JCJ A;  5C8R A;  1IIM A;  1LZ7 A;  4FRB A;  2XMH A;  3U2X A;  2RJ9 A;  1YRO B;  4LW6 A;  3TZT A;  5C1G A;  4FQW A;  5C1H A;  2X5Z A;  1OMX A;  4FRL A;  2XWL A;  4G3P A;  2J0A A;  5L6S A;  1H4E A;  4G3S A;  3U2V A;  1HM8 A;  4KNR A;  4FRE A;  1OMZ A;  1FXJ A;  1VIC A;  3RMW A;  2A8W A;  1YP2 A;  2O1F A;  2WE9 A;  4UEG A;  2V0I A;  3V0Q A;  1EZI A;  3SXB A;  1VH3 A;  1VZU A;  3I0J A;  3NGW A;  2QKX A;  4B3U A;  5CMI A;  5I1F A;  2V0K A;  1MC3 A;  5C38 A;  1G93 A;  1H7F A;  2D0J A;  1ZJO A;  1EYR A;  1VGT A;  1LL2 A;  4EEA A;  3DJ4 A;  4NAN A;  2RJ7 A;  3JUJ A;  1H5R B;  1NQI B;  2JCL A;  4KC2 A;  1S4N A;  2VK9 A;  2Y6P A;  4CJC A;  3V8Z A;  5AJO A;  3Q7U A;  4EE4 A;  2GGO A;  4AC3 A;  2BO4 A;  2ICX A;  2Y4M A;  3CKN A;  1S4O A;  3D98 A;  3CGX A;  3RSB A;  2ZU8 A;  3I0D A;  2QGI A;  4FRP A;  4IRP A;  5CQP A;  4M4K A;  5C36 A;  3POL A;  2BO7 A;  4FIX A;  2OEF A;  5HS2 A;  3SXD A;  3V0M A;  1JVG A;  5C4E A;  3R3I A;  1FZW A;  1JYL A;  1G8O A;  1ZHJ A;  5C1L A;  5IDS A;  4HO0 A;  5FTV A;  4KPZ A;  1FGG A;  3V90 A;  1H5T A;  5C4B A;  3ST8 A;  4EE3 A;  3I0C A;  1LZ0 A;  4Y7V A;  1ZJ0 A;  4Q7C A;  1GQC A;  1H7H A;  1YP3 A;  5EJ1 A;  1R80 A;  5AJP A;  4EEG A;  1IIN A;  4HOC A;  1INI A;  5FV9 A;  5JQQ A;  1TW5 A;  1G9R A;  2AM5 A;  3U2W A;  2OI5 A;  2XWN A;  4B2W A;  1GWW A;  1TW1 A;  1ZCY A;  3OGZ A;  1WVC A;  2APC A;  2OI7 A;  4HO3 A;  4L41 C;  1SS9 A;  4ECM A;  4D0Z A;  3SXC A;  4EE5 A;  4M2B A;  2OEG A;  2RJ0 A;  4B4G A;  4Y6N A;  1PZT A;  2A8U A;  4NAI A;  2V0L A;  2W0W A;  3U2U A;  5AJN A;  4MIX A;  1ZCT A;  1ZCV A;  4MYB A;  4FCU A;  2O1H A;  4D48 A;  5DDT A;  2FYB A;  5D91 A;  3JTJ A;  4EEO A;  1NF5 B;  2AGD A;  2BO6 A;  4Y9X A;  1O23 B;  4Y63 A;  4Y6U A;  5CQN X;  3ZLL A;  5FU8 A;  2FYD B;  3RMV A;  2AM3 A;  4P02 A;  2E3D A;  3D5N A;  1FR9 A;  1H7T A;  1XHB A;  2Y4J A;  4KT7 A;  4O6M A;  3DUV A;  2WEE A;  3SXE A;  4EVW A;  5EIY A;  4BMA A;  1PZY B;  1NHE B;  1O7Q A;  2RJ8 A;  3IOJ A;  5CMG X;  1H5T B;  1WT0 A;  2RJ5 A;  1YP4 A;  3T7N A;  3I0E A;  3V0N A;  2Z87 A;  3IOH A;  2YC3 A;  1ZI4 A;  1R81 A;  4B4B A;  1JYK A;  1H7G A;  3I0F A;  3I0G A;  