5FTSA

Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
301
structure length
296
Chain Sequence
HHHHKRKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLGSASQRQTGASVFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIATLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLLTETVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
publication title Allosteric Competitive Inhibitors of the Glucose-1-Phosphate Thymidylyltransferase (Rmla) from Pseudomonas Aeruginosa.
rcsb
source organism Pseudomonas aeruginosa
total genus 98
structure length 296
sequence length 301
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.24: Glucose-1-phosphate thymidylyltransferase.
pdb deposition date 2016-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5ftsA00
4EEOA 1V83A 1VH1A 5FU0A 3SXAA 4G3SA 4DDZA 2RIXA 4Y7FA 2FFUA 4B4BA 3CKQA 4IRQA 1FGXA 4Y6NA 3SXDA 1FOAA 1NHEB 5FYEA 3OH4A 1VGWA 2VSHA 1V84A 1WVCA 2RJ9A 2WAWA 1Z90A 4M2AA 1NKHB 2ZU8A 3OH3A 4B2WA 4KPZA 3OC9A 2O1HA 5C1HA 1ZJPA 2PGVA 2D7IA 1FRWA 2A8WA 2OI7A 1R81A 2YQSA 1INIA 4D11A 1H5SC 3I0LA 1G23A 2AM5A 1GA8A 5C4CA 2RJ6A 4ARWA 5IDSA 1FXJA 4M2BA 1OQMB 1JV1A 4FRPA 5CQLX 1TZFA 3V0OA 4HO8A 1ZIZA 4FQWA 5L6SA 3CKJA 2V0IA 3OH1A 2GGQA 3F1YA 3U0YA 3JUJA 4P00A 2XWLA 1HJLA 5C4DA 1OMXA 4HO5A 5CMIA 3T7OA 2YESA 3CKNA 3I0CA 2PA4A 4Y9XA 4FCEA 1JYKA 1G93A 3V0LA 2AECA 5CQNX 4ASYA 4BQHA 2QKXA 1H7GA 1LL0A 3FWWA 3Q80A 5C48A 1H5TB 1VM8A 4FRMA 1VICA 1H5RA 3ZGFA 5FUHA 2FYAA 2OEFA 1R7VA 4M28A 1YROB 2Y4JA 4M4KA 2JCOA 3I0GA 2P72A 5FTSA 4E1KA 4AYJA 2VXLA 3R3IA 1NF5B 1INJA 4GBPA 3ZLLA 3OAMA 4BMAA 1ZJ3A 1JVDA 4HO6A 3SX3A 1ZI3A 4FRQA 5CMFX 1W55A 2O1FA 1ZI4A 2VS4A 2JCJA 1VH3A 2YC5A 4D11C 