1NMMB

Beta-1,4-galactosyltransferase mutant cys342thr complex with alpha-lactalbumin and glcnac
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
272
structure length
272
Chain Sequence
LTACPEESPLLVGPMLIEFNIPVDLKLVEQQNPKVKLGGRYTPMDCISPHKVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGESMFNRAKLLNVGFKEALKDYDYNCFVFSDVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLSINGFPNNYWGWGGEDDDIYNRLAFRGMSVSRPNAVIGKTRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYMVLEVQRYPLYTKITVDIGTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title alpha-Lactalbumin (LA) stimulates milk beta-1,4-galactosyltransferase I (beta 4Gal-T1) to transfer glucose from UDP-glucose to N-acetylglucosamine. Crystal structure of beta 4Gal-T1 x LA complex with UDP-Glc.
pubmed doi rcsb
molecule keywords ALPHA-LACTALBUMIN
molecule tags Transferase activator/transferase
source organism Mus musculus
total genus 92
structure length 272
sequence length 272
chains with identical sequence D
ec nomenclature ec 2.4.1.22: Lactose synthase.
pdb deposition date 2003-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02709 Glyco_transf_7C N-terminal domain of galactosyltransferase
B PF13733 Glyco_transf_7N N-terminal region of glycosyl transferase group 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1nmmB00
1H5RB 2AM3A 2RJ1A 1LL3A 3PNNA 2VS5A 3I0KA 4NANA 2OI6A 5C4BA 1ZJ2A 1H7LA 3CU0A 1PZTA 5EJ1A 2WEEA 4KRVA 2VSHA 1O0RA 1ZI1A 2X60A 1R81A 4NAIA 4DECA 1G97A 3ZGGA 3E26A 4KPXA 3CGXA 4G3SA 2BO4A 1GWVA 3FWWA 2JCLA 4BQHA 1WT3A 4IRQA 2Y4JA 1SS9A 2XWLA 2MZBA 1VZXA 2FYBA 4Y7VA 5AJNA 3POLA 1OMXA 5AJOA 3V8ZA 4B2WA 4MYBA 3JUKA 1O7QA 2V0JA 3I0CA 5C3DA 4Y9XA 3JTJA 1FO9A 3Q4SA 4FRDA 3I0LA 3SXBA 3SX7A 4HO8A 3K8DA 3RMVA 3O3PA 2RJ7A 2BO6A 4B4MA 2FY7A 2QKXA 4D0TA 1H4CA 2RJ5A 2PGVA 3OGZA 1O23B 1FO8A 5FV9A 3SX8A 5HS2A 1VZUA 3SXCA 2WVMA 5AJPA 4D48A 2RIYA 3I0EA 5CMFX 2PX7A 1IINA 1MP4A 4KNRA 1INIA 1H3MA 4P00A 4HO2A 2ZU7A 1VGTA 1G2VA 2VXLA 3OH0A 5FYEA 2RJ0A 3R2WA 2O1GA 3Q80A 4Y7UA 1JYLA 1QGQA 1NF5B 5CQNX 5DDTA 1WSZA 2A8UA 2AECA 3F1CA 4AYJA 1LL0A 2AE7A 1R7XA 3IOIA 1JVDA 1H7HA 3IOJA 1INJA 5FU8A 2BO8A 1NMMB 4FCUA 5L6VA 1R80A 5C4CA 1H7EA 2DPWA 1FXOA 1FGXA 1TZFA 5C8RA 4HO9A 1VGUA 1GWWA 3D8VA 4GBPA 4HO0A 4JD0A 4ZDQA 3CKOA 4B3UA 1FRWA 1NHEB 4G87A 3I0GA 1H7QA 1OMZA 1GQ9A 2OI7A 1G8OA 4FRMA 1ZIZA 2W0WA 3TZTA 4M28A 1G0RA 1H5SD 2ZU9A 1VICA 2WAWA 4Y7FA 4FRPA 2JCKA 1WVCA 1GX4A 3U0YA 3SXAA 3OKRA 4KC2A 3V0PA 3DJ4A 1NWGB 1ZDGA 4FROA 4FRQA 4FREA 4G3QA 3NGWA 1YROB 4P02A 1XZ6A 4HO5A 2VS3A 4NALA 4EEOA 2ICYA 5C4EA 1HJLA 2P72A 1S4PA 2D0JA 3SX3A 1TW5A 4UEGA 5IDSA 5IDTA 4EE4A 3T7MA 1ZDFA 3CKQA 4HCQA 3SXDA 2O1FA 4KC1A 2D7IA 4KC4A 3RMWA 3V0NA 4HOCA 2YCMA 1ON6A 2V0HA 4G3PA 1TW1A 1H7FA 1QG8A 5CMIA 2RJ4A 1EZIA 2WGZA 4C2SA 4IRPA 2I5KA 4Y6UA 4FCEA 4KQLA 1R7VA 3I0DA 3T7OA 2A8WA 1VPAA 3U2VA 1ZI4A 4CJCA 2Z87A 2E3DA 5CMGX 2XMEA 2YQJA 4EE5A 4FRLA 2O1HA 1H4DA 4B5BA 1OQMB 2Z86A 1S4OA 2FFVA 3IOHA 3U2WA 2Y7AA 1HM9A 1ZJ3A 2RJ9A 1R7TA 2AGDA 1H7TA 1H4EA 1LZ7A 4HO4A 5FU0A 2P6WA 3V91A 1VGWA 2FYDB 2XWNA 1GQCA 4D11C 3V0QA 4XWIA 4DDZA 3D5NA 4Y63A 4AC3A 3I0FA 2VD4A 2XMHA 3QVBA 2PA4A 4Y7TA 1ZCVA 2ZU8A 1YP2A 5IFYA 2P73A 5FTVA 1V82A 4YS8A 4B42A 4Y6NA 1W57A 1G23A 1FXJA 2GGOA 2Y4LA 1GA8A 1KWSA 1S4NA 3OH3A 3SX5A 2RIXA 3KIAA 3I0HA 3SXGA 1FR9A 1FR8A 4Y7GA 3T7NA 5C49A 5CMJA 3E25A 4Y64A 1HM8A 5C4DA 1YP4A 4AAWA 4ASYA 1R7YA 4KPZA 4Y62A 4R7PA 1H5TA 1WT1A 4FRHA 3I0JA 3U0XA 3ST8A 1YP3A 2VXMA 1G93A 1MP3A 2E8BA 1ZCTA 1QGSA 1V84A 2FYCB 1H5TB 1FG5N 1LZJA 4ECMA 5L6SA 5DDVA 3U2UA 4LW6A 4E1KA 1FZWA 4M2AA 4CJ8A 2RIZA 2XWMA 2Y4MA 