1G0R A;  3SX8 A;  3SPT A;  5CQL X;  3EE5 A;  1R7T A;  1VM8 A;  2AM4 A;  2J0B A;  3OC9 A;  2XME A;  2RJ1 A;  1H5S C;  3V0P A;  4FRD A;  1FGX A;  1FOA A;  5C47 A;  3E26 A;  1H4D A;  3R2W A;  3OH3 A;  4D11 C;  2WVL A;  1NKH B;  4HG6 A;  1H7E A;  2PX7 A;  3USR A;  2P6W A;  1O0R A;  3OAM A;  3KIA A;  2YCM A;  3CKO A;  3F1Y A;  4KQL A;  3ZGG A;  1HM0 A;  3PNN A;  1I52 A;  4Y7U A;  4AYL A;  1FXO A;  1R82 A;  2VSI A;  4KPX A;  1G97 A;  2VFZ A;  5C3D A;  1ZDG A;  4YS8 A;  2E8B A;  1FRW A;  1FG5 N;  3QVB A;  1H5S A;  3V0O A;  2JCK A;  3ZLK A;  2VS5 A;  4HO8 A;  1ZJ2 A;  1HM9 A;  2Z86 A;  3I0L A;  3I0H A;  5FYE A;  4KRV A;  2VS3 A;  4M2A A;  1R7V A;  4R7P A;  4ARW A;  1XZ6 A;  4ASY A;  3OH2 A;  3HL3 A;  1MP5 A;  2X5S A;  4JD0 A;  3SX3 A;  1GWV A;  1VPA A;  1WT3 A;  2V0H A;  3E25 A;  4KXO A;  2X60 A;  1VH1 A;  1V84 A;  3GUE A;  4HO5 A;  1S4P A;  4B2X A;  2I5E A; 
#chains in the Genus database with same CATH homology
 3D8V A;  3T7M A;  1FO8 A;  1ZJP A;  4Y7F A;  2D7I A;  1ON6 A;  2VD4 A;  4D0T A;  5C4C A;  4DEC A;  5IFY A;  3T7O A;  2Y7A A;  1G23 A;  3OH1 A;  3OH4 A;  3F1C A;  1W77 A;  5CMF X;  2X65 A;  2FY7 A;  1FWY A;  3N9W A;  1WSZ A;  1OQM B;  5CMJ A;  2Q4J A;  4JIS A;  1HV9 A;  1H4C A;  2VS4 A;  1JV1 A;  1ZDF A;  2Y4K A;  1VZX A;  3Q80 A;  4P00 A;  2JCO A;  2YQJ A;  5CQO A;  2AES A;  2P73 A;  2QH5 A;  2FYC B;  3DK5 A;  1JVD A;  1W55 A;  4Y7T A;  1NWG B;  3V8Y A;  1R7U A;  2O1G A;  1ZJ1 A;  4FRM A;  5FTS A;  1VGW A;  3PKQ A;  2V0J A;  4C2S A;  4EEM A;  4J18 A;  2AEC A;  4K6R A;  2WGZ A;  3U0Y A;  2RIZ A;  2PGV A;  3CKJ A;  2D7R A;  1Z90 A;  2AE7 A;  3I0K A;  1QG8 A;  3SXA A;  2NXV A;  4DE7 A;  2W0V A;  4LW3 A;  1O7O A;  1QWJ A;  1TVY A;  3PKP A;  2RIX A;  4G3Q A;  4FIY A;  3U2T A;  1LL0 A;  5J49 A;  4XWI A;  2VSH A;  4HCQ A;  1FR8 A;  5C4D A;  5EJZ A;  2WVM A;  4AAW A;  3OH0 A;  4O6N A;  2I5K A;  3I0I X;  2ZU7 A;  1WT2 A;  1VGU A;  1E5K A;  3TQD A;  5C4F A;  1V83 A;  3K8D A;  2BO8 A;  2C0N A;  3BCV A;  1H7Q A;  2RJ6 A;  4IRQ A;  3ZF8 A;  5C49 A;  2YQC A;  1HJL A;  4FRO A;  1TZF A;  3OKR A;  5IDT A;  4HO4 A;  4G87 A;  3U0X A;  2RIT A;  1QGS A;  5C3A