2Y4MA 1W77A 3I0EA 3R2WA 1ZJ1A 2AGDA 3RSBA 2YQJA 3V0NA 1ZCVA 3QVBA 1G2VA 2RJ5A 5C3AA 2GGOA 2RJ8A 3V90A 3JTJA 5L6VA 2P73A 1MP3A 2FYBA 1ZJ2A 2Z87A 4B42A 4KPXA 3CKOA 1XZ6A 4HO0A 3ZLKA 2BO8A 1VGUA 4Y7UA 2W0VA 1WT1A 1FWYA 1R7UA 5J49A 1H5SB 2I5EA 2YQCA 2RJ4A 1LVWA 1S4NA 1XHBA 2A8UA 5EIYA 4FRBA 4Y7GA 4KXOA 1FR9A 4EE3A 5C1LA 5CMHA 4JISA 3U2WA 1FR8A 1GWVA 3I0FA 3SXCA 4FRLA 4KC4A 1R7TA 1FG5N 5C36A 1R80A 3K8EA 2X5SA 3Q4SA 2APCA 2OEGA 4EEMA 2QH5A 2Q4JA 1G97A 1H5SD 1PZYB 1IIMA 2XWNA 5JQQA 3SX7A 4UEGA 5EJ1A 1ZCYA 2RJ0A 1LL2A 1NWGB 3JUKA 1O23B 2P6WA 3IOIA 2E3DA 1VPAA 2WVMA 4HG6A 2FYDB 4Y7TA 5C4BA 4B5BA 1S4PA 1MC3A 1QGSA 1LL3A 4HO2A 1QGQA 3POLA 3D98A 4D0TA 5HS2A 2RJ1A 3F1CA 1G9RA 4NALA 3V91A 1G3LA 1IINA 5FTVA 2AM4A 3T7MA 5AJOA 5C3BA 5C47A 4Y63A 5C4EA 5AJNA 3BRKX 1V82A 4KRVA 2OI6A 3TZTA 4K6RA 4Y64A 4EVWA 2O1GA 1H3MA 2VD4A 4FRHA 3RMVA 1WT3A 1ON6A 4AAWA 5BXCA 3O3PA 1LZ0A 4AC3A 5CMJA 2I7BA 4L41C 2WGZA 3DJ4A 1G0RA 4YS8A 3D5NA 5IFYA 4J18A 1WT2A 5FU8A 4IRPA 3I0IX 1I52A 3SXBA 2ICXA 4NAIA 3IOHA 2RIZA 3V0PA 4HO9A 1H7QA 1W57A 2FY7A 3U0XA 1H4CA 4Y6UA 1ZI5A 2VS5A 4FRDA 3NGWA 4G87A 1E5KA 1R7XA 2BO6A 2FFVA 2DPWA 2Y6PA 2ZU7A 2VXMA 2RIYA 3KIAA 4EEAA 2ZU9A 1JYLA 5CQOA 3SPTA 1GQCA 3U2UA 3TQDA 1FXOA 1H7FA 1EYRA 1TW1A 3FOQA 5C3DA 3I0HA 2WVLA 4ZDQA 1EZIA 4JD0A 1FO9A 3E25A 1ZI1A 4C2SA 1H5RB 1PZTA 4CJ8A 2XMHA 1ZCTA 3OGZA 1ZDFA 1YP4A 3E26A 3CGXA 3T7NA 1G1LA 1KWSA 2MZBA 2V0HA 2VS3A 4G3QA 3N9WA 1HM9A 2PX7A 4KT7A 1ZJ0A 5C49A 4Y7VA 4KNRA 3PKPA 3V0MA 4MYBA 3PNNA 2BO7A 3OH2A 5EJZA 4FREA 1YP3A 1WSZA 4LW3A 1ZHJA 3USRA 2WVKA 3V0QA 5AJPA 4B4GA 1H7LA 1S4OA 1GX4A 2FYCB 2VSIA 3D8VA 5FV9A 2CU2A 2AH9A 4HCQA 4B3UA 3IOJA 1R7YA 5DDVA 3I0JA 2AE7A 2XWMA 1H5TA 3EE5A 