2VS4A

The binding of udp-galactose by an active site mutant of alpha-1,3 galactosyltransferase (alpha3gt)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
288
structure length
288
Chain Sequence
SKLKLSDWFNPFKRPEVVTMTKWKAPVVWEGTYNRAVLDNYYAKQKITVGLTVFAVGRYIEHYLEEFLTSANKHFMVGHPVIFYIMVDDVSRMPLIELGPLRSFKVFKIKPEKRWQDISMMRMKTIGEHIVAHIQHEVDFLFCMDVDQVFQDKFGVETLGESVAQLQAWWYKADPNDFTYERRKESAAYIPFGEGDFYYHAAIFGGTPTQVLNITQECFKGILKDKKNDIEAQWHEESHLNKYFLLNKPTKILSPEYCWDYHIGLPADIKLVKMSWQTKEYNVVRNNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N-ACETYLLACTOSAMINIDE ALPHA-1,3-GALACTOSYLTRANSFERASE
publication title Structural Basis of Udp-Galactose Binding by Alpha- 1,3-Galactosyltransferase (Alpha3Gt): Role of Negative Charge on Aspartic Acid 316 in Structure and Activity.
pubmed doi rcsb
source organism Bos taurus
total genus 103
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 2.4.1.87: N-acetyllactosaminide 3-alpha-galactosyltransferase.
pdb deposition date 2008-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2vs4A00
3I0HA 1XZ6A 5IFYA 2D0JA 4Y6NA 4KNXA 3DUVA 4FRPA 1O0RA 1VZUA 1FRWA 3I0KA 1H4CA 3CU0A 1H5TA 3CKJA 3SXDA 3BCVA 4FRLA 1FR9A 1ZDFA 5CMIA 3CGXA 4KRVA 3OH2A 3D98A 2WEEA 3IOIA 4FRQA 2RITA 3PNNA 1W57A 1YP3A 5FTSA 3TZTA 1QGQA 1H3MA 2RIZA 3BRKX 4ECMA 2V0JA 1H7QA 3D5NA 4DE7A 5I1FA 3SX8A 1WT0A 5CQOA 4FRHA 4EE5A 1ZJPA 4P02A 2RJ6A 2I5KA 4Y7TA 2AM5A 5CQNX 1W55A 3IOJA 1GX4A 5C8RA 3V0OA 2P73A 5L6VA 1WSZA 2ZU7A 2JCKA 5C4FA 1VZXA 3ST8A 3QVBA 1ZJ0A 1R80A 3K8EA 4FRBA 3SPTA 5C4CA 1HM9A 2VS3A 2OEFA 1NHEB 4IRQA 2A8UA 4J18A 2Y6PA 3E25A 4KXOA 2GGQA 5EJZA 1ZJ3A 2OI7A 1H5SD 3IOHA 1VGWA 4B5BA 1WVCA 5C4BA 4KC1A 2W0VA 2QGIA 1W77A 3U2WA 1NWGB 1H5RA 1EZIA 3Q4SA 3JTJA 1HJJA 2OI5A 3FWWA 5C3BA 2XMEA 1H7LA 1NF5B 2RJ7A 3N9WA 4B3UA 2VSHA 4K6RA 4FREA 1FZWA 2RIXA 1H5TB 2V0LA 3V0QA 4Y7GA 3NGWA 4KNRA 1GWVA 2RJ5A 5CMJA 3R3IA 5FTVA 4M2BA 3CKQA 5C3DA 1INJA 2YQJA 1IIMA 2YQSA 1H4EA 2YC3A 1LVWA 1S4PA 2XMHA 2BO7A 3Q80A 1ZCYA 5FUHA 1FR8A 1ON6A 1V84A 4CJ8A 1VGUA 1R7UA 2AGDA 2V0IA 3I0EA 4NALA 5C3AA 3V0MA 1GA8A 2OI6A 1LL0A 5C4DA 2X60A 1VICA 4EE4A 4Y64A 3I0GA 4EVWA 4KC2A 4D11A 3CKVA 1ZDGA 5CQMX 4AYLA 1G0RA 1MP5A 1JV3A 4FQWA 1VM8A 1OMXA 3I0FA 2UX8A 5AJPA 1G23A 1ZCVA 3I0IX 1VPAA 2QH5A 1MC3A 4LW6A 3SXEA 3T7NA 3USQA 4Y6UA 1ZHJA 4ASYA 1JV1A 1YP4A 2Z87A 4HG6A 1R7XA 1H5RB 1KWSA 1PZTA 5CMGX 3SX5A 1R82A 2RJ4A 2RJ9A 4FCEA 5DDTA 3U2UA 4ASJA 1FGGA 3TQDA 2W0WA 3ZGGA 2BO8A 3R2WA 4G3SA 5L6SA 1VH1A 2YQCA 4E1KA 4D11C 1R7TA 3ZF8A 3OC9A 1FXOA 1H7TA 5CMFX 5CQLX 5EJ1A 3JUJA 4B2WA 2ICXA 3HL3A 4D0TA 4EEAA 5AJOA 2BO6A 2XWLA 4AAWA 4D0ZA 2DPWA 2XWNA 2QKXA 1WT1A 1ZI1A 1O23B 4FROA 1H7EA 4CJCA 2VFZA 1ZI3A 1GWWA 4B4MA 1HJLA 2AM4A 2WVMA 3KIAA 3GUEA 1ZI4A 1NQIB 3OH3A 2Z86A 3EE5A 2YCMA 4M4KA 3DK5A 2AECA 4G87A 1HV9A 1YROB 3Q7UA 4M28A 1ZCUA 1V82A 1H5SA 3SXBA 3T7OA 4CJBA 4CVHA 2APCA 1O7OA 1G9RA 1VH3A 4GBPA 2NXVA 1S4OA 4Y63A 2WAWA 4BMAA 2D7IA 2ZU8A 3I0JA 1JVDA 1R7YA 1Z90A 2RJ8A 5C1HA 3U0YA 1ZIZA 2A8WA 3O3PA 3USRA 4R7PA 1HM8A 1FO9A 5CQPA 4ARWA 2AE7A 1SS9A 3U2XA 5C47A 5EIYA 4KQLA 2X5ZA 4C2SA 4EEGA 4B4GA 2CU2A 3RSBA 2FFUA 1MP4A 4HO6A 3PKPA 1GQ9A 2Y4KA 3V90A 3D8VA 5DDVA 2D7RA 2MZBA 2AH9A 4NANA 2X65A 1MP3A 3SXCA 4HO9A 4EEOA 2FFVA 3OGZA 4LW3A 1ZJOA 3SXGA 4EEMA 3F1CA 1LL3A 2AESA 1IINA 2PGYA 3U0XA 4MNDA 1XHBA 2WVKA 1G93A 3OKRA 1NKHB 1INIA 4ZDQA 3RMVA 1LZJA 2V0HA 1R7VA 4KPZA 5C48A 4FCUA 2VSIA 3PKQA 2JCLA 5IDTA 2YESA 1V83A 1GX0A 1HM0A 4MYBA 1G2VA 5JQQA 4Y7UA 3SX3A 3U2TA 4JISA 4AYJA 2I7BA 2E3DA 2FY7A 4L41C 1H5SB 2X5SA 3V91A 4B2XA 4HCQA 2O1FA 2FYCB 4P00A 2RIYA 