A;  1LZJ A;  4KC1 A;  3LW6 A;  3O3P A;  4CJ8 A;  2YES A;  2WAW A;  3USQ A;  1K4V A;  5CQM X;  2UX8 A;  1G1L A;  1ZCU A;  5CMH A;  5L6V A;  3V91 A;  4B5B A;  1HJJ A;  3ZGF A;  2FYA A;  2AH9 A;  1G95 A;  2WVK A;  1R7Y A;  2Y4L A;  2YQH A;  2FFU A;  4KC4 A;  1LZI A;  1INJ A;  4E1K A;  3SXG A;  1KWS A;  1JV3 A;  4Y62 A;  1ZI1 A;  2PGY A;  2OI6 A;  1ON8 A;  3JUK A;  2VXL A;  5BXC A;  1V82 A;  4D11 A;  2YQS A;  3IOI A;  4HO6 A;  1G2V A;  4FRH A;  1QGQ A;  3SX5 A;  1MP4 A;  1R7X A;  4GBP A;  5DDV A;  1G3L A;  4HO9 A;  4Y7G A;  2DPW A;  1WT1 A;  1ZIZ A;  4ZDQ A;  3BRK X;  3SX7 A;  2MZB A;  3CKQ A;  3CU0 A;  3V0L A;  1LL3 A;  5C3B A;  1GQ9 A;  1ZJ3 A;  4B4M A;  2FFV A;  1NMM B;  2CU2 A;  1ZI5 A;  4NAL A;  4M28 A;  4B42 A;  1H7L A;  2XWM A;  2I7B A;  1VGZ A;  1LVW A;  1MP3 A;  1W57 A;  4BQH A;  1VZT A;  2GGQ A;  4DDZ A;  4Y64 A;  1H5S D;  2ZU9 A;  2ICY A;  4CVH A;  2PA4 A;  4FRA A;  5D92 A;  4FCE A;  1FO9 A;  3FOQ A;  4KNX A;  1H5R A;  4FRQ A;  1H3M A;  1ZI3 A;  3FWW A;  2RIY A;  5C48 A;  4ASJ A;  5FUH A;  1GA8 A;  3Q4S A;  3CKV A;  2VXM A;  2YC5 A;  1GX0 A;  3K8E A;  2P72 A;  4NAK A;  4AYJ A;  1GX4 A;  2RJ4 A;  5FU0 A;  4HO2 A;  4MND A;  4CJB A;  1H5S B;  2JCJ A;  5C8R A;  1IIM A;  1LZ7 A;  4FRB A;  2XMH A;  3U2X A;  2RJ9 A;  1YRO B;  4LW6 A;  3TZT A;  5C1G A;  4FQW A;  5C1H A;  2X5Z A;  1OMX A;  4FRL A;  2XWL A;  4G3P A;  2J0A A;  5L6S A;  1H4E A;  4G3S A;  3U2V A;  1HM8 A;  4KNR A;  4FRE A;  1OMZ A;  1FXJ A;  1VIC A;  3RMW A;  2A8W A;  1YP2 A;  2O1F A;  2WE9 A;  4UEG A;  2V0I A;  3V0Q A;  1EZI A;  3SXB A;  1VH3 A;  1VZU A;  3I0J A;  3NGW A;  2QKX A;  4B3U A;  5CMI A;  5I1F A;  2V0K A;  1MC3 A;  5C38 A;  1G93 A;  1H7F A;  2D0J A;  1ZJO A;  1EYR A;  1VGT A;  1LL2 A;  4EEA A;  3DJ4 A;  4NAN A;  2RJ7 A;  3JUJ A;  1H5R B;  1NQI B;  2JCL A;  4KC2 A;  1S4N A;  2VK9 A;  2Y6P A;  4CJC A;  3V8Z A;  5AJO A;  3Q7U A;  4EE4 A;  2GGO A;  4AC3 A;  2BO4 A;  2ICX A;  2Y4M A;  3CKN A;  1S4O A;  3D98 A;  3CGX A;  3RSB A;  2ZU8 A;  3I0D A;  2QGI A;  4FRP A;  4IRP A;  5CQP A;  4M4K A;  5C36 A;  3POL A;  2BO7 A;  4FIX A;  2OEF A;  5HS2 A;  3SXD A;  3V0M A;  1JVG A;  5C4E