4HO4A 2V0KA 5CMGX 3Q7UA 3U2XA 5C1GA 1GX0A 1MP4A 2RJ7A 3SX5A 2Z86A 4CJBA 2VFZA 2YC3A 1TVYA 4D0ZA 5I1FA 1VGTA 1H4EA 1TW5A 2QGIA 1ON8A 2X5ZA 3DUVA 5C4FA 2OI5A 1FGGA 1ZJOA 4KNXA 4CJCA 2NXVA 1QWJA 4P02A 3USQA 3ZGGA 1JV3A 2X65A 1VZUA 1QG8A 4B2XA 4AYLA 1R82A 1HM0A 2WE9A 3CU0A 1ZCUA 4KQLA 1G8OA 4MNDA 2X60A 3K8DA 1HM8A 4XWIA 4DE7A 2YCMA 1G95A 4G3PA 1VZXA 2Y4KA 2AESA 2D7RA 1H7EA 1H7HA 3HL3A 1VGZA 1NMMB 2Y4LA 4NANA 3I0DA 3PKQA 4KC2A 5CQMX 3SX8A 3SXGA 1WT0A 2JCLA 3SXEA 4NAKA 1O0RA 1O7OA 1OMZA 2E8BA 1HJJA 3RMWA 3CKVA 2I5KA 3GUEA 2V0JA 3V8ZA 2BO4A 1GQ9A 3ST8A 4ECMA 4R7PA 1LZJA 4EE5A 1O7QA 4CVHA 3LW6A 1H5SA 4HOCA 4Y62A 4FCUA 1NQIB 4KC1A 2WEEA 2V0LA 5IDTA 2YQHA 1MP5A 2XMEA 5CQPA 1YP2A 4EEGA 4ASJA 1GWWA 1H7TA 1K4VA 3V8YA 2JCKA 2UX8A 2W0WA 1FO8A 3DK5A 2ICYA 1JVGA 4D48A 2Y7AA 1SS9A 3OKRA 2D0JA 5DDTA 3U2TA 3BCVA 1FZWA 3ZF8A 4FROA 4DECA 5C38A 2PGYA 5C8RA 2AM3A 1LZIA 3OH0A 1LZ7A 1HV9A 4B4MA 3U2VA 4LW6A 2RITA 1H4DA 4HO3A 4FRAA 4EE4A 1VZTA 1ZDGA 3I0KA
chains in the Genus database with same CATH superfamily
4EEOA 1V83A 1VH1A 5FU0A 3SXAA 4G3SA 4DDZA 2RIXA 4Y7FA 2FFUA 4B4BA 3CKQA 4IRQA 1FGXA 4Y6NA 3SXDA 1FOAA 1NHEB 5FYEA 3OH4A 1VGWA 2VSHA 1V84A 1WVCA 2RJ9A 2WAWA 1Z90A 4M2AA 1NKHB 2ZU8A 3OH3A 4B2WA 4KPZA 3OC9A 2O1HA 5C1HA 1ZJPA 2PGVA 2D7IA 1FRWA 2A8WA 2OI7A 1R81A 2YQSA 1INIA 4D11A 1H5SC 3I0LA 1G23A 2AM5A 1GA8A 5C4CA 2RJ6A 4ARWA 5IDSA 1FXJA 4M2BA 1OQMB 1JV1A 4FRPA 5CQLX 1TZFA 3V0OA 4HO8A 1ZIZA 4FQWA 5L6SA 3CKJA 2V0IA 3OH1A 2GGQA 3F1YA 3U0YA 3JUJA 4P00A 2XWLA 1HJLA 5C4DA 1OMXA 4HO5A 5CMIA 3T7OA 2YESA 3CKNA 3I0CA 2PA4A 4Y9XA 4FCEA 5D91A 1JYKA 1G93A 3V0LA 2AECA 5CQNX 4ASYA 4BQHA 2QKXA 1H7GA 1LL0A 3FWWA 3Q80A 5C48A 1H5TB 1VM8A 4FRMA 1VICA 