2WE9A 2I5EA 1WT2A 1VGTA 1H7GA 2WGZA 3DJ4A 5IDSA 4Y9XA 4YS8A 4FRDA 2O1HA 1TW1A 4KC4A 5BXCA 3CKOA 2JCJA 4NAKA 3OH1A 3U2VA 4DECA 2YQHA 2Q4JA 1VGZA 2FYBA 4EE3A 5FU8A 1E5KA 1QWJA 1H7FA 4FRMA 1H4DA 4UEGA 4XWIA 2GGOA 3OH0A 2AM3A 2RJ0A 1S4NA 1JVGA 4HO4A 1H7HA 2PX7A 2BO4A 1G97A 3I0LA 2YC5A 3OH4A 4HO5A 1PZYB 5C36A 3I0DA 2V0KA 3F1YA 2FYDB 4KPXA 3CKNA 4HO0A 1LL2A 3ZLKA 3ZLLA 2WVLA 2VD4A 4G3QA 2Y7AA 1I52A 4NAIA 3RMWA 3ZGFA 3OAMA 2VXMA 3LW6A 4AC3A 2PA4A 4HO8A 5CMHA 4G3PA 5C1GA 3V8YA 3E26A 3JUKA 2ICYA 2OEGA 1TZFA 5FV9A 2VS4A 5C1LA 1O7QA 2Y4LA 4BQHA 3FOQA 2PGVA 5FU0A 1ZJ1A 1FG5N 1G1LA 3K8DA 4Y7FA 2JCOA 4JD0A 3V8ZA 1JYLA 2E8BA 3V0PA 1TW5A 2RJ1A 1G3LA 2XWMA 4D48A 1LZ0A 1ZJ2A 3SX7A 1ZCTA 3V0NA 1LZIA 1ZI5A 5HS2A 4HO2A 1QGSA 1VZTA 2FYAA 4M2AA 4FRAA 2VXLA 1LZ7A 3POLA 1H5SC 1TVYA 2Y4MA 2O1GA 1JYKA 1K4VA 4Y7VA 3T7MA 4HOCA 5C49A 1FOAA 4DDZA 5C38A 1FGXA 3I0CA 1OQMB 1NMMB 2Y4JA 1FXJA 3V0LA 4B4BA 2ZU9A 5J49A 4HO3A 1R81A 3SXAA 1WT3A 2P6WA 4KT7A 5AJNA 1FWYA 1OMZA 5FYEA 4B42A 2P72A 5C4EA 1GQCA 1FO8A 2VS5A 1YP2A 1G8OA 1G95A 1QG8A 4Y62A 1EYRA 4IRPA 1ON8A
chains in the Genus database with same CATH superfamily
3I0HA 1XZ6A 5IFYA 2D0JA 4Y6NA 4KNXA 3DUVA 4FRPA 1O0RA 1VZUA 1FRWA 3I0KA 1H4CA 3CU0A 1H5TA 3CKJA 3SXDA 3BCVA 4FRLA 1FR9A 1ZDFA 5CMIA 3CGXA 4KRVA 3OH2A 5D91A 3D98A 2WEEA 3IOIA 4FRQA 2RITA 3PNNA 1W57A 1YP3A 5FTSA 3TZTA 1QGQA 1H3MA 2RIZA 3BRKX 4ECMA 2V0JA 1H7QA 3D5NA 4DE7A 5I1FA 3SX8A 1WT0A 5CQOA 4FRHA 4EE5A 1ZJPA 4P02A 2RJ6A 2I5KA 4Y7TA 2AM5A 5CQNX 1W55A 3IOJA 1GX4A 5C8RA 3V0OA 2P73A 5L6VA 1WSZA 2ZU7A 2JCKA 5C4FA 1VZXA 3ST8A 3QVBA 1ZJ0A 1R80A 3K8EA 4FRBA 3SPTA 5C4CA 1HM9A 2VS3A 2OEFA 1NHEB 4IRQA 2A8UA 4J18A 2Y6PA 3E25A 4KXOA 2GGQA 5EJZA 1ZJ3A 2OI7A 1H5SD 3IOHA 1VGWA 4B5BA 1WVCA 5C4BA 4KC1A 2W0VA 2QGIA 1W77A 3U2WA 1NWGB 1H5RA 1EZIA 3Q4SA 3JTJA 1HJJA 2OI5A 3FWWA 5C3BA 2XMEA 1H7LA 1NF5B 2RJ7A 3N9WA 4B3UA 2VSHA 4K6RA 4FREA 1FZWA 2RIXA 1H5TB 2V0LA 3V0QA 4Y7GA 3NGWA 4KNRA 1GWVA 2RJ5A 5CMJA 3R3IA 5FTVA 4M2BA 3CKQA 5C3DA 1INJA 2YQJA 1IIMA 2YQSA 1H4EA 2YC3A 1LVWA 1S4PA 2XMHA 2BO7A 3Q80A 1ZCYA 5FUHA 1FR8A 1ON6A 1V84A 4CJ8A 1VGUA 1R7UA 2AGDA 2V0IA 3I0EA 4NALA 5C3AA 3V0MA 1GA8A 2OI6A 1LL0A 5C4DA 2X60A 1VICA 4EE4A 4Y64A 3I0GA 4EVWA 4KC2A 4O6MA 4D11A 3CKVA 1ZDGA 5CQMX 4AYLA 1G0RA 1MP5A 1JV3A 4FQWA 1VM8A 1OMXA 3I0FA 2UX8A 5AJPA 1G23A 1ZCVA 3I0IX 1VPAA 2QH5A 1MC3A 4LW6A 3SXEA 3T7NA 4FIYA 3USQA 4Y6UA 1ZHJA 4ASYA 1JV1A 1YP4A 2Z87A 4HG6A 1R7XA 1H5RB 1KWSA 1PZTA 5CMGX 3SX5A 1R82A 2RJ4A 2RJ9A 4FCEA 5DDTA 3U2UA 4ASJA 1FGGA 3TQDA 2W0WA 3ZGGA 2BO8A 3R2WA 4G3SA 5L6SA 1VH1A 2YQCA 4E1KA 4D11C 1R7TA 3ZF8A 3OC9A 1FXOA 1H7TA 5CMFX 5CQLX 5EJ1A 3JUJA 4B2WA 2ICXA 3HL3A 4D0TA 4EEAA 5AJOA 2BO6A 2XWLA 4AAWA 4D0ZA 2DPWA 2XWNA 2QKXA 1WT1A 4MIXA 1ZI1A 1O23B 4FROA 1H7EA 4CJCA 2VFZA 1ZI3A 1GWWA 4B4MA 1HJLA 2AM4A 2WVMA 3KIAA 3GUEA 1ZI4A 1NQIB 3OH3A 2Z86A 3EE5A 2YCMA 4M4KA 3DK5A 2AECA 4G87A 1HV9A 1YROB 3Q7UA 4M28A 1ZCUA 1V82A 1H5SA 3SXBA 3T7OA 4CJBA 4CVHA 2APCA 1O7OA 1G9RA 1VH3A 4GBPA 2NXVA 1S4OA 4Y63A 2WAWA 4BMAA 2D7IA 2ZU8A 3I0JA 1JVDA 1R7YA 1Z90A 2J0BA 2RJ8A 5C1HA 3U0YA 1ZIZA 2A8WA 3O3PA 3USRA 4R7PA 1HM8A 1FO9A 5CQPA 4ARWA 2AE7A 1SS9A 3U2XA 5C47A 5EIYA 4KQLA 2X5ZA 4C2SA 4EEGA 4B4GA 2CU2A 3RSBA 2FFUA 1MP4A 4HO6A 3PKPA 1GQ9A 2Y4KA 3V90A 3D8VA 5DDVA 2D7RA 2MZBA 2AH9A 4NANA 2X65A 1MP3A 3SXCA 4HO9A 4EEOA 2FFVA 3OGZA 4LW3A 1ZJOA 3SXGA 4EEMA 3F1CA 1LL3A 2AESA 1IINA 2PGYA 3U0XA 4MNDA 1XHBA 2WVKA 1G93A 3OKRA 1NKHB 1INIA 4ZDQA 3RMVA 1LZJA 2V0HA 1R7VA 4KPZA 5C48A 4FCUA 2VSIA 3PKQA 2JCLA 5IDTA 2YESA 1V83A 1GX0A 1HM0A 4MYBA 1G2VA 5JQQA 4Y7UA 3SX3A 3U2TA 4JISA 