2YQSA 2V0LA 3SXEA 3V90A 5C47A 2APCA 1VZTA 4CJBA 5I1FA 2QH5A 2D7RA 5CQLX 5C38A 3ZGFA 1JVGA 5CQMX 1HM0A 1JYKA 3JUJA 2Y4KA 1H5SC 4KXOA 2JCJA 2NXVA 4LW3A 3ZF8A 3BRKX 4EEMA 5FTSA 2WVLA 1NKHB 1H7GA 5C48A 1LZIA 1VM8A 5C36A 1W55A 1ZJ0A 4J18A 4AYLA 2GGQA 4K6RA 3FOQA 3ZLLA 3V0LA 3U2TA 2BO7A 4B2XA 2AH9A 1WT0A 3V0MA 5EIYA 1G1LA 2VSIA 3F1YA 1FWYA 2YQHA 5CMHA 4EEGA 4FRBA 3USQA 4NAKA 1G3LA 2YQCA 2FYAA 1IIMA 5C3AA 3TQDA 4BMAA 2VS4A 1MC3A 1QWJA 2V0IA 3DUVA 5C1LA 5CQPA 4FRAA 4JISA 1LZ0A 1XHBA 3DK5A 4HO6A 2X65A 1I52A 4D11A 4ASJA 1PZYB 2V0KA 2RITA 1ZJ1A 2QGIA 2JCOA 2YC5A 3N9WA 5EJZA 2X5ZA 1VGZA 1ZI3A 1O7OA 5C1HA 4EE3A 4B4GA 2RJ6A 2FFUA 2X5SA 3BCVA 4KNXA 2ICXA 2OEGA 3D98A 1ZJPA 3LW6A 5C1GA 1ON8A 1TVYA 2WE9A 1K4VA 3CKJA 4CVHA 2WVKA 2VFZA 4M4KA 3OH2A 2RJ8A 1E5KA 1JV1A 1VH3A 2PGYA 3SPTA 2YESA 2AM5A 1LVWA 1LL2A 3PKQA 3K8EA 2OEFA 1R82A 1WT2A 3V0OA 4D0ZA 3OH4A 2W0VA 3U2XA 3HL3A 2YC3A 1MP5A 2Q4JA 3OH1A 5FUHA 1R7UA 4HG6A 4L41C 1EYRA 2CU2A 3EE5A 3OAMA 1ZJOA 3ZLKA 2I5EA 1HJJA 4EEAA 3OC9A 2UX8A 3RSBA 1NQIB 3CKVA 2Y6PA 4ARWA 1GX0A 3V8YA 2AM4A 2I7BA 4FQWA 2OI5A 5C3BA 1G9RA 1FGGA 1ZCUA 5J49A 5BXCA 2AESA 1H5SA 1V83A 1Z90A 1ZHJA 1JV3A 4KT7A 5CQOA 4EVWA 3GUEA 4B4BA 1ZI5A 1H5RA 4MNDA 3PKPA 3Q7UA 1G95A 1ZCYA 4HO3A 3USRA 4DE7A 3I0IX 3R3IA 1H5SB 4M2BA 1VH1A 1W77A 5JQQA 1FOAA 5C4FA 1HV9A 3CKNA
chains in the Genus database with same CATH superfamily
1H5RB 2AM3A 2RJ1A 1LL3A 3PNNA 2VS5A 3I0KA 4FIXA 4NANA 2OI6A 5C4BA 1ZJ2A 1H7LA 3CU0A 1PZTA 5EJ1A 2WEEA 4KRVA 2VSHA 1O0RA 1ZI1A 2X60A 1R81A 4NAIA 4DECA 1G97A 3ZGGA 3E26A 4KPXA 3CGXA 4G3SA 2BO4A 1GWVA 3FWWA 2JCLA 4BQHA 1WT3A 4IRQA 2Y4JA 1SS9A 2XWLA 2MZBA 1VZXA 2FYBA 4Y7VA 5AJNA 3POLA 1OMXA 5AJOA 3V8ZA 4B2WA 4MYBA 3JUKA 1O7QA 2V0JA 3I0CA 5C3DA 4Y9XA 3JTJA 4O6MA 1FO9A 3Q4SA 4FRDA 3I0LA 3SXBA 3SX7A 4HO8A 3K8DA 3RMVA 3O3PA 2RJ7A 2BO6A 4B4MA 2FY7A 2QKXA 2C0NA 4D0TA 1H4CA 2RJ5A 2PGVA 3OGZA 1O23B 1FO8A 5FV9A 3SX8A 5HS2A 1VZUA 3SXCA 2WVMA 5AJPA 4D48A 2RIYA 3I0EA 5CMFX 2PX7A 1IINA 1MP4A 4KNRA 1INIA 1H3MA 4P00A 4HO2A 2ZU7A 1VGTA 1G2VA 2VXLA 3OH0A 5FYEA 2RJ0A 3R2WA 2O1GA 3Q80A 4Y7UA 1JYLA 1QGQA 1NF5B 5CQNX 5DDTA 1WSZA 2A8UA 2AECA 3F1CA 4AYJA 1LL0A 2AE7A 1R7XA 3IOIA 1JVDA 1H7HA 3IOJA 1INJA 5FU8A 2BO8A 1NMMB 4FCUA 5L6VA 1R80A 5C4CA 1H7EA 2DPWA 1FXOA 1FGXA 1TZFA 5C8RA 4HO9A 1VGUA 1GWWA 3D8VA 4GBPA 4HO0A 4JD0A 4ZDQA 3CKOA 4B3UA 1FRWA 1NHEB 4G87A 3I0GA 1H7QA 1OMZA 1GQ9A 2OI7A 1G8OA 4FRMA 5D92A 1ZIZA 2W0WA 3TZTA 4M28A 1G0RA 1H5SD 2ZU9A 1VICA 2WAWA 4O6NA 4Y7FA 4FRPA 2JCKA 1WVCA 1GX4A 3U0YA 3SXAA 3OKRA 4KC2A 3V0PA 3DJ4A 1NWGB 1ZDGA 4FROA 4FRQA 4FREA 4G3QA 3NGWA 1YROB 4P02A 1XZ6A 4HO5A 2VS3A 4NALA 4EEOA 2ICYA 5C4EA 1HJLA 2P72A 1S4PA 2D0JA 3SX3A 1TW5A 4UEGA 5IDSA 5IDTA 4EE4A 3T7MA 1ZDFA 3CKQA 4HCQA 3SXDA 2O1FA 4KC1A 2D7IA 4KC4A 3RMWA 3V0NA 4HOCA 2YCMA 1ON6A 2V0HA 4G3PA 1TW1A 1H7FA 1QG8A 5CMIA 2RJ4A 1EZIA 2WGZA 4C2SA 4IRPA 2I5KA 4Y6UA 4FCEA 4KQLA 1R7VA 3I0DA 3T7OA 2A8WA 1VPAA 3U2VA 1ZI4A 4CJCA 4MIXA 2Z87A 2E3DA 5CMGX 2XMEA 2YQJA 4EE5A 4FRLA 2O1HA 1H4DA 4B5BA 1OQMB 2Z86A 1S4OA 2FFVA 3IOHA 3U2WA 2Y7AA 1HM9A 1ZJ3A 2RJ9A 1R7TA 2AGDA 1H7TA 5D91A 1H4EA 1LZ7A 4HO4A 5FU0A 2P6WA 3V91A 1VGWA 2FYDB 2XWNA 1GQCA 4D11C 3V0QA 4XWIA 4DDZA 3D5NA 4Y63A 4AC3A 3I0FA 2VD4A 2XMHA 3QVBA 2PA4A 4Y7TA 1ZCVA 2ZU8A 1YP2A 5IFYA 2P73A 5FTVA 1V82A 4YS8A 4B42A 4Y6NA 1W57A 1G23A 1FXJA 2GGOA 2Y4LA 1GA8A 1KWSA 1S4NA 3OH3A 3SX5A 2RIXA 3KIAA 3I0HA 3SXGA 1FR9A 1FR8A 4Y7GA 3T7NA 5C49A 5CMJA 3E25A 4Y64A 1HM8A 5C4DA 1YP4A 4AAWA 4ASYA 1R7YA 4KPZA 4Y62A 4R7PA 1H5TA 1WT1A 4FRHA 3I0JA 3U0XA 3ST8A 1YP3A 2VXMA 1G93A 1MP3A 2E8BA 1ZCTA 1QGSA 1V84A 2FYCB 1H5TB 1FG5N 1LZJA 4ECMA 