1H5RA 3ZGFA 5FUHA 2FYAA 2OEFA 1R7VA 4M28A 1YROB 2Y4JA 4M4KA 2JCOA 3I0GA 2P72A 5FTSA 4E1KA 4AYJA 2VXLA 3R3IA 1NF5B 1INJA 4GBPA 3ZLLA 3OAMA 4BMAA 1ZJ3A 1JVDA 4HO6A 3SX3A 1ZI3A 4FRQA 5CMFX 1W55A 2O1FA 1ZI4A 2VS4A 2JCJA 1VH3A 2YC5A 4D11C 2Y4MA 1W77A 3I0EA 3R2WA 1ZJ1A 2AGDA 3RSBA 2YQJA 3V0NA 1ZCVA 3QVBA 1G2VA 2RJ5A 5C3AA 2GGOA 2RJ8A 3V90A 3JTJA 5L6VA 2P73A 1MP3A 2FYBA 1ZJ2A 2Z87A 4B42A 4KPXA 3CKOA 1XZ6A 4HO0A 3ZLKA 2BO8A 1VGUA 4Y7UA 2W0VA 1WT1A 1FWYA 1R7UA 5J49A 1H5SB 2I5EA 2YQCA 2RJ4A 1LVWA 1S4NA 1XHBA 2A8UA 5EIYA 4FRBA 4Y7GA 4KXOA 1FR9A 4EE3A 5C1LA 5CMHA 4JISA 3U2WA 1FR8A 1GWVA 3I0FA 3SXCA 4FRLA 4KC4A 1R7TA 1FG5N 5C36A 1R80A 3K8EA 2X5SA 3Q4SA 2APCA 2OEGA 4EEMA 2QH5A 2Q4JA 1G97A 1H5SD 1PZYB 1IIMA 2XWNA 5JQQA 3SX7A 4UEGA 5EJ1A 1ZCYA 2RJ0A 1LL2A 1NWGB 3JUKA 1O23B 2P6WA 3IOIA 2E3DA 1VPAA 2WVMA 4HG6A 2FYDB 4Y7TA 5C4BA 4B5BA 1S4PA 1MC3A 1QGSA 1LL3A 4HO2A 1QGQA 3POLA 3D98A 4D0TA 5HS2A 2RJ1A 3F1CA 1G9RA 4NALA 3V91A 1G3LA 1IINA 5FTVA 2AM4A 3T7MA 5AJOA 5C3BA 5C47A 4Y63A 5C4EA 5AJNA 3BRKX 1V82A 4KRVA 2OI6A 3TZTA 4K6RA 4Y64A 4EVWA 2O1GA 1H3MA 2VD4A 4FRHA 3RMVA 1WT3A 1ON6A 4AAWA 5BXCA 3O3PA 1LZ0A 4AC3A 5CMJA 2I7BA 4L41C 2WGZA 3DJ4A 1G0RA 4YS8A 3D5NA 5IFYA 4J18A 1WT2A 5FU8A 4IRPA 3I0IX 1I52A 3SXBA 2ICXA 4NAIA 3IOHA 2RIZA 3V0PA 4HO9A 1H7QA 1W57A 2FY7A 3U0XA 1H4CA 4Y6UA 1ZI5A 2VS5A 4FIYA 3NGWA 4FRDA 4G87A 1E5KA 1R7XA 2BO6A 2FFVA 2DPWA 2Y6PA 2ZU7A 2VXMA 2RIYA 3KIAA 4EEAA 2ZU9A 1JYLA 5CQOA 3SPTA 1GQCA 3U2UA 3TQDA 1FXOA 1H7FA 1EYRA 1TW1A 3FOQA 5C3DA 3I0HA 2WVLA 4ZDQA 1EZIA 4JD0A 1FO9A 2VK9A 3E25A 1ZI1A 4C2SA 4FIXA 1H5RB 1PZTA 4CJ8A 2XMHA 1ZCTA 3OGZA 1ZDFA 1YP4A 3E26A 3CGXA 3T7NA 1G1LA 1KWSA 2MZBA 2V0HA 2VS3A 4G3QA 3N9WA 1HM9A 2PX7A 