4AYJA 2I7BA 2E3DA 2FY7A 4L41C 1H5SB 2X5SA 3V91A 4B2XA 4HCQA 2O1FA 2FYCB 4P00A 2VK9A 2RIYA 2WE9A 2I5EA 1WT2A 1VGTA 1H7GA 2WGZA 3DJ4A 5IDSA 4Y9XA 4YS8A 4FRDA 2O1HA 1TW1A 4KC4A 5BXCA 3CKOA 2JCJA 4NAKA 3OH1A 3U2VA 4DECA 2YQHA 2Q4JA 1VGZA 2FYBA 4EE3A 5FU8A 1E5KA 1QWJA 1H7FA 4FRMA 1H4DA 4UEGA 4XWIA 2GGOA 3OH0A 2AM3A 2RJ0A 1S4NA 1JVGA 4HO4A 1H7HA 2PX7A 2BO4A 1G97A 3I0LA 2YC5A 3OH4A 4HO5A 1PZYB 5C36A 2C0NA 3I0DA 2V0KA 3F1YA 2FYDB 4KPXA 3CKNA 4HO0A 1LL2A 3ZLKA 3ZLLA 2WVLA 2VD4A 4G3QA 2Y7AA 1I52A 2J0AA 4NAIA 3RMWA 3ZGFA 3OAMA 2VXMA 3LW6A 4AC3A 2PA4A 4HO8A 4O6NA 5CMHA 4G3PA 5C1GA 3V8YA 3E26A 3JUKA 2ICYA 2OEGA 1TZFA 5FV9A 2VS4A 5C1LA 1O7QA 2Y4LA 4BQHA 3FOQA 2PGVA 5FU0A 1ZJ1A 1FG5N 1G1LA 3K8DA 4Y7FA 2JCOA 4JD0A 3V8ZA 1JYLA 2E8BA 3V0PA 1TW5A 2RJ1A 1G3LA 2XWMA 4D48A 1LZ0A 1ZJ2A 3SX7A 1ZCTA 3V0NA 4Q7CA 1LZIA 1ZI5A 5HS2A 4HO2A 1QGSA 1VZTA 2FYAA 4M2AA 4FRAA 2VXLA 1LZ7A 3POLA 5D92A 1H5SC 1TVYA 2Y4MA 2O1GA 1JYKA 1K4VA 4Y7VA 3T7MA 4HOCA 5C49A 1FOAA 4DDZA 5C38A 1FGXA 3I0CA 1OQMB 1NMMB 2Y4JA 1FXJA 3V0LA 4B4BA 2ZU9A 5J49A 4HO3A 1R81A 3SXAA 1WT3A 2P6WA 4KT7A 5AJNA 1FWYA 1OMZA 5FYEA 4B42A 2P72A 5C4EA 1GQCA 1FO8A 2VS5A 1YP2A 1G8OA 1G95A 1QG8A 4Y62A 4FIXA 1EYRA 4IRPA 1ON8A
chains in the Genus database with same CATH topology
3I0HA 1XZ6A 5IFYA 2D0JA 4Y6NA 4KNXA 3DUVA 4FRPA 1O0RA 1VZUA 1FRWA 3I0KA 1H4CA 3CU0A 1H5TA 3CKJA 3SXDA 3BCVA 4FRLA 1FR9A 1ZDFA 5CMIA 3CGXA 4KRVA 3OH2A 5D91A 3D98A 2WEEA 3IOIA 4FRQA 2RITA 3PNNA 1W57A 1YP3A 5FTSA 3TZTA 1QGQA 1H3MA 2RIZA 3BRKX 4ECMA 2V0JA 1H7QA 3D5NA 4DE7A 5I1FA 3SX8A 1WT0A 5CQOA 4FRHA 4EE5A 1ZJPA 4P02A 2RJ6A 2I5KA 4Y7TA 2AM5A 5CQNX 1W55A 3IOJA 1GX4A 5C8RA 3V0OA 2P73A 5L6VA 1WSZA 2ZU7A 2JCKA 5C4FA 1VZXA 3ST8A 3QVBA 1ZJ0A 1R80A 3K8EA 4FRBA 3SPTA 5C4CA 1HM9A 2VS3A 2OEFA 1NHEB 4IRQA 2A8UA 4J18A 2Y6PA 3E25A 4KXOA 2GGQA 5EJZA 1ZJ3A 2OI7A 1H5SD 3IOHA 1VGWA 4B5BA 1WVCA 5C4BA 4KC1A 2W0VA 2QGIA 1W77A 3U2WA 1NWGB 1H5RA 1EZIA 3Q4SA 3JTJA 1HJJA 2OI5A 3FWWA 5C3BA 2XMEA 1H7LA 1NF5B 2RJ7A 3N9WA 4B3UA 2VSHA 4K6RA 4FREA 1FZWA 2RIXA 1H5TB 2V0LA 3V0QA 4Y7GA 3NGWA 4KNRA 1GWVA 2RJ5A 5CMJA 3R3IA 5FTVA 4M2BA 3CKQA 5C3DA 1INJA 2YQJA 1IIMA 2YQSA 1H4EA 2YC3A 1LVWA 1S4PA 2XMHA 2BO7A 3Q80A 1ZCYA 5FUHA 1FR8A 1ON6A 1V84A 4CJ8A 1VGUA 1R7UA 2AGDA 2V0IA 3I0EA 4NALA 5C3AA 3V0MA 1GA8A 2OI6A 1LL0A 5C4DA 2X60A 1VICA 4EE4A 4Y64A 3I0GA 4EVWA 4KC2A 4O6MA 4D11A 3CKVA 1ZDGA 5CQMX 4AYLA 1G0RA 1MP5A 1JV3A 4FQWA 1VM8A 1OMXA 3I0FA 2UX8A 5AJPA 1G23A 1ZCVA 3I0IX 1VPAA 2QH5A 1MC3A 4LW6A 3SXEA 3T7NA 4FIYA 3USQA 4Y6UA 1ZHJA 4ASYA 1JV1A 1YP4A 2Z87A 4HG6A 1R7XA 1H5RB 1KWSA 1PZTA 5CMGX 3SX5A 1R82A 2RJ4A 2RJ9A 4FCEA 5DDTA 3U2UA 4ASJA 1FGGA 3TQDA 2W0WA 3ZGGA 2BO8A 3R2WA 4G3SA 5L6SA 1VH1A 2YQCA 4E1KA 4D11C 1R7TA 3ZF8A 3OC9A 1FXOA 1H7TA 5CMFX 5CQLX 5EJ1A 3JUJA 4B2WA 2ICXA 3HL3A 4D0TA 4EEAA 5AJOA 2BO6A 2XWLA 4AAWA 4D0ZA 2DPWA 2XWNA 2QKXA 1WT1A 4MIXA 1ZI1A 1O23B 4FROA 1H7EA 4CJCA 2VFZA 1ZI3A 1GWWA 4B4MA 1HJLA 2AM4A 2WVMA 3KIAA 3GUEA 1ZI4A 1NQIB 3OH3A 2Z86A 3EE5A 2YCMA 4M4KA 3DK5A 2AECA 4G87A 1HV9A 1YROB 3Q7UA 4M28A 1ZCUA 1V82A 1H5SA 3SXBA 3T7OA 4CJBA 4CVHA 2APCA 1O7OA 1G9RA 1VH3A 4GBPA 2NXVA 1S4OA 4Y63A 2WAWA 4BMAA 2D7IA 2ZU8A 3I0JA 1JVDA 1R7YA 1Z90A 2J0BA 2RJ8A 5C1HA 3U0YA 1ZIZA 2A8WA 3O3PA 3USRA 4R7PA 1HM8A 1FO9A 5CQPA 4ARWA 2AE7A 1SS9A 3U2XA 5C47A 5EIYA 4KQLA 2X5ZA 4C2SA 4EEGA 4B4GA 2CU2A 3RSBA 2FFUA 1MP4A 4HO6A 3PKPA 1GQ9A 2Y4KA 3V90A 3D8VA 5DDVA 2D7RA 2MZBA 2AH9A 4NANA 2X65A 1MP3A 3SXCA 4HO9A 4EEOA 2FFVA 3OGZA 4LW3A 1ZJOA 3SXGA 4EEMA 3F1CA 1LL3A 2AESA 1IINA 2PGYA 3U0XA 4MNDA 1XHBA 2WVKA 1G93A 3OKRA 1NKHB 1INIA 4ZDQA 3RMVA 