5L6SA 5DDVA 3U2UA 4LW6A 4E1KA 1FZWA 4M2AA 4CJ8A 2RIZA 2XWMA 2Y4MA 2YQSA 2V0LA 3SXEA 3V90A 5C47A 2APCA 2J0AA 1VZTA 4CJBA 5I1FA 2QH5A 2D7RA 5CQLX 5C38A 3ZGFA 1JVGA 5CQMX 1HM0A 1JYKA 3JUJA 2Y4KA 1H5SC 4KXOA 2JCJA 2NXVA 2J0BA 4LW3A 3ZF8A 3BRKX 4EEMA 5FTSA 2WVLA 1NKHB 1H7GA 5C48A 1LZIA 1VM8A 5C36A 1W55A 1ZJ0A 4J18A 4AYLA 2GGQA 4K6RA 3FOQA 3ZLLA 3V0LA 3U2TA 2BO7A 4B2XA 2AH9A 1WT0A 3V0MA 5EIYA 1G1LA 2VSIA 3F1YA 1FWYA 2YQHA 5CMHA 4EEGA 4FRBA 3USQA 4NAKA 1G3LA 2YQCA 2FYAA 1IIMA 5C3AA 3TQDA 4BMAA 2VS4A 1MC3A 1QWJA 2V0IA 3DUVA 5C1LA 4FIYA 5CQPA 4FRAA 4JISA 1LZ0A 1XHBA 3DK5A 4HO6A 2X65A 1I52A 4D11A 4ASJA 1PZYB 2V0KA 2RITA 1ZJ1A 2QGIA 2VK9A 2JCOA 2YC5A 3N9WA 5EJZA 2X5ZA 1VGZA 1ZI3A 1O7OA 5C1HA 4EE3A 4B4GA 2RJ6A 2FFUA 2X5SA 3BCVA 4KNXA 2ICXA 2OEGA 3D98A 1ZJPA 3LW6A 5C1GA 1ON8A 1TVYA 2WE9A 1K4VA 3CKJA 4CVHA 2WVKA 2VFZA 4M4KA 3OH2A 2RJ8A 1E5KA 1JV1A 1VH3A 2PGYA 3SPTA 2YESA 2AM5A 1LVWA 1LL2A 3PKQA 3K8EA 2OEFA 1R82A 1WT2A 3V0OA 4D0ZA 3OH4A 2W0VA 3U2XA 3HL3A 2YC3A 1MP5A 2Q4JA 3OH1A 5FUHA 1R7UA 4HG6A 4L41C 1EYRA 2CU2A 3EE5A 3OAMA 4Q7CA 1ZJOA 3ZLKA 2I5EA 1HJJA 4EEAA 3OC9A 2UX8A 3RSBA 1NQIB 3CKVA 2Y6PA 4ARWA 1GX0A 3V8YA 2AM4A 2I7BA 4FQWA 2OI5A 5C3BA 1G9RA 1FGGA 1ZCUA 5J49A 5BXCA 2AESA 1H5SA 1V83A 1Z90A 1ZHJA 1JV3A 4KT7A 5CQOA 4EVWA 3GUEA 4B4BA 1ZI5A 1H5RA 4MNDA 3PKPA 3Q7UA 1G95A 1ZCYA 4HO3A 3USRA 4DE7A 3I0IX 3R3IA 1H5SB 4M2BA 1VH1A 1W77A 5JQQA 1FOAA 5C4FA 1HV9A 3CKNA
chains in the Genus database with same CATH topology
1H5RB 2AM3A 2RJ1A 1LL3A 3PNNA 2VS5A 3I0KA 4FIXA 4NANA 2OI6A 5C4BA 1ZJ2A 1H7LA 3CU0A 1PZTA 5EJ1A 2WEEA 4KRVA 2VSHA 1O0RA 1ZI1A 2X60A 1R81A 4NAIA 4DECA 1G97A 3ZGGA 3E26A 4KPXA 3CGXA 4G3SA 2BO4A 1GWVA 3FWWA 2JCLA 4BQHA 1WT3A 4IRQA 2Y4JA 1SS9A 2XWLA 2MZBA 1VZXA 2FYBA 4Y7VA 5AJNA 3POLA 1OMXA 5AJOA 3V8ZA 4B2WA 4MYBA 3JUKA 1O7QA 2V0JA 3I0CA 5C3DA 4Y9XA 3JTJA 4O6MA 1FO9A 3Q4SA 4FRDA 3I0LA 3SXBA 3SX7A 4HO8A 3K8DA 3RMVA 3O3PA 2RJ7A 2BO6A 4B4MA 2FY7A 2QKXA 2C0NA 4D0TA 1H4CA 2RJ5A 2PGVA 3OGZA 1O23B 1FO8A 5FV9A 3SX8A 5HS2A 1VZUA 3SXCA 2WVMA 5AJPA 4D48A 2RIYA 3I0EA 5CMFX 2PX7A 1IINA 1MP4A 4KNRA 1INIA 1H3MA 4P00A 4HO2A 2ZU7A 1VGTA 1G2VA 2VXLA 3OH0A 5FYEA 2RJ0A 3R2WA 2O1GA 3Q80A 4Y7UA 1JYLA 1QGQA 1NF5B 5CQNX 5DDTA 1WSZA 2A8UA 2AECA 3F1CA 4AYJA 1LL0A 2AE7A 1R7XA 3IOIA 1JVDA 1H7HA 3IOJA 1INJA 5FU8A 2BO8A 1NMMB 4FCUA 5L6VA 1R80A 5C4CA 1H7EA 2DPWA 1FXOA 1FGXA 1TZFA 5C8RA 4HO9A 1VGUA 1GWWA 3D8VA 4GBPA 4HO0A 4JD0A 4ZDQA 3CKOA 4B3UA 1FRWA 1NHEB 4G87A 3I0GA 1H7QA 1OMZA 1GQ9A 2OI7A 1G8OA 4FRMA 5D92A 1ZIZA 2W0WA 3TZTA 4M28A 1G0RA 1H5SD 2ZU9A 1VICA 2WAWA 4O6NA 4Y7FA 4FRPA 2JCKA 1WVCA 1GX4A 3U0YA 3SXAA 3OKRA 4KC2A 3V0PA 3DJ4A 1NWGB 1ZDGA 4FROA 4FRQA 4FREA 4G3QA 3NGWA 1YROB 4P02A 1XZ6A 4HO5A 2VS3A 4NALA 4EEOA 2ICYA 5C4EA 1HJLA 2P72A 1S4PA 2D0JA 3SX3A 1TW5A 4UEGA 5IDSA 5IDTA 4EE4A 3T7MA 1ZDFA 3CKQA 4HCQA 3SXDA 2O1FA 4KC1A 2D7IA 4KC4A 3RMWA 3V0NA 4HOCA 2YCMA 1ON6A 2V0HA 4G3PA 1TW1A 1H7FA 1QG8A 5CMIA 2RJ4A 1EZIA 2WGZA 4C2SA 4IRPA 2I5KA 4Y6UA 4FCEA 4KQLA 1R7VA 3I0DA 3T7OA 2A8WA 1VPAA 3U2VA 1ZI4A 4CJCA 4MIXA 2Z87A 2E3DA 5CMGX 2XMEA 2YQJA 4EE5A 4FRLA 2O1HA 1H4DA 4B5BA 1OQMB 2Z86A 1S4OA 2FFVA 3IOHA 3U2WA 2Y7AA 1HM9A 1ZJ3A 2RJ9A 1R7TA 2AGDA 1H7TA 5D91A 1H4EA 1LZ7A 4HO4A 5FU0A 2P6WA 3V91A 1VGWA 2FYDB 2XWNA 1GQCA 4D11C 3V0QA 4XWIA 4DDZA 3D5NA 4Y63A 4AC3A 3I0FA 2VD4A 2XMHA 3QVBA 2PA4A 4Y7TA 1ZCVA 2ZU8A 1YP2A 5IFYA 2P73A 5FTVA 1V82A 4YS8A 4B42A 4Y6NA 1W57A 1G23A 1FXJA 2GGOA 2Y4LA 1GA8A 1KWSA 1S4NA 3OH3A 3SX5A 2RIXA 3KIAA 3I0HA 3SXGA 1FR9A 1FR8A 4Y7GA 3T7NA 5C49A 5CMJA 3E25A 4Y64A 1HM8A 5C4DA 1YP4A 4AAWA 4ASYA 1R7YA 4KPZA 4Y62A 4R7PA 1H5TA 1WT1A 4FRHA 3I0JA 