4KT7A 1ZJ0A 5C49A 4Y7VA 4KNRA 3PKPA 3V0MA 4MYBA 3PNNA 2BO7A 3OH2A 5EJZA 4FREA 1YP3A 1WSZA 4LW3A 1ZHJA 3USRA 2J0AA 2WVKA 3V0QA 5AJPA 4B4GA 1H7LA 1S4OA 1GX4A 2FYCB 2VSIA 3D8VA 5FV9A 2CU2A 2AH9A 4HCQA 4B3UA 3IOJA 1R7YA 5DDVA 3I0JA 2AE7A 2XWMA 1H5TA 3EE5A 4HO4A 2V0KA 5CMGX 3Q7UA 3U2XA 5C1GA 1GX0A 1MP4A 2RJ7A 3SX5A 2Z86A 4CJBA 2VFZA 2YC3A 1TVYA 4D0ZA 5I1FA 1VGTA 1H4EA 1TW5A 2QGIA 1ON8A 2X5ZA 3DUVA 5C4FA 2OI5A 4MIXA 1FGGA 1ZJOA 4KNXA 4CJCA 2NXVA 1QWJA 4O6MA 4P02A 3USQA 1JV3A 3ZGGA 2X65A 1VZUA 1QG8A 4B2XA 4AYLA 1R82A 1HM0A 2WE9A 3CU0A 1ZCUA 4O6NA 4KQLA 1G8OA 4MNDA 2X60A 3K8DA 1HM8A 4XWIA 4DE7A 2YCMA 1G95A 4G3PA 1VZXA 2Y4KA 2AESA 2D7RA 2C0NA 1H7EA 1H7HA 3HL3A 1VGZA 1NMMB 2Y4LA 4NANA 3I0DA 3PKQA 4KC2A 5CQMX 3SX8A 3SXGA 1WT0A 2JCLA 3SXEA 4NAKA 1O0RA 1O7OA 1OMZA 2E8BA 1HJJA 3RMWA 3CKVA 2I5KA 3GUEA 2V0JA 3V8ZA 2BO4A 1GQ9A 3ST8A 4ECMA 4Q7CA 4R7PA 1LZJA 4EE5A 1O7QA 5D92A 4CVHA 3LW6A 1H5SA 4HOCA 4Y62A 4FCUA 1NQIB 4KC1A 2WEEA 2V0LA 5IDTA 2YQHA 1MP5A 2XMEA 5CQPA 1YP2A 4EEGA 4ASJA 1GWWA 1H7TA 1K4VA 3V8YA 2JCKA 2UX8A 2W0WA 1FO8A 3DK5A 2ICYA 1JVGA 4D48A 2Y7AA 1SS9A 3OKRA 2D0JA 5DDTA 3U2TA 3BCVA 1FZWA 2J0BA 3ZF8A 4FROA 4DECA 5C38A 2PGYA 5C8RA 2AM3A 1LZIA 3OH0A 1LZ7A 1HV9A 4B4MA 3U2VA 4LW6A 2RITA 1H4DA 4HO3A 4FRAA 4EE4A 1VZTA 1ZDGA 3I0KA
chains in the Genus database with same CATH topology
4EEOA 1V83A 1VH1A 5FU0A 3SXAA 4G3SA 4DDZA 2RIXA 4Y7FA 2FFUA 4B4BA 3CKQA 4IRQA 1FGXA 4Y6NA 3SXDA 1FOAA 1NHEB 5FYEA 3OH4A 1VGWA 2VSHA 1V84A 1WVCA 2RJ9A 2WAWA 1Z90A 4M2AA 1NKHB 2ZU8A 3OH3A 4B2WA 4KPZA 3OC9A 2O1HA 5C1HA 1ZJPA 2PGVA 2D7IA 1FRWA 2A8WA 2OI7A 1R81A 2YQSA 1INIA 4D11A 1H5SC 3I0LA 1G23A 2AM5A 1GA8A 5C4CA 2RJ6A 4ARWA 5IDSA 1FXJA 4M2BA 