1LZJA 2V0HA 1R7VA 4KPZA 5C48A 4FCUA 2VSIA 3PKQA 2JCLA 5IDTA 2YESA 1V83A 1GX0A 1HM0A 4MYBA 1G2VA 5JQQA 4Y7UA 3SX3A 3U2TA 4JISA 4AYJA 2I7BA 2E3DA 2FY7A 4L41C 1H5SB 2X5SA 3V91A 4B2XA 4HCQA 2O1FA 2FYCB 4P00A 2VK9A 2RIYA 2WE9A 2I5EA 1WT2A 1VGTA 1H7GA 2WGZA 3DJ4A 5IDSA 4Y9XA 4YS8A 4FRDA 2O1HA 1TW1A 4KC4A 5BXCA 3CKOA 2JCJA 4NAKA 3OH1A 3U2VA 4DECA 2YQHA 2Q4JA 1VGZA 2FYBA 4EE3A 5FU8A 1E5KA 1QWJA 1H7FA 4FRMA 1H4DA 4UEGA 4XWIA 2GGOA 3OH0A 2AM3A 2RJ0A 1S4NA 1JVGA 4HO4A 1H7HA 2PX7A 2BO4A 1G97A 3I0LA 2YC5A 3OH4A 4HO5A 1PZYB 5C36A 2C0NA 3I0DA 2V0KA 3F1YA 2FYDB 4KPXA 3CKNA 4HO0A 1LL2A 3ZLKA 3ZLLA 2WVLA 2VD4A 4G3QA 2Y7AA 1I52A 2J0AA 4NAIA 3RMWA 3ZGFA 3OAMA 2VXMA 3LW6A 4AC3A 2PA4A 4HO8A 4O6NA 5CMHA 4G3PA 5C1GA 3V8YA 3E26A 3JUKA 2ICYA 2OEGA 1TZFA 5FV9A 2VS4A 5C1LA 1O7QA 2Y4LA 4BQHA 3FOQA 2PGVA 5FU0A 1ZJ1A 1FG5N 1G1LA 3K8DA 4Y7FA 2JCOA 4JD0A 3V8ZA 1JYLA 2E8BA 3V0PA 1TW5A 2RJ1A 1G3LA 2XWMA 4D48A 1LZ0A 1ZJ2A 3SX7A 1ZCTA 3V0NA 4Q7CA 1LZIA 1ZI5A 5HS2A 4HO2A 1QGSA 1VZTA 2FYAA 4M2AA 4FRAA 2VXLA 1LZ7A 3POLA 5D92A 1H5SC 1TVYA 2Y4MA 2O1GA 1JYKA 1K4VA 4Y7VA 3T7MA 4HOCA 5C49A 1FOAA 4DDZA 5C38A 1FGXA 3I0CA 1OQMB 1NMMB 2Y4JA 1FXJA 3V0LA 4B4BA 2ZU9A 5J49A 4HO3A 1R81A 3SXAA 1WT3A 2P6WA 4KT7A 5AJNA 1FWYA 1OMZA 5FYEA 4B42A 2P72A 5C4EA 1GQCA 1FO8A 2VS5A 1YP2A 1G8OA 1G95A 1QG8A 4Y62A 4FIXA 1EYRA 4IRPA 1ON8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I0H A;  1XZ6 A;  5IFY A;  2D0J A;  4Y6N A;  4KNX A;  3DUV A;  4FRP A;  1O0R A;  1VZU A;  1FRW A;  3I0K A;  1H4C A;  3CU0 A;  1H5T A;  3CKJ A;  3SXD A;  3BCV A;  4FRL A;  1FR9 A;  1ZDF A;  5CMI A;  3CGX A;  4KRV A;  3OH2 A;  3D98 A;  2WEE A;  3IOI A;  4FRQ A;  2RIT A;  3PNN A;  1W57 A;  1YP3 A;  5FTS A;  3TZT A;  1QGQ A;  1H3M A;  2RIZ A;  3BRK X;  4ECM A;  2V0J A;  1H7Q A;  3D5N A;  4DE7 A;  5I1F A;  3SX8 A;  1WT0 A;  5CQO A;  4FRH A;  4EE5 A;  1ZJP A;  4P02 A;  2RJ6 A;  2I5K A;  4Y7T A;  2AM5 A;  5CQN X;  1W55 A;  3IOJ A;  1GX4 A;  5C8R A;  3V0O A;  2P73 A;  5L6V A;  1WSZ A;  2ZU7 A;  2JCK A;  5C4F A;  1VZX A;  3ST8 A;  3QVB A;  1ZJ0 A;  1R80 A;  3K8E A;  4FRB A;  3SPT A;  5C4C A;  1HM9 A;  2VS3 A;  2OEF A;  1NHE B;  4IRQ A;  2A8U A;  4J18 A;  2Y6P A;  3E25 A;  4KXO A;  2GGQ A;  5EJZ A;  1ZJ3 A;  2OI7 A;  1H5S D;  3IOH A;  1VGW A;  4B5B A;  1WVC A;  5C4B A;  4KC1 A;  2W0V A;  2QGI A;  1W77 A;  3U2W A;  1NWG B;  1H5R A;  1EZI A;  3Q4S A;  3JTJ A;  1HJJ A;  2OI5 A;  3FWW A;  5C3B A;  2XME A;  1H7L A;  1NF5 B;  2RJ7 A;  3N9W A;  4B3U A;  2VSH A;  4K6R A;  4FRE A;  1FZW A;  2RIX A;  1H5T B;  2V0L A;  3V0Q A;  4Y7G A;  3NGW A;  4KNR A;  1GWV A;  2RJ5 A;  5CMJ A;  3R3I A;  5FTV A;  4M2B A;  3CKQ A;  5C3D A;  1INJ A;  2YQJ A;  1IIM A;  2YQS A;  1H4E A;  2YC3 A;  1LVW A;  1S4P A;  2XMH A;  2BO7 A;  3Q80 A;  1ZCY A;  5FUH A;  1FR8 A;  1ON6 A;  1V84 A;  4CJ8 A;  1VGU A;  1R7U A;  2AGD A;  2V0I A;  3I0E A;  4NAL A;  5C3A A;  3V0M A;  1GA8 A;  2OI6 A;  1LL0 A;  5C4D A;  2X60 A;  1VIC A;  4EE4 A;  4Y64 A;  3I0G A;  4EVW A;  4KC2 A;  4D11 A;  3CKV A;  1ZDG A;  5CQM X;  4AYL A;  1G0R A;  1MP5 A;  1JV3 A;  4FQW A;  1VM8 A;  1OMX A;  3I0F A;  2UX8 A;  5AJP A;  1G23 A;  1ZCV A;  3I0I X;  1VPA A;  2QH5 A;  1MC3 A;  4LW6 A;  3SXE A;  3T7N A;  3USQ A;  4Y6U A;  1ZHJ A;  4ASY A;  1JV1 A;  1YP4 A;  2Z87 A;  4HG6 A;  1R7X A;  1H5R B;  1KWS A;  1PZT A;  5CMG X;  3SX5 A;  1R82 A;  2RJ4 A;  2RJ9 A;  4FCE A;  5DDT A;  3U2U A;  4ASJ A;  1FGG A;  3TQD A;  2W0W A;  3ZGG A;  2BO8 A;  3R2W A;  4G3S A;  5L6S A;  1VH1 A;  2YQC A;  4E1K A;  4D11 C;  1R7T A;  3ZF8 A;  3OC9 A;  1FXO A;  1H7T A;  