3U0XA 3ST8A 1YP3A 2VXMA 1G93A 1MP3A 2E8BA 1ZCTA 1QGSA 1V84A 2FYCB 1H5TB 1FG5N 1LZJA 4ECMA 5L6SA 5DDVA 3U2UA 4LW6A 4E1KA 1FZWA 4M2AA 4CJ8A 2RIZA 2XWMA 2Y4MA 2YQSA 2V0LA 3SXEA 3V90A 5C47A 2APCA 2J0AA 1VZTA 4CJBA 5I1FA 2QH5A 2D7RA 5CQLX 5C38A 3ZGFA 1JVGA 5CQMX 1HM0A 1JYKA 3JUJA 2Y4KA 1H5SC 4KXOA 2JCJA 2NXVA 2J0BA 4LW3A 3ZF8A 3BRKX 4EEMA 5FTSA 2WVLA 1NKHB 1H7GA 5C48A 1LZIA 1VM8A 5C36A 1W55A 1ZJ0A 4J18A 4AYLA 2GGQA 4K6RA 3FOQA 3ZLLA 3V0LA 3U2TA 2BO7A 4B2XA 2AH9A 1WT0A 3V0MA 5EIYA 1G1LA 2VSIA 3F1YA 1FWYA 2YQHA 5CMHA 4EEGA 4FRBA 3USQA 4NAKA 1G3LA 2YQCA 2FYAA 1IIMA 5C3AA 3TQDA 4BMAA 2VS4A 1MC3A 1QWJA 2V0IA 3DUVA 5C1LA 4FIYA 5CQPA 4FRAA 4JISA 1LZ0A 1XHBA 3DK5A 4HO6A 2X65A 1I52A 4D11A 4ASJA 1PZYB 2V0KA 2RITA 1ZJ1A 2QGIA 2VK9A 2JCOA 2YC5A 3N9WA 5EJZA 2X5ZA 1VGZA 1ZI3A 1O7OA 5C1HA 4EE3A 4B4GA 2RJ6A 2FFUA 2X5SA 3BCVA 4KNXA 2ICXA 2OEGA 3D98A 1ZJPA 3LW6A 5C1GA 1ON8A 1TVYA 2WE9A 1K4VA 3CKJA 4CVHA 2WVKA 2VFZA 4M4KA 3OH2A 2RJ8A 1E5KA 1JV1A 1VH3A 2PGYA 3SPTA 2YESA 2AM5A 1LVWA 1LL2A 3PKQA 3K8EA 2OEFA 1R82A 1WT2A 3V0OA 4D0ZA 3OH4A 2W0VA 3U2XA 3HL3A 2YC3A 1MP5A 2Q4JA 3OH1A 5FUHA 1R7UA 4HG6A 4L41C 1EYRA 2CU2A 3EE5A 3OAMA 4Q7CA 1ZJOA 3ZLKA 2I5EA 1HJJA 4EEAA 3OC9A 2UX8A 3RSBA 1NQIB 3CKVA 2Y6PA 4ARWA 1GX0A 3V8YA 2AM4A 2I7BA 4FQWA 2OI5A 5C3BA 1G9RA 1FGGA 1ZCUA 5J49A 5BXCA 2AESA 1H5SA 1V83A 1Z90A 1ZHJA 1JV3A 4KT7A 5CQOA 4EVWA 3GUEA 4B4BA 1ZI5A 1H5RA 4MNDA 3PKPA 3Q7UA 1G95A 1ZCYA 4HO3A 3USRA 4DE7A 3I0IX 3R3IA 1H5SB 4M2BA 1VH1A 1W77A 5JQQA 1FOAA 5C4FA 1HV9A 3CKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H5R B;  2AM3 A;  2RJ1 A;  1LL3 A;  3PNN A;  2VS5 A;  3I0K A;  4NAN A;  2OI6 A;  5C4B A;  1ZJ2 A;  1H7L A;  3CU0 A;  1PZT A;  5EJ1 A;  2WEE A;  4KRV A;  2VSH A;  1O0R A;  1ZI1 A;  2X60 A;  1R81 A;  4NAI A;  4DEC A;  1G97 A;  3ZGG A;  3E26 A;  4KPX A;  3CGX A;  4G3S A;  2BO4 A;  1GWV A;  3FWW A;  2JCL A;  4BQH A;  1WT3 A;  4IRQ A;  2Y4J A;  1SS9 A;  2XWL A;  2MZB A;  1VZX A;  2FYB A;  4Y7V A;  5AJN A;  3POL A;  1OMX A;  5AJO A;  3V8Z A;  4B2W A;  4MYB A;  3JUK A;  1O7Q A;  2V0J A;  3I0C A;  5C3D A;  4Y9X A;  3JTJ A;  1FO9 A;  3Q4S A;  4FRD A;  3I0L A;  3SXB A;  3SX7 A;  4HO8 A;  3K8D A;  3RMV A;  3O3P A;  2RJ7 A;  2BO6 A;  4B4M A;  2FY7 A;  2QKX A;  4D0T A;  1H4C A;  2RJ5 A;  2PGV A;  3OGZ A;  1O23 B;  1FO8 A;  5FV9 A;  3SX8 A;  5HS2 A;  1VZU A;  3SXC A;  2WVM A;  5AJP A;  4D48 A;  2RIY A;  3I0E A;  5CMF X;  2PX7 A;  1IIN A;  1MP4 A;  4KNR A;  1INI A;  1H3M A;  4P00 A;  4HO2 A;  2ZU7 A;  1VGT A;  1G2V A;  2VXL A;  3OH0 A;  5FYE A;  2RJ0 A;  3R2W A;  2O1G A;  3Q80 A;  4Y7U A;  1JYL A;  1QGQ A;  1NF5 B;  5CQN X;  5DDT A;  1WSZ A;  2A8U A;  2AEC A;  3F1C A;  4AYJ A;  1LL0 A;  2AE7 A;  1R7X A;  3IOI A;  1JVD A;  1H7H A;  3IOJ A;  1INJ A;  5FU8 A;  2BO8 A;  1NMM B;  4FCU A;  5L6V A;  1R80 A;  5C4C A;  1H7E A;  2DPW A;  1FXO A;  1FGX A;  1TZF A;  5C8R A;  4HO9 A;  1VGU A;  1GWW A;  3D8V A;  4GBP A;  4HO0 A;  4JD0 A;  4ZDQ A;  3CKO A;  4B3U A;  1FRW A;  1NHE B;  4G87 A;  3I0G A;  1H7Q A;  1OMZ A;  1GQ9 A;  2OI7 A;  1G8O A;  4FRM A;  1ZIZ A;  2W0W A;  3TZT A;  4M28 A;  1G0R A;  1H5S D;  2ZU9 A;  1VIC A;  2WAW A;  4Y7F A;  4FRP A;  2JCK A;  1WVC A;  1GX4 A;  3U0Y A;  3SXA A;  3OKR A;  4KC2 A;  3V0P A;  3DJ4 A;  1NWG B;  1ZDG A;  4FRO A;  4FRQ A;  4FRE A;  4G3Q A;  3NGW A;  1YRO B;  4P02 A;  1XZ6 A;  4HO5 A;  2VS3 A;  4NAL A;  4EEO A;  2ICY A;  5C4E A;  1HJL A;  2P72 A;  1S4P A;  2D0J A;  3SX3 A;  1TW5 A;  4UEG A;  5IDS A;  5IDT A;  4EE4 A;  3T7M A;  1ZDF A;  3CKQ A;  4HCQ A;  3SXD A;  2O1F A;  4KC1 A;  2D7I A;  4KC4 A;  3RMW A;  3V0N A;  