A;  3R3I A;  1FZW A;  1JYL A;  1G8O A;  1ZHJ A;  5C1L A;  5IDS A;  4HO0 A;  5FTV A;  4KPZ A;  1FGG A;  3V90 A;  1H5T A;  5C4B A;  3ST8 A;  4EE3 A;  3I0C A;  1LZ0 A;  4Y7V A;  1ZJ0 A;  4Q7C A;  1GQC A;  1H7H A;  1YP3 A;  5EJ1 A;  1R80 A;  5AJP A;  4EEG A;  1IIN A;  4HOC A;  1INI A;  5FV9 A;  5JQQ A;  1TW5 A;  1G9R A;  2AM5 A;  3U2W A;  2OI5 A;  2XWN A;  4B2W A;  1GWW A;  1TW1 A;  1ZCY A;  3OGZ A;  1WVC A;  2APC A;  2OI7 A;  4HO3 A;  4L41 C;  1SS9 A;  4ECM A;  4D0Z A;  3SXC A;  4EE5 A;  4M2B A;  2OEG A;  2RJ0 A;  4B4G A;  4Y6N A;  1PZT A;  2A8U A;  4NAI A;  2V0L A;  2W0W A;  3U2U A;  5AJN A;  4MIX A;  1ZCT A;  1ZCV A;  4MYB A;  4FCU A;  2O1H A;  4D48 A;  5DDT A;  2FYB A;  5D91 A;  3JTJ A;  4EEO A;  1NF5 B;  2AGD A;  2BO6 A;  4Y9X A;  1O23 B;  4Y63 A;  4Y6U A;  5CQN X;  3ZLL A;  5FU8 A;  2FYD B;  3RMV A;  2AM3 A;  4P02 A;  2E3D A;  3D5N A;  1FR9 A;  1H7T A;  1XHB A;  2Y4J A;  4KT7 A;  4O6M A;  3DUV A;  2WEE A;  3SXE A;  4EVW A;  5EIY A;  4BMA A;  1PZY B;  1NHE B;  1O7Q A;  2RJ8 A;  3IOJ A;  5CMG X;  1H5T B;  1WT0 A;  2RJ5 A;  1YP4 A;  3T7N A;  3I0E A;  3V0N A;  2Z87 A;  3IOH A;  2YC3 A;  1ZI4 A;  1R81 A;  4B4B A;  1JYK A;  1H7G A;  3I0F A;  3I0G A;  1G0R A;  3SX8 A;  3SPT A;  5CQL X;  3EE5 A;  1R7T A;  1VM8 A;  2AM4 A;  2J0B A;  3OC9 A;  2XME A;  2RJ1 A;  1H5S C;  3V0P A;  4FRD A;  1FGX A;  1FOA A;  5C47 A;  3E26 A;  1H4D A;  3R2W A;  3OH3 A;  4D11 C;  2WVL A;  1NKH B;  4HG6 A;  1H7E A;  2PX7 A;  3USR A;  2P6W A;  1O0R A;  3OAM A;  3KIA A;  2YCM A;  3CKO A;  3F1Y A;  4KQL A;  3ZGG A;  1HM0 A;  3PNN A;  1I52 A;  4Y7U A;  4AYL A;  1FXO A;  1R82 A;  2VSI A;  4KPX A;  1G97 A;  2VFZ A;  5C3D A;  1ZDG A;  4YS8 A;  2E8B A;  1FRW A;  1FG5 N;  3QVB A;  1H5S A;  3V0O A;  2JCK A;  3ZLK A;  2VS5 A;  4HO8 A;  1ZJ2 A;  1HM9 A;  2Z86 A;  3I0L A;  3I0H A;  5FYE A;  4KRV A;  2VS3 A;  4M2A A;  1R7V A;  4R7P A;  4ARW A;  1XZ6 A;  4ASY A;  3OH2 A;  3HL3 A;  1MP5 A;  2X5S A;  4JD0 A;  3SX3 A;  1GWV A;  1VPA A;  1WT3 A;  2V0H A;  3E25 A;  4KXO A;  2X60 A;  1VH1 A;  1V84 A;  3GUE A;  4HO5 A;  1S4P A;  4B2X A;  2I5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...