5CMF X;  5CQL X;  5EJ1 A;  3JUJ A;  4B2W A;  2ICX A;  3HL3 A;  4D0T A;  4EEA A;  5AJO A;  2BO6 A;  2XWL A;  4AAW A;  4D0Z A;  2DPW A;  2XWN A;  2QKX A;  1WT1 A;  1ZI1 A;  1O23 B;  4FRO A;  1H7E A;  4CJC A;  2VFZ A;  1ZI3 A;  1GWW A;  4B4M A;  1HJL A;  2AM4 A;  2WVM A;  3KIA A;  3GUE A;  1ZI4 A;  1NQI B;  3OH3 A;  2Z86 A;  3EE5 A;  2YCM A;  4M4K A;  3DK5 A;  2AEC A;  4G87 A;  1HV9 A;  1YRO B;  3Q7U A;  4M28 A;  1ZCU A;  1V82 A;  1H5S A;  3SXB A;  3T7O A;  4CJB A;  4CVH A;  2APC A;  1O7O A;  1G9R A;  1VH3 A;  4GBP A;  2NXV A;  1S4O A;  4Y63 A;  2WAW A;  4BMA A;  2D7I A;  2ZU8 A;  3I0J A;  1JVD A;  1R7Y A;  1Z90 A;  2RJ8 A;  5C1H A;  3U0Y A;  1ZIZ A;  2A8W A;  3O3P A;  3USR A;  4R7P A;  1HM8 A;  1FO9 A;  5CQP A;  4ARW A;  2AE7 A;  1SS9 A;  3U2X A;  5C47 A;  5EIY A;  4KQL A;  2X5Z A;  4C2S A;  4EEG A;  4B4G A;  2CU2 A;  3RSB A;  2FFU A;  1MP4 A;  4HO6 A;  3PKP A;  1GQ9 A;  2Y4K A;  3V90 A;  3D8V A;  5DDV A;  2D7R A;  2MZB A;  2AH9 A;  4NAN A;  2X65 A;  1MP3 A;  3SXC A;  4HO9 A;  4EEO A;  2FFV A;  3OGZ A;  4LW3 A;  1ZJO A;  3SXG A;  4EEM A;  3F1C A;  1LL3 A;  2AES A;  1IIN A;  2PGY A;  3U0X A;  4MND A;  1XHB A;  2WVK A;  1G93 A;  3OKR A;  1NKH B;  1INI A;  4ZDQ A;  3RMV A;  1LZJ A;  2V0H A;  1R7V A;  4KPZ A;  5C48 A;  4FCU A;  2VSI A;  3PKQ A;  2JCL A;  5IDT A;  2YES A;  1V83 A;  1GX0 A;  1HM0 A;  4MYB A;  1G2V A;  5JQQ A;  4Y7U A;  3SX3 A;  3U2T A;  4JIS A;  4AYJ A;  2I7B A;  2E3D A;  2FY7 A;  4L41 C;  1H5S B;  2X5S A;  3V91 A;  4B2X A;  4HCQ A;  2O1F A;  2FYC B;  4P00 A;  2RIY A;  2WE9 A;  2I5E A;  1WT2 A;  1VGT A;  1H7G A;  2WGZ A;  3DJ4 A;  5IDS A;  4Y9X A;  4YS8 A;  4FRD A;  2O1H A;  1TW1 A;  4KC4 A;  5BXC A;  3CKO A;  2JCJ A;  4NAK A;  3OH1 A;  3U2V A;  4DEC A;  2YQH A;  2Q4J A;  1VGZ A;  2FYB A;  4EE3 A;  5FU8 A;  1E5K A;  1QWJ A;  1H7F A;  4FRM A;  1H4D A;  4UEG A;  4XWI A;  2GGO A;  3OH0 A;  2AM3 A;  2RJ0 A;  1S4N A;  1JVG A;  4HO4 A;  1H7H A;  2PX7 A;  2BO4 A;  1G97 A;  3I0L A;  2YC5 A;  3OH4 A;  4HO5 A;  1PZY B;  5C36 A;  3I0D A;  2V0K A;  3F1Y A;  2FYD B;  4KPX A;  3CKN A;  4HO0 A;  1LL2 A;  3ZLK A;  3ZLL A;  2WVL A;  2VD4 A;  4G3Q A;  2Y7A A;  1I52 A;  4NAI A;  3RMW A;  3ZGF A;  3OAM A;  2VXM A;  3LW6 A;  4AC3 A;  2PA4 A;  4HO8 A;  5CMH A;  4G3P A;  5C1G A;  3V8Y A;  3E26 A;  3JUK A;  2ICY A;  2OEG A;  1TZF A;  5FV9 A;  2VS4 A;  5C1L A;  1O7Q A;  2Y4L A;  4BQH A;  3FOQ A;  2PGV A;  5FU0 A;  1ZJ1 A;  1FG5 N;  1G1L A;  3K8D A;  4Y7F A;  2JCO A;  4JD0 A;  3V8Z A;  1JYL A;  2E8B A;  3V0P A;  1TW5 A;  2RJ1 A;  1G3L A;  2XWM A;  4D48 A;  1LZ0 A;  1ZJ2 A;  3SX7 A;  1ZCT A;  3V0N A;  1LZI A;  1ZI5 A;  5HS2 A;  4HO2 A;  1QGS A;  1VZT A;  2FYA A;  4M2A A;  4FRA A;  2VXL A;  1LZ7 A;  3POL A;  1H5S C;  1TVY A;  2Y4M A;  2O1G A;  1JYK A;  1K4V A;  4Y7V A;  3T7M A;  4HOC A;  5C49 A;  1FOA A;  4DDZ A;  5C38 A;  1FGX A;  3I0C A;  1OQM B;  1NMM B;  2Y4J A;  1FXJ A;  3V0L A;  4B4B A;  2ZU9 A;  5J49 A;  4HO3 A;  1R81 A;  3SXA A;  1WT3 A;  2P6W A;  4KT7 A;  5AJN A;  1FWY A;  1OMZ A;  5FYE A;  4B42 A;  2P72 A;  5C4E A;  1GQC A;  1FO8 A;  2VS5 A;  1YP2 A;  1G8O A;  1G95 A;  1QG8 A;  4Y62 A;  1EYR A;  4IRP A;  1ON8 A; 
#chains in the Genus database with same CATH topology