4HOC A;  2YCM A;  1ON6 A;  2V0H A;  4G3P A;  1TW1 A;  1H7F A;  1QG8 A;  5CMI A;  2RJ4 A;  1EZI A;  2WGZ A;  4C2S A;  4IRP A;  2I5K A;  4Y6U A;  4FCE A;  4KQL A;  1R7V A;  3I0D A;  3T7O A;  2A8W A;  1VPA A;  3U2V A;  1ZI4 A;  4CJC A;  2Z87 A;  2E3D A;  5CMG X;  2XME A;  2YQJ A;  4EE5 A;  4FRL A;  2O1H A;  1H4D A;  4B5B A;  1OQM B;  2Z86 A;  1S4O A;  2FFV A;  3IOH A;  3U2W A;  2Y7A A;  1HM9 A;  1ZJ3 A;  2RJ9 A;  1R7T A;  2AGD A;  1H7T A;  1H4E A;  1LZ7 A;  4HO4 A;  5FU0 A;  2P6W A;  3V91 A;  1VGW A;  2FYD B;  2XWN A;  1GQC A;  4D11 C;  3V0Q A;  4XWI A;  4DDZ A;  3D5N A;  4Y63 A;  4AC3 A;  3I0F A;  2VD4 A;  2XMH A;  3QVB A;  2PA4 A;  4Y7T A;  1ZCV A;  2ZU8 A;  1YP2 A;  5IFY A;  2P73 A;  5FTV A;  1V82 A;  4YS8 A;  4B42 A;  4Y6N A;  1W57 A;  1G23 A;  1FXJ A;  2GGO A;  2Y4L A;  1GA8 A;  1KWS A;  1S4N A;  3OH3 A;  3SX5 A;  2RIX A;  3KIA A;  3I0H A;  3SXG A;  1FR9 A;  1FR8 A;  4Y7G A;  3T7N A;  5C49 A;  5CMJ A;  3E25 A;  4Y64 A;  1HM8 A;  5C4D A;  1YP4 A;  4AAW A;  4ASY A;  1R7Y A;  4KPZ A;  4Y62 A;  4R7P A;  1H5T A;  1WT1 A;  4FRH A;  3I0J A;  3U0X A;  3ST8 A;  1YP3 A;  2VXM A;  1G93 A;  1MP3 A;  2E8B A;  1ZCT A;  1QGS A;  1V84 A;  2FYC B;  1H5T B;  1FG5 N;  1LZJ A;  4ECM A;  5L6S A;  5DDV A;  3U2U A;  4LW6 A;  4E1K A;  1FZW A;  4M2A A;  4CJ8 A;  2RIZ A;  2XWM A;  2Y4M A;  2YQS A;  2V0L A;  3SXE A;  3V90 A;  5C47 A;  2APC A;  1VZT A;  4CJB A;  5I1F A;  2QH5 A;  2D7R A;  5CQL X;  5C38 A;  3ZGF A;  1JVG A;  5CQM X;  1HM0 A;  1JYK A;  3JUJ A;  2Y4K A;  1H5S C;  4KXO A;  2JCJ A;  2NXV A;  4LW3 A;  3ZF8 A;  3BRK X;  4EEM A;  5FTS A;  2WVL A;  1NKH B;  1H7G A;  5C48 A;  1LZI A;  1VM8 A;  5C36 A;  1W55 A;  1ZJ0 A;  4J18 A;  4AYL A;  2GGQ A;  4K6R A;  3FOQ A;  3ZLL A;  3V0L A;  3U2T A;  2BO7 A;  4B2X A;  2AH9 A;  1WT0 A;  3V0M A;  5EIY A;  1G1L A;  2VSI A;  3F1Y A;  1FWY A;  2YQH A;  5CMH A;  4EEG A;  4FRB A;  3USQ A;  4NAK A;  1G3L A;  2YQC A;  2FYA A;  1IIM A;  5C3A A;  3TQD A;  4BMA A;  2VS4 A;  1MC3 A;  1QWJ A;  2V0I A;  3DUV A;  5C1L A;  5CQP A;  4FRA A;  4JIS A;  1LZ0 A;  1XHB A;  3DK5 A;  4HO6 A;  2X65 A;  1I52 A;  4D11 A;  4ASJ A;  1PZY B;  2V0K A;  2RIT A;  1ZJ1 A;  2QGI A;  2JCO A;  2YC5 A;  3N9W A;  5EJZ A;  2X5Z A;  1VGZ A;  1ZI3 A;  1O7O A;  5C1H A;  4EE3 A;  4B4G A;  2RJ6 A;  2FFU A;  2X5S A;  3BCV A;  4KNX A;  2ICX A;  2OEG A;  3D98 A;  1ZJP A;  3LW6 A;  5C1G A;  1ON8 A;  1TVY A;  2WE9 A;  1K4V A;  3CKJ A;  4CVH A;  2WVK A;  2VFZ A;  4M4K A;  3OH2 A;  2RJ8 A;  1E5K A;  1JV1 A;  1VH3 A;  2PGY A;  3SPT A;  2YES A;  2AM5 A;  1LVW A;  1LL2 A;  3PKQ A;  3K8E A;  2OEF A;  1R82 A;  1WT2 A;  3V0O A;  4D0Z A;  3OH4 A;  2W0V A;  3U2X A;  3HL3 A;  2YC3 A;  1MP5 A;  2Q4J A;  3OH1 A;  5FUH A;  1R7U A;  4HG6 A;  4L41 C;  1EYR A;  2CU2 A;  3EE5 A;  3OAM A;  1ZJO A;  3ZLK A;  2I5E A;  1HJJ A;  4EEA A;  3OC9 A;  2UX8 A;  3RSB A;  1NQI B;  3CKV A;  2Y6P A;  4ARW A;  1GX0 A;  3V8Y A;  2AM4 A;  2I7B A;  4FQW A;  2OI5 A;  5C3B A;  1G9R A;  1FGG A;  1ZCU A;  5J49 A;  5BXC A;  2AES A;  1H5S A;  1V83 A;  1Z90 A;  1ZHJ A;  1JV3 A;  4KT7 A;  5CQO A;  4EVW A;  3GUE A;  4B4B A;  1ZI5 A;  1H5R A;  4MND A;  3PKP A;  3Q7U A;  1G95 A;  1ZCY A;  4HO3 A;  3USR A;  4DE7 A;  3I0I X;  3R3I A;  1H5S B;  4M2B A;  1VH1 A;  1W77 A;  5JQQ A;  1FOA A;  5C4F A;  1HV9 A;  3CKN A; 
#chains in the Genus database with same CATH topology