1OQMB 1JV1A 4FRPA 5CQLX 1TZFA 3V0OA 4HO8A 1ZIZA 4FQWA 5L6SA 3CKJA 2V0IA 3OH1A 2GGQA 3F1YA 3U0YA 3JUJA 4P00A 2XWLA 1HJLA 5C4DA 1OMXA 4HO5A 5CMIA 3T7OA 2YESA 3CKNA 3I0CA 2PA4A 4Y9XA 4FCEA 5D91A 1JYKA 1G93A 3V0LA 2AECA 5CQNX 4ASYA 4BQHA 2QKXA 1H7GA 1LL0A 3FWWA 3Q80A 5C48A 1H5TB 1VM8A 4FRMA 1VICA 1H5RA 3ZGFA 5FUHA 2FYAA 2OEFA 1R7VA 4M28A 1YROB 2Y4JA 4M4KA 2JCOA 3I0GA 2P72A 5FTSA 4E1KA 4AYJA 2VXLA 3R3IA 1NF5B 1INJA 4GBPA 3ZLLA 3OAMA 4BMAA 1ZJ3A 1JVDA 4HO6A 3SX3A 1ZI3A 4FRQA 5CMFX 1W55A 2O1FA 1ZI4A 2VS4A 2JCJA 1VH3A 2YC5A 4D11C 2Y4MA 1W77A 3I0EA 3R2WA 1ZJ1A 2AGDA 3RSBA 2YQJA 3V0NA 1ZCVA 3QVBA 1G2VA 2RJ5A 5C3AA 2GGOA 2RJ8A 3V90A 3JTJA 5L6VA 2P73A 1MP3A 2FYBA 1ZJ2A 2Z87A 4B42A 4KPXA 3CKOA 1XZ6A 4HO0A 3ZLKA 2BO8A 1VGUA 4Y7UA 2W0VA 1WT1A 1FWYA 1R7UA 5J49A 1H5SB 2I5EA 2YQCA 2RJ4A 1LVWA 1S4NA 1XHBA 2A8UA 5EIYA 4FRBA 4Y7GA 4KXOA 1FR9A 4EE3A 5C1LA 5CMHA 4JISA 3U2WA 1FR8A 1GWVA 3I0FA 3SXCA 4FRLA 4KC4A 1R7TA 1FG5N 5C36A 1R80A 3K8EA 2X5SA 3Q4SA 2APCA 2OEGA 4EEMA 2QH5A 2Q4JA 1G97A 1H5SD 1PZYB 1IIMA 2XWNA 5JQQA 3SX7A 4UEGA 5EJ1A 1ZCYA 2RJ0A 1LL2A 1NWGB 3JUKA 1O23B 2P6WA 3IOIA 2E3DA 1VPAA 2WVMA 4HG6A 2FYDB 4Y7TA 5C4BA 4B5BA 1S4PA 1MC3A 1QGSA 1LL3A 4HO2A 1QGQA 3POLA 3D98A 4D0TA 5HS2A 2RJ1A 3F1CA 1G9RA 4NALA 3V91A 1G3LA 1IINA 5FTVA 2AM4A 3T7MA 5AJOA 5C3BA 5C47A 4Y63A 5C4EA 5AJNA 3BRKX 1V82A 4KRVA 2OI6A 3TZTA 4K6RA 4Y64A 4EVWA 2O1GA 1H3MA 2VD4A 4FRHA 3RMVA 1WT3A 1ON6A 4AAWA 5BXCA 3O3PA 1LZ0A 4AC3A 5CMJA 2I7BA 4L41C 2WGZA 3DJ4A 1G0RA 4YS8A 3D5NA 5IFYA 4J18A 1WT2A 5FU8A 4IRPA 3I0IX 1I52A 3SXBA 2ICXA 4NAIA 3IOHA 2RIZA 3V0PA 4HO9A 1H7QA 1W57A 2FY7A 3U0XA 1H4CA 4Y6UA 1ZI5A 2VS5A 4FIYA 3NGWA 4FRDA 4G87A 1E5KA 1R7XA 2BO6A 2FFVA 2DPWA 