 3I0H A;  1XZ6 A;  5IFY A;  2D0J A;  4Y6N A;  4KNX A;  3DUV A;  4FRP A;  1O0R A;  1VZU A;  1FRW A;  3I0K A;  1H4C A;  3CU0 A;  1H5T A;  3CKJ A;  3SXD A;  3BCV A;  4FRL A;  1FR9 A;  1ZDF A;  5CMI A;  3CGX A;  4KRV A;  3OH2 A;  5D91 A;  3D98 A;  2WEE A;  3IOI A;  4FRQ A;  2RIT A;  3PNN A;  1W57 A;  1YP3 A;  5FTS A;  3TZT A;  1QGQ A;  1H3M A;  2RIZ A;  3BRK X;  4ECM A;  2V0J A;  1H7Q A;  3D5N A;  4DE7 A;  5I1F A;  3SX8 A;  1WT0 A;  5CQO A;  4FRH A;  4EE5 A;  1ZJP A;  4P02 A;  2RJ6 A;  2I5K A;  4Y7T A;  2AM5 A;  5CQN X;  1W55 A;  3IOJ A;  1GX4 A;  5C8R A;  3V0O A;  2P73 A;  5L6V A;  1WSZ A;  2ZU7 A;  2JCK A;  5C4F A;  1VZX A;  3ST8 A;  3QVB A;  1ZJ0 A;  1R80 A;  3K8E A;  4FRB A;  3SPT A;  5C4C A;  1HM9 A;  2VS3 A;  2OEF A;  1NHE B;  4IRQ A;  2A8U A;  4J18 A;  2Y6P A;  3E25 A;  4KXO A;  2GGQ A;  5EJZ A;  1ZJ3 A;  2OI7 A;  1H5S D;  3IOH A;  1VGW A;  4B5B A;  1WVC A;  5C4B A;  4KC1 A;  2W0V A;  2QGI A;  1W77 A;  3U2W A;  1NWG B;  1H5R A;  1EZI A;  3Q4S A;  3JTJ A;  1HJJ A;  2OI5 A;  3FWW A;  5C3B A;  2XME A;  1H7L A;  1NF5 B;  2RJ7 A;  3N9W A;  4B3U A;  2VSH A;  4K6R A;  4FRE A;  1FZW A;  2RIX A;  1H5T B;  2V0L A;  3V0Q A;  4Y7G A;  3NGW A;  4KNR A;  1GWV A;  2RJ5 A;  5CMJ A;  3R3I A;  5FTV A;  4M2B A;  3CKQ A;  5C3D A;  1INJ A;  2YQJ A;  1IIM A;  2YQS A;  1H4E A;  2YC3 A;  1LVW A;  1S4P A;  2XMH A;  2BO7 A;  3Q80 A;  1ZCY A;  5FUH A;  1FR8 A;  1ON6 A;  1V84 A;  4CJ8 A;  1VGU A;  1R7U A;  2AGD A;  2V0I A;  3I0E A;  4NAL A;  5C3A A;  3V0M A;  1GA8 A;  2OI6 A;  1LL0 A;  5C4D A;  2X60 A;  1VIC A;  4EE4 A;  4Y64 A;  3I0G A;  4EVW A;  4KC2 A;  4O6M A;  4D11 A;  3CKV A;  1ZDG A;  5CQM X;  4AYL A;  1G0R A;  1MP5 A;  1JV3 A;  4FQW A;  1VM8 A;  1OMX A;  3I0F A;  2UX8 A;  5AJP A;  1G23 A;  1ZCV A;  3I0I X;  1VPA A;  2QH5 A;  1MC3 A;  4LW6 A;  3SXE A;  3T7N A;  4FIY A;  3USQ A;  4Y6U A;  1ZHJ A;  4ASY A;  1JV1 A;  1YP4 A;  2Z87 A;  4HG6 A;  1R7X A;  1H5R B;  1KWS A;  1PZT A;  5CMG X;  3SX5 A;  1R82 A;  2RJ4 A;  2RJ9 A;  4FCE A;  5DDT A;  3U2U A;  4ASJ A;  1FGG A;  3TQD A;  2W0W A;  3ZGG A;  2BO8 A;  3R2W A;  4G3S A;  5L6S A;  1VH1 A;  2YQC A;  4E1K A;  4D11 C;  1R7T A;  3ZF8 A;  3OC9 A;  1FXO A;  1H7T A;  5CMF X;  5CQL X;  5EJ1 A;  3JUJ A;  4B2W A;  2ICX A;  3HL3 A;  4D0T A;  4EEA A;  5AJO A;  2BO6 A;  2XWL A;  4AAW A;  4D0Z A;  2DPW A;  2XWN A;  2QKX A;  1WT1 A;  4MIX A;  1ZI1 A;  1O23 B;  4FRO A;  1H7E A;  4CJC A;  2VFZ A;  1ZI3 A;  1GWW A;  4B4M A;  1HJL A;  2AM4 A;  2WVM A;  3KIA A;  3GUE A;  1ZI4 A;  1NQI B;  3OH3 A;  2Z86 A;  3EE5 A;  2YCM A;  4M4K A;  3DK5 A;  2AEC A;  4G87 A;  1HV9 A;  1YRO B;  3Q7U A;  4M28 A;  1ZCU A;  1V82 A;  1H5S A;  3SXB A;  3T7O A;  4CJB A;  4CVH A;  2APC A;  1O7O A;  1G9R A;  1VH3 A;  4GBP A;  2NXV A;  1S4O A;  4Y63 A;  2WAW A;  4BMA A;  2D7I A;  2ZU8 A;  3I0J A;  1JVD A;  1R7Y A;  1Z90 A;  2J0B A;  2RJ8 A;  5C1H A;  3U0Y A;  1ZIZ A;  2A8W A;  3O3P A;  3USR A;  4R7P A;  1HM8 A;  1FO9 A;  5CQP A;  4ARW A;  2AE7 A;  1SS9 A;  3U2X A;  5C47 A;  5EIY A;  4KQL A;  2X5Z A;  4C2S A;  4EEG A;  4B4G A;  2CU2 A;  3RSB A;  2FFU A;  1MP4 A;  4HO6 A;  3PKP A;  1GQ9 A;  2Y4K A;  3V90 A;  3D8V A;  5DDV A;  2D7R A;  2MZB A;  2AH9 A;  4NAN A;  2X65 A;  1MP3 A;  3SXC A;  4HO9 A;  4EEO A;  2FFV A;  3OGZ A;  4LW3 A;  1ZJO A;  3SXG A;  4EEM A;  3F1C A;  1LL3 A;  2AES A;  1IIN A;  2PGY A;  3U0X A;  4MND A;  1XHB A;  2WVK A;  1G93 A;  3OKR A;  1NKH B;  1INI A;  4ZDQ A;  3RMV A;  1LZJ A;  2V0H A;  1R7V A;  4KPZ A;  5C48 A;  4FCU A;  2VSI A;  3PKQ A;  2JCL A;  5IDT A;  2YES A;  1V83 A;  1GX0 A;  1HM0 A;  4MYB A;  1G2V A;  5JQQ A;  4Y7U A;  3SX3 A;  3U2T A;  4JIS A;  4AYJ A;  2I7B A;  2E3D A;  2FY7 A;  4L41 C;  1H5S B;  2X5S A;  3V91 A;  4B2X A;  4HCQ A;  2O1F A;  2FYC B;  4P00 A;  2VK9 A;  2RIY A;  2WE9 A;  2I5E A;  1WT2 A;  1VGT A;  1H7G A;  2WGZ A;  3DJ4 A;  5IDS A;  4Y9X A;  4YS8 A;  4FRD A;  2O1H A;  