 1H5R B;  2AM3 A;  2RJ1 A;  1LL3 A;  3PNN A;  2VS5 A;  3I0K A;  4FIX A;  4NAN A;  2OI6 A;  5C4B A;  1ZJ2 A;  1H7L A;  3CU0 A;  1PZT A;  5EJ1 A;  2WEE A;  4KRV A;  2VSH A;  1O0R A;  1ZI1 A;  2X60 A;  1R81 A;  4NAI A;  4DEC A;  1G97 A;  3ZGG A;  3E26 A;  4KPX A;  3CGX A;  4G3S A;  2BO4 A;  1GWV A;  3FWW A;  2JCL A;  4BQH A;  1WT3 A;  4IRQ A;  2Y4J A;  1SS9 A;  2XWL A;  2MZB A;  1VZX A;  2FYB A;  4Y7V A;  5AJN A;  3POL A;  1OMX A;  5AJO A;  3V8Z A;  4B2W A;  4MYB A;  3JUK A;  1O7Q A;  2V0J A;  3I0C A;  5C3D A;  4Y9X A;  3JTJ A;  4O6M A;  1FO9 A;  3Q4S A;  4FRD A;  3I0L A;  3SXB A;  3SX7 A;  4HO8 A;  3K8D A;  3RMV A;  3O3P A;  2RJ7 A;  2BO6 A;  4B4M A;  2FY7 A;  2QKX A;  2C0N A;  4D0T A;  1H4C A;  2RJ5 A;  2PGV A;  3OGZ A;  1O23 B;  1FO8 A;  5FV9 A;  3SX8 A;  5HS2 A;  1VZU A;  3SXC A;  2WVM A;  5AJP A;  4D48 A;  2RIY A;  3I0E A;  5CMF X;  2PX7 A;  1IIN A;  1MP4 A;  4KNR A;  1INI A;  1H3M A;  4P00 A;  4HO2 A;  2ZU7 A;  1VGT A;  1G2V A;  2VXL A;  3OH0 A;  5FYE A;  2RJ0 A;  3R2W A;  2O1G A;  3Q80 A;  4Y7U A;  1JYL A;  1QGQ A;  1NF5 B;  5CQN X;  5DDT A;  1WSZ A;  2A8U A;  2AEC A;  3F1C A;  4AYJ A;  1LL0 A;  2AE7 A;  1R7X A;  3IOI A;  1JVD A;  1H7H A;  3IOJ A;  1INJ A;  5FU8 A;  2BO8 A;  1NMM B;  4FCU A;  5L6V A;  1R80 A;  5C4C A;  1H7E A;  2DPW A;  1FXO A;  1FGX A;  1TZF A;  5C8R A;  4HO9 A;  1VGU A;  1GWW A;  3D8V A;  4GBP A;  4HO0 A;  4JD0 A;  4ZDQ A;  3CKO A;  4B3U A;  1FRW A;  1NHE B;  4G87 A;  3I0G A;  1H7Q A;  1OMZ A;  1GQ9 A;  2OI7 A;  1G8O A;  4FRM A;  5D92 A;  1ZIZ A;  2W0W A;  3TZT A;  4M28 A;  1G0R A;  1H5S D;  2ZU9 A;  1VIC A;  2WAW A;  4O6N A;  4Y7F A;  4FRP A;  2JCK A;  1WVC A;  1GX4 A;  3U0Y A;  3SXA A;  3OKR A;  4KC2 A;  3V0P A;  3DJ4 A;  1NWG B;  1ZDG A;  4FRO A;  4FRQ A;  4FRE A;  4G3Q A;  3NGW A;  1YRO B;  4P02 A;  1XZ6 A;  4HO5 A;  2VS3 A;  4NAL A;  4EEO A;  2ICY A;  5C4E A;  1HJL A;  2P72 A;  1S4P A;  2D0J A;  3SX3 A;  1TW5 A;  4UEG A;  5IDS A;  5IDT A;  4EE4 A;  3T7M A;  1ZDF A;  3CKQ A;  4HCQ A;  3SXD A;  2O1F A;  4KC1 A;  2D7I A;  4KC4 A;  3RMW A;  3V0N A;  4HOC A;  2YCM A;  1ON6 A;  2V0H A;  4G3P A;  1TW1 A;  1H7F A;  1QG8 A;  5CMI A;  2RJ4 A;  1EZI A;  2WGZ A;  4C2S A;  4IRP A;  2I5K A;  4Y6U A;  4FCE A;  4KQL A;  1R7V A;  3I0D A;  3T7O A;  2A8W A;  1VPA A;  3U2V A;  1ZI4 A;  4CJC A;  4MIX A;  2Z87 A;  2E3D A;  5CMG X;  2XME A;  2YQJ A;  4EE5 A;  4FRL A;  2O1H A;  1H4D A;  4B5B A;  1OQM B;  2Z86 A;  1S4O A;  2FFV A;  3IOH A;  3U2W A;  2Y7A A;  1HM9 A;  1ZJ3 A;  2RJ9 A;  1R7T A;  2AGD A;  1H7T A;  5D91 A;  1H4E A;  1LZ7 A;  4HO4 A;  5FU0 A;  2P6W A;  3V91 A;  1VGW A;  2FYD B;  2XWN A;  1GQC A;  4D11 C;  3V0Q A;  4XWI A;  4DDZ A;  3D5N A;  4Y63 A;  4AC3 A;  3I0F A;  2VD4 A;  2XMH A;  3QVB A;  2PA4 A;  4Y7T A;  1ZCV A;  2ZU8 A;  1YP2 A;  5IFY A;  2P73 A;  5FTV A;  1V82 A;  4YS8 A;  4B42 A;  4Y6N A;  1W57 A;  1G23 A;  1FXJ A;  2GGO A;  2Y4L A;  1GA8 A;  1KWS A;  1S4N A;  3OH3 A;  3SX5 A;  2RIX A;  3KIA A;  3I0H A;  3SXG A;  1FR9 A;  1FR8 A;  4Y7G A;  3T7N A;  5C49 A;  5CMJ A;  3E25 A;  4Y64 A;  1HM8 A;  5C4D A;  1YP4 A;  4AAW A;  4ASY A;  1R7Y A;  4KPZ A;  4Y62 A;  4R7P A;  1H5T A;  1WT1 A;  4FRH A;  3I0J A;  3U0X A;  3ST8 A;  1YP3 A;  2VXM A;  1G93 A;  1MP3 A;  2E8B A;  1ZCT A;  1QGS A;  1V84 A;  2FYC B;  1H5T B;  1FG5 N;  1LZJ A;  4ECM A;  5L6S A;  5DDV A;  3U2U A;  4LW6 A;  4E1K A;  1FZW A;  4M2A A;  4CJ8 A;  2RIZ A;  2XWM A;  2Y4M A;  2YQS A;  2V0L A;  3SXE A;  3V90 A;  5C47 A;  2APC A;  2J0A A;  1VZT A;  4CJB A;  5I1F A;  2QH5 A;  2D7R A;  5CQL X;  5C38 A;  3ZGF A;  1JVG A;  5CQM X;  1HM0 A;  1JYK A;  3JUJ A;  2Y4K A;  1H5S C;  4KXO A;  2JCJ A;  2NXV A;  2J0B A;  4LW3 A;  3ZF8 A;  3BRK X;  4EEM A;  5FTS A;  2WVL A;  1NKH B;  1H7G A;  5C48 A;  1LZI A;  1VM8 A;  5C36 A;  1W55 A;  1ZJ0 A;  4J18 A;  4AYL A;  2GGQ A;  4K6R A;  3FOQ A;  3ZLL A;  3V0L A;  3U2T A;  2BO7 A;  4B2X A;  2AH9 A;  1WT0 A;  3V0M A;  5EIY A;  1G1L A;  2VSI A;  3F1Y A;  1FWY A;  2YQH A;  5CMH A;  4EEG A;  4FRB A;  3USQ A;  4NAK A;  1G3L A;  2YQC A;  2FYA A;  1IIM A;  5C3A A;  3TQD A;  4BMA A;  2VS4 A;  1MC3 A;  1QWJ A;  2V0I A;  3DUV A;  5C1L A;  4FIY A;  5CQP A;  4FRA A;  4JIS A;  1LZ0 A;  1XHB A;  3DK5 A;  4HO6 A;  2X65 A;  1I52 A;  4D11 A;  4ASJ A;  1PZY B;  2V0K A;  2RIT A;  1ZJ1 A;  2QGI A;  2VK9 A;  2JCO A;  2YC5 A;  3N9W A;  5EJZ A;  2X5Z A;  1VGZ A;  1ZI3 A;  1O7O A;  5C1H A;  4EE3 A;  4B4G A;  2RJ6 A;  2FFU A;  2X5S A;  3BCV A;  4KNX A;  2ICX A;  2OEG A;  3D98 A;  1ZJP A;  3LW6 A;  5C1G A;  1ON8 A;  1TVY A;  2WE9 A;  1K4V A;  3CKJ A;  4CVH A;  2WVK A;  2VFZ A;  4M4K A;  3OH2 A;  2RJ8 A;  1E5K A;  1JV1 A;  1VH3 A;  2PGY A;  3SPT A;  2YES A;  2AM5 A;  1LVW A;  1LL2 A;  3PKQ A;  3K8E A;  2OEF A;  1R82 A;  1WT2 A;  3V0O A;  4D0Z A;  3OH4 A;  2W0V A;  3U2X A;  3HL3 A;  2YC3 A;  1MP5 A;  2Q4J A;  3OH1 A;  5FUH A;  1R7U A;  4HG6 A;  4L41 C;  1EYR A;  2CU2 A;  3EE5 A;  3OAM A;  4Q7C A;  1ZJO A;  3ZLK A;  2I5E A;  1HJJ A;  4EEA A;  3OC9 A;  2UX8 A;  3RSB A;  1NQI B;  3CKV A;  2Y6P A;  4ARW A;  1GX0 A;  3V8Y A;  2AM4 A;  2I7B A;  4FQW A;  2OI5 A;  5C3B A;  1G9R A;  1FGG A;  1ZCU A;  5J49 A;  5BXC A;  2AES A;  1H5S A;  1V83 A;  1Z90 A;  1ZHJ A;  1JV3 A;  4KT7 A;  5CQO A;  4EVW A;  3GUE A;  4B4B A;  1ZI5 A;  1H5R A;  4MND A;  3PKP A;  3Q7U A;  1G95 A;  1ZCY A;  4HO3 A;  3USR A;  4DE7 A;  3I0I X;  3R3I A;  1H5S B;  4M2B A;  1VH1 A;  1W77 A;  5JQQ A;  1FOA A;  5C4F A;  1HV9 A;  3CKN A; 
#chains in the Genus database with same CATH homology
 1H5R B;  2AM3 A;  2RJ1 A;  1LL3 A;  3PNN A;  2VS5 A;  3I0K A;  4FIX A;  4NAN A;  2OI6 A;  5C4B A;  1ZJ2 A;  1H7L A;  3CU0 A;  1PZT A;  5EJ1 A;  2WEE A;  4KRV A;  2VSH A;  1O0R A;  1ZI1 A;  2X60 A;  1R81 A;  4NAI A;  4DEC A;  1G97 A;  3ZGG A;  3E26 A;  4KPX A;  3CGX A;  4G3S A;  2BO4 A;  1GWV A;  3FWW A;  2JCL A;  4BQH A;  1WT3 A;  4IRQ A;  2Y4J A;  1SS9 A;  2XWL A;  2MZB A;  1VZX A;  2FYB A;  4Y7V A;  5AJN A;  3POL A;  1OMX A;  5AJO A;  3V8Z A;  4B2W A;  4MYB A;  3JUK A;  1O7Q A;  2V0J A;  3I0C A;  5C3D A;  4Y9X A;  3JTJ A;  4O6M A;  1FO9 A;  3Q4S A;  4FRD A;  3I0L A;  3SXB A;  3SX7 A;  4HO8 A;  3K8D A;  3RMV A;  3O3P A;  2RJ7 A;  2BO6 A;  4B4M A;  2FY7 A;  2QKX A;  2C0N A;  4D0T A;  1H4C A;  2RJ5 A;  2PGV A;  3OGZ A;  1O23 B;  1FO8 A;  5FV9 A;  3SX8 A;  5HS2 A;  1VZU A;  3SXC A;  2WVM A;  5AJP A;  4D48 A;  2RIY A;  3I0E A;  5CMF X;  2PX7 A;  1IIN A;  1MP4 A;  4KNR A;  1INI A;  1H3M A;  4P00 A;  4HO2 A;  2ZU7 A;  1VGT A;  1G2V A;  2VXL A;  3OH0 A;  5FYE A;  2RJ0 A;  3R2W A;  2O1G A;  3Q80 A;  4Y7U A;  1JYL A;  1QGQ A;  1NF5 B;  5CQN X;  5DDT A;  1WSZ A;  2A8U A;  2AEC A;  3F1C A;  4AYJ A;  1LL0 A;  2AE7 A;  1R7X A;  3IOI A;  1JVD A;  1H7H A;  3IOJ A;  1INJ A;  5FU8 A;  2BO8 A;  1NMM B;  4FCU A;  5L6V A;  1R80 A;  5C4C A;  1H7E A;  2DPW A;  1FXO A;  1FGX A;  1TZF A;  5C8R A;  4HO9 A;  1VGU A;  1GWW A;  3D8V A;  4GBP A;  4HO0 A;  4JD0 A;  4ZDQ A;  3CKO A;  4B3U A;  1FRW A;  1NHE B;  4G87 A;  3I0G A;  1H7Q A;  1OMZ A;  1GQ9 A;  2OI7 A;  1G8O A;  4FRM A;  5D92 A;  1ZIZ A;  2W0W A;  3TZT A;  4M28 A;  1G0R A;  1H5S D;  2ZU9 A;  1VIC A;  2WAW A;  4O6N A;  4Y7F A;  4FRP A;  2JCK A;  1WVC A;  1GX4 A;  3U0Y A;  3SXA A;  3OKR A;  4KC2 A;  3V0P A;  3DJ4 A;  1NWG B;  1ZDG A;  4FRO A;  4FRQ A;  4FRE A;  4G3Q A;  3NGW A;  1YRO B;  4P02 A;  1XZ6 A;  4HO5 A;  2VS3 A;  4NAL A;  4EEO A;  2ICY A;  5C4E A;  1HJL A;  2P72 A;  1S4P A;  