1TW1 A;  4KC4 A;  5BXC A;  3CKO A;  2JCJ A;  4NAK A;  3OH1 A;  3U2V A;  4DEC A;  2YQH A;  2Q4J A;  1VGZ A;  2FYB A;  4EE3 A;  5FU8 A;  1E5K A;  1QWJ A;  1H7F A;  4FRM A;  1H4D A;  4UEG A;  4XWI A;  2GGO A;  3OH0 A;  2AM3 A;  2RJ0 A;  1S4N A;  1JVG A;  4HO4 A;  1H7H A;  2PX7 A;  2BO4 A;  1G97 A;  3I0L A;  2YC5 A;  3OH4 A;  4HO5 A;  1PZY B;  5C36 A;  2C0N A;  3I0D A;  2V0K A;  3F1Y A;  2FYD B;  4KPX A;  3CKN A;  4HO0 A;  1LL2 A;  3ZLK A;  3ZLL A;  2WVL A;  2VD4 A;  4G3Q A;  2Y7A A;  1I52 A;  2J0A A;  4NAI A;  3RMW A;  3ZGF A;  3OAM A;  2VXM A;  3LW6 A;  4AC3 A;  2PA4 A;  4HO8 A;  4O6N A;  5CMH A;  4G3P A;  5C1G A;  3V8Y A;  3E26 A;  3JUK A;  2ICY A;  2OEG A;  1TZF A;  5FV9 A;  2VS4 A;  5C1L A;  1O7Q A;  2Y4L A;  4BQH A;  3FOQ A;  2PGV A;  5FU0 A;  1ZJ1 A;  1FG5 N;  1G1L A;  3K8D A;  4Y7F A;  2JCO A;  4JD0 A;  3V8Z A;  1JYL A;  2E8B A;  3V0P A;  1TW5 A;  2RJ1 A;  1G3L A;  2XWM A;  4D48 A;  1LZ0 A;  1ZJ2 A;  3SX7 A;  1ZCT A;  3V0N A;  4Q7C A;  1LZI A;  1ZI5 A;  5HS2 A;  4HO2 A;  1QGS A;  1VZT A;  2FYA A;  4M2A A;  4FRA A;  2VXL A;  1LZ7 A;  3POL A;  5D92 A;  1H5S C;  1TVY A;  2Y4M A;  2O1G A;  1JYK A;  1K4V A;  4Y7V A;  3T7M A;  4HOC A;  5C49 A;  1FOA A;  4DDZ A;  5C38 A;  1FGX A;  3I0C A;  1OQM B;  1NMM B;  2Y4J A;  1FXJ A;  3V0L A;  4B4B A;  2ZU9 A;  5J49 A;  4HO3 A;  1R81 A;  3SXA A;  1WT3 A;  2P6W A;  4KT7 A;  5AJN A;  1FWY A;  1OMZ A;  5FYE A;  4B42 A;  2P72 A;  5C4E A;  1GQC A;  1FO8 A;  2VS5 A;  1YP2 A;  1G8O A;  1G95 A;  1QG8 A;  4Y62 A;  4FIX A;  1EYR A;  4IRP A;  1ON8 A; 
#chains in the Genus database with same CATH homology
 3I0H A;  1XZ6 A;  5IFY A;  2D0J A;  4Y6N A;  4KNX A;  3DUV A;  4FRP A;  1O0R A;  1VZU A;  1FRW A;  3I0K A;  1H4C A;  3CU0 A;  1H5T A;  3CKJ A;  3SXD A;  3BCV A;  4FRL A;  1FR9 A;  1ZDF A;  5CMI A;  3CGX A;  4KRV A;  3OH2 A;  5D91 A;  3D98 A;  2WEE A;  3IOI A;  4FRQ A;  2RIT A;  3PNN A;  1W57 A;  1YP3 A;  5FTS A;  3TZT A;  1QGQ A;  1H3M A;  2RIZ A;  3BRK X;  4ECM A;  2V0J A;  1H7Q A;  3D5N A;  4DE7 A;  5I1F A;  3SX8 A;  1WT0 A;  5CQO A;  4FRH A;  4EE5 A;  1ZJP A;  4P02 A;  2RJ6 A;  2I5K A;  4Y7T A;  2AM5 A;  5CQN X;  1W55 A;  3IOJ A;  1GX4 A;  5C8R A;  3V0O A;  2P73 A;  5L6V A;  1WSZ A;  2ZU7 A;  2JCK A;  5C4F A;  1VZX A;  3ST8 A;  3QVB A;  1ZJ0 A;  1R80 A;  3K8E A;  4FRB A;  3SPT A;  5C4C A;  1HM9 A;  2VS3 A;  2OEF A;  1NHE B;  4IRQ A;  2A8U A;  4J18 A;  2Y6P A;  3E25 A;  4KXO A;  2GGQ A;  5EJZ A;  1ZJ3 A;  2OI7 A;  1H5S D;  3IOH A;  1VGW A;  4B5B A;  1WVC A;  5C4B A;  4KC1 A;  2W0V A;  2QGI A;  1W77 A;  3U2W A;  1NWG B;  1H5R A;  1EZI A;  3Q4S A;  3JTJ A;  1HJJ A;  2OI5 A;  3FWW A;  5C3B A;  2XME A;  1H7L A;  1NF5 B;  2RJ7 A;  3N9W A;  4B3U A;  2VSH A;  4K6R A;  4FRE A;  1FZW A;  2RIX A;  1H5T B;  2V0L A;  3V0Q A;  4Y7G A;  3NGW A;  4KNR A;  1GWV A;  2RJ5 A;  5CMJ A;  3R3I A;  5FTV A;  4M2B A;  3CKQ A;  5C3D A;  1INJ A;  2YQJ A;  1IIM A;  2YQS A;  1H4E A;  2YC3 A;  1LVW A;  1S4P A;  2XMH A;  2BO7 A;  3Q80 A;  1ZCY A;  5FUH A;  1FR8 A;  1ON6 A;  1V84 A;  4CJ8 A;  1VGU A;  1R7U A;  2AGD A;  2V0I A;  3I0E A;  4NAL A;  5C3A A;  3V0M A;  1GA8 A;  2OI6 A;  1LL0 A;  5C4D A;  2X60 A;  1VIC A;  4EE4 A;  4Y64 A;  3I0G A;  4EVW A;  4KC2 A;  4O6M A;  4D11 A;  3CKV A;  1ZDG A;  5CQM X;  4AYL A;  1G0R A;  1MP5 A;  1JV3 A;  4FQW A;  1VM8 A;  1OMX A;  3I0F A;  2UX8 A;  5AJP A;  1G23 A;  1ZCV A;  3I0I X;  1VPA A;  2QH5 A;  1MC3 A;  4LW6 A;  3SXE A;  3T7N A;  4FIY A;  3USQ A;  4Y6U A;  1ZHJ A;  4ASY A;  1JV1 A;  1YP4 A;  2Z87 A;  4HG6 A;  1R7X A;  1H5R B;  1KWS