2D0J A;  3SX3 A;  1TW5 A;  4UEG A;  5IDS A;  5IDT A;  4EE4 A;  3T7M A;  1ZDF A;  3CKQ A;  4HCQ A;  3SXD A;  2O1F A;  4KC1 A;  2D7I A;  4KC4 A;  3RMW A;  3V0N A;  4HOC A;  2YCM A;  1ON6 A;  2V0H A;  4G3P A;  1TW1 A;  1H7F A;  1QG8 A;  5CMI A;  2RJ4 A;  1EZI A;  2WGZ A;  4C2S A;  4IRP A;  2I5K A;  4Y6U A;  4FCE A;  4KQL A;  1R7V A;  3I0D A;  3T7O A;  2A8W A;  1VPA A;  3U2V A;  1ZI4 A;  4CJC A;  4MIX A;  2Z87 A;  2E3D A;  5CMG X;  2XME A;  2YQJ A;  4EE5 A;  4FRL A;  2O1H A;  1H4D A;  4B5B A;  1OQM B;  2Z86 A;  1S4O A;  2FFV A;  3IOH A;  3U2W A;  2Y7A A;  1HM9 A;  1ZJ3 A;  2RJ9 A;  1R7T A;  2AGD A;  1H7T A;  5D91 A;  1H4E A;  1LZ7 A;  4HO4 A;  5FU0 A;  2P6W A;  3V91 A;  1VGW A;  2FYD B;  2XWN A;  1GQC A;  4D11 C;  3V0Q A;  4XWI A;  4DDZ A;  3D5N A;  4Y63 A;  4AC3 A;  3I0F A;  2VD4 A;  2XMH A;  3QVB A;  2PA4 A;  4Y7T A;  1ZCV A;  2ZU8 A;  1YP2 A;  5IFY A;  2P73 A;  5FTV A;  1V82 A;  4YS8 A;  4B42 A;  4Y6N A;  1W57 A;  1G23 A;  1FXJ A;  2GGO A;  2Y4L A;  1GA8 A;  1KWS A;  1S4N A;  3OH3 A;  3SX5 A;  2RIX A;  3KIA A;  3I0H A;  3SXG A;  1FR9 A;  1FR8 A;  4Y7G A;  3T7N A;  5C49 A;  5CMJ A;  3E25 A;  4Y64 A;  1HM8 A;  5C4D A;  1YP4 A;  4AAW A;  4ASY A;  1R7Y A;  4KPZ A;  4Y62 A;  4R7P A;  1H5T A;  1WT1 A;  4FRH A;  3I0J A;  3U0X A;  3ST8 A;  1YP3 A;  2VXM A;  1G93 A;  1MP3 A;  2E8B A;  1ZCT A;  1QGS A;  1V84 A;  2FYC B;  1H5T B;  1FG5 N;  1LZJ A;  4ECM A;  5L6S A;  5DDV A;  3U2U A;  4LW6 A;  4E1K A;  1FZW A;  4M2A A;  4CJ8 A;  2RIZ A;  2XWM A;  2Y4M A;  2YQS A;  2V0L A;  3SXE A;  3V90 A;  5C47 A;  2APC A;  2J0A A;  1VZT A;  4CJB A;  5I1F A;  2QH5 A;  2D7R A;  5CQL X;  5C38 A;  3ZGF A;  1JVG A;  5CQM X;  1HM0 A;  1JYK A;  3JUJ A;  2Y4K A;  1H5S C;  4KXO A;  2JCJ A;  2NXV A;  2J0B A;  4LW3 A;  3ZF8 A;  3BRK X;  4EEM A;  5FTS A;  2WVL A;  1NKH B;  1H7G A;  5C48 A;  1LZI A;  1VM8 A;  5C36 A;  1W55 A;  1ZJ0 A;  4J18 A;  4AYL A;  2GGQ A;  4K6R A;  3FOQ A;  3ZLL A;  3V0L A;  3U2T A;  2BO7 A;  4B2X A;  2AH9 A;  1WT0 A;  3V0M A;  5EIY A;  1G1L A;  2VSI A;  3F1Y A;  1FWY A;  2YQH A;  5CMH A;  4EEG A;  4FRB A;  3USQ A;  4NAK A;  1G3L A;  2YQC A;  2FYA A;  1IIM A;  5C3A A;  3TQD A;  4BMA A;  2VS4 A;  1MC3 A;  1QWJ A;  2V0I A;  3DUV A;  5C1L A;  4FIY A;  5CQP A;  4FRA A;  4JIS A;  1LZ0 A;  1XHB A;  3DK5 A;  4HO6 A;  2X65 A;  1I52 A;  4D11 A;  4ASJ A;  1PZY B;  2V0K A;  2RIT A;  1ZJ1 A;  2QGI A;  2VK9 A;  2JCO A;  2YC5 A;  3N9W A;  5EJZ A;  2X5Z A;  1VGZ A;  1ZI3 A;  1O7O A;  5C1H A;  4EE3 A;  4B4G A;  2RJ6 A;  2FFU A;  2X5S A;  3BCV A;  4KNX A;  2ICX A;  2OEG A;  3D98 A;  1ZJP A;  3LW6 A;  5C1G A;  1ON8 A;  1TVY A;  2WE9 A;  1K4V A;  3CKJ A;  4CVH A;  2WVK A;  2VFZ A;  4M4K A;  3OH2 A;  2RJ8 A;  1E5K A;  1JV1 A;  1VH3 A;  2PGY A;  3SPT A;  2YES A;  2AM5 A;  1LVW A;  1LL2 A;  3PKQ A;  3K8E A;  2OEF A;  1R82 A;  1WT2 A;  3V0O A;  4D0Z A;  3OH4 A;  2W0V A;  3U2X A;  3HL3 A;  2YC3 A;  1MP5 A;  2Q4J A;  3OH1 A;  5FUH A;  1R7U A;  4HG6 A;  4L41 C;  1EYR A;  2CU2 A;  3EE5 A;  3OAM A;  4Q7C A;  1ZJO A;  3ZLK A;  2I5E A;  1HJJ A;  4EEA A;  3OC9 A;  2UX8 A;  3RSB A;  1NQI B;  3CKV A;  2Y6P A;  4ARW A;  1GX0 A;  3V8Y A;  2AM4 A;  2I7B A;  4FQW A;  2OI5 A;  5C3B A;  1G9R A;  1FGG A;  1ZCU A;  5J49 A;  5BXC A;  2AES A;  1H5S A;  1V83 A;  1Z90 A;  1ZHJ A;  1JV3 A;  4KT7 A;  5CQO A;  4EVW A;  3GUE A;  4B4B A;  1ZI5 A;  1H5R A;  4MND A;  3PKP A;  3Q7U A;  1G95 A;  1ZCY A;  4HO3 A;  3USR A;  4DE7 A;  3I0I X;  3R3I A;  1H5S B;  4M2B A;  1VH1 A;  1W77 A;  5JQQ A;  1FOA A;  5C4F A;  1HV9 A;  3CKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...