A;  1PZT A;  5CMG X;  3SX5 A;  1R82 A;  2RJ4 A;  2RJ9 A;  4FCE A;  5DDT A;  3U2U A;  4ASJ A;  1FGG A;  3TQD A;  2W0W A;  3ZGG A;  2BO8 A;  3R2W A;  4G3S A;  5L6S A;  1VH1 A;  2YQC A;  4E1K A;  4D11 C;  1R7T A;  3ZF8 A;  3OC9 A;  1FXO A;  1H7T A;  5CMF X;  5CQL X;  5EJ1 A;  3JUJ A;  4B2W A;  2ICX A;  3HL3 A;  4D0T A;  4EEA A;  5AJO A;  2BO6 A;  2XWL A;  4AAW A;  4D0Z A;  2DPW A;  2XWN A;  2QKX A;  1WT1 A;  4MIX A;  1ZI1 A;  1O23 B;  4FRO A;  1H7E A;  4CJC A;  2VFZ A;  1ZI3 A;  1GWW A;  4B4M A;  1HJL A;  2AM4 A;  2WVM A;  3KIA A;  3GUE A;  1ZI4 A;  1NQI B;  3OH3 A;  2Z86 A;  3EE5 A;  2YCM A;  4M4K A;  3DK5 A;  2AEC A;  4G87 A;  1HV9 A;  1YRO B;  3Q7U A;  4M28 A;  1ZCU A;  1V82 A;  1H5S A;  3SXB A;  3T7O A;  4CJB A;  4CVH A;  2APC A;  1O7O A;  1G9R A;  1VH3 A;  4GBP A;  2NXV A;  1S4O A;  4Y63 A;  2WAW A;  4BMA A;  2D7I A;  2ZU8 A;  3I0J A;  1JVD A;  1R7Y A;  1Z90 A;  2J0B A;  2RJ8 A;  5C1H A;  3U0Y A;  1ZIZ A;  2A8W A;  3O3P A;  3USR A;  4R7P A;  1HM8 A;  1FO9 A;  5CQP A;  4ARW A;  2AE7 A;  1SS9 A;  3U2X A;  5C47 A;  5EIY A;  4KQL A;  2X5Z A;  4C2S A;  4EEG A;  4B4G A;  2CU2 A;  3RSB A;  2FFU A;  1MP4 A;  4HO6 A;  3PKP A;  1GQ9 A;  2Y4K A;  3V90 A;  3D8V A;  5DDV A;  2D7R A;  2MZB A;  2AH9 A;  4NAN A;  2X65 A;  1MP3 A;  3SXC A;  4HO9 A;  4EEO A;  2FFV A;  3OGZ A;  4LW3 A;  1ZJO A;  3SXG A;  4EEM A;  3F1C A;  1LL3 A;  2AES A;  1IIN A;  2PGY A;  3U0X A;  4MND A;  1XHB A;  2WVK A;  1G93 A;  3OKR A;  1NKH B;  1INI A;  4ZDQ A;  3RMV A;  1LZJ A;  2V0H A;  1R7V A;  4KPZ A;  5C48 A;  4FCU A;  2VSI A;  3PKQ A;  2JCL A;  5IDT A;  2YES A;  1V83 A;  1GX0 A;  1HM0 A;  4MYB A;  1G2V A;  5JQQ A;  4Y7U A;  3SX3 A;  3U2T A;  4JIS A;  4AYJ A;  2I7B A;  2E3D A;  2FY7 A;  4L41 C;  1H5S B;  2X5S A;  3V91 A;  4B2X A;  4HCQ A;  2O1F A;  2FYC B;  4P00 A;  2VK9 A;  2RIY A;  2WE9 A;  2I5E A;  1WT2 A;  1VGT A;  1H7G A;  2WGZ A;  3DJ4 A;  5IDS A;  4Y9X A;  4YS8 A;  4FRD A;  2O1H A;  1TW1 A;  4KC4 A;  5BXC A;  3CKO A;  2JCJ A;  4NAK A;  3OH1 A;  3U2V A;  4DEC A;  2YQH A;  2Q4J A;  1VGZ A;  2FYB A;  4EE3 A;  5FU8 A;  1E5K A;  1QWJ A;  1H7F A;  4FRM A;  1H4D A;  4UEG A;  4XWI A;  2GGO A;  3OH0 A;  2AM3 A;  2RJ0 A;  1S4N A;  1JVG A;  4HO4 A;  1H7H A;  2PX7 A;  2BO4 A;  1G97 A;  3I0L A;  2YC5 A;  3OH4 A;  4HO5 A;  1PZY B;  5C36 A;  2C0N A;  3I0D A;  2V0K A;  3F1Y A;  2FYD B;  4KPX A;  3CKN A;  4HO0 A;  1LL2 A;  3ZLK A;  3ZLL A;  2WVL A;  2VD4 A;  4G3Q A;  2Y7A A;  1I52 A;  2J0A A;  4NAI A;  3RMW A;  3ZGF A;  3OAM A;  2VXM A;  3LW6 A;  4AC3 A;  2PA4 A;  4HO8 A;  4O6N A;  5CMH A;  4G3P A;  5C1G A;  3V8Y A;  3E26 A;  3JUK A;  2ICY A;  2OEG A;  1TZF A;  5FV9 A;  2VS4 A;  5C1L A;  1O7Q A;  2Y4L A;  4BQH A;  3FOQ A;  2PGV A;  5FU0 A;  1ZJ1 A;  1FG5 N;  1G1L A;  3K8D A;  4Y7F A;  2JCO A;  4JD0 A;  3V8Z A;  1JYL A;  2E8B A;  3V0P A;  1TW5 A;  2RJ1 A;  1G3L A;  2XWM A;  4D48 A;  1LZ0 A;  1ZJ2 A;  3SX7 A;  1ZCT A;  3V0N A;  4Q7C A;  1LZI A;  1ZI5 A;  5HS2 A;  4HO2 A;  1QGS A;  1VZT A;  2FYA A;  4M2A A;  4FRA A;  2VXL A;  1LZ7 A;  3POL A;  5D92 A;  1H5S C;  1TVY A;  2Y4M A;  2O1G A;  1JYK A;  1K4V A;  4Y7V A;  3T7M A;  4HOC A;  5C49 A;  1FOA A;  4DDZ A;  5C38 A;  1FGX A;  3I0C A;  1OQM B;  1NMM B;  2Y4J A;  1FXJ A;  3V0L A;  4B4B A;  2ZU9 A;  5J49 A;  4HO3 A;  1R81 A;  3SXA A;  1WT3 A;  2P6W A;  4KT7 A;  5AJN A;  1FWY A;  1OMZ A;  5FYE A;  4B42 A;  2P72 A;  5C4E A;  1GQC A;  1FO8 A;  2VS5 A;  1YP2 A;  1G8O A;  1G95 A;  1QG8 A;  4Y62 A;  4FIX A;  1EYR A;  4IRP A;  1ON8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...