2Y6PA 2ZU7A 2VXMA 2RIYA 3KIAA 4EEAA 2ZU9A 1JYLA 5CQOA 3SPTA 1GQCA 3U2UA 3TQDA 1FXOA 1H7FA 1EYRA 1TW1A 3FOQA 5C3DA 3I0HA 2WVLA 4ZDQA 1EZIA 4JD0A 1FO9A 2VK9A 3E25A 1ZI1A 4C2SA 4FIXA 1H5RB 1PZTA 4CJ8A 2XMHA 1ZCTA 3OGZA 1ZDFA 1YP4A 3E26A 3CGXA 3T7NA 1G1LA 1KWSA 2MZBA 2V0HA 2VS3A 4G3QA 3N9WA 1HM9A 2PX7A 4KT7A 1ZJ0A 5C49A 4Y7VA 4KNRA 3PKPA 3V0MA 4MYBA 3PNNA 2BO7A 3OH2A 5EJZA 4FREA 1YP3A 1WSZA 4LW3A 1ZHJA 3USRA 2J0AA 2WVKA 3V0QA 5AJPA 4B4GA 1H7LA 1S4OA 1GX4A 2FYCB 2VSIA 3D8VA 5FV9A 2CU2A 2AH9A 4HCQA 4B3UA 3IOJA 1R7YA 5DDVA 3I0JA 2AE7A 2XWMA 1H5TA 3EE5A 4HO4A 2V0KA 5CMGX 3Q7UA 3U2XA 5C1GA 1GX0A 1MP4A 2RJ7A 3SX5A 2Z86A 4CJBA 2VFZA 2YC3A 1TVYA 4D0ZA 5I1FA 1VGTA 1H4EA 1TW5A 2QGIA 1ON8A 2X5ZA 3DUVA 5C4FA 2OI5A 4MIXA 1FGGA 1ZJOA 4KNXA 4CJCA 2NXVA 1QWJA 4O6MA 4P02A 3USQA 1JV3A 3ZGGA 2X65A 1VZUA 1QG8A 4B2XA 4AYLA 1R82A 1HM0A 2WE9A 3CU0A 1ZCUA 4O6NA 4KQLA 1G8OA 4MNDA 2X60A 3K8DA 1HM8A 4XWIA 4DE7A 2YCMA 1G95A 4G3PA 1VZXA 2Y4KA 2AESA 2D7RA 2C0NA 1H7EA 1H7HA 3HL3A 1VGZA 1NMMB 2Y4LA 4NANA 3I0DA 3PKQA 4KC2A 5CQMX 3SX8A 3SXGA 1WT0A 2JCLA 3SXEA 4NAKA 1O0RA 1O7OA 1OMZA 2E8BA 1HJJA 3RMWA 3CKVA 2I5KA 3GUEA 2V0JA 3V8ZA 2BO4A 1GQ9A 3ST8A 4ECMA 4Q7CA 4R7PA 1LZJA 4EE5A 1O7QA 5D92A 4CVHA 3LW6A 1H5SA 4HOCA 4Y62A 4FCUA 1NQIB 4KC1A 2WEEA 2V0LA 5IDTA 2YQHA 1MP5A 2XMEA 5CQPA 1YP2A 4EEGA 4ASJA 1GWWA 1H7TA 1K4VA 3V8YA 2JCKA 2UX8A 2W0WA 1FO8A 3DK5A 2ICYA 1JVGA 4D48A 2Y7AA 1SS9A 3OKRA 2D0JA 5DDTA 3U2TA 3BCVA 1FZWA 2J0BA 3ZF8A 4FROA 4DECA 5C38A 2PGYA 5C8RA 2AM3A 1LZIA 3OH0A 1LZ7A 1HV9A 4B4MA 3U2VA 4LW6A 2RITA 1H4DA 4HO3A 4FRAA 4EE4A 1VZTA 1ZDGA 3I0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EEO A;  1V83 A;  1VH1 A;  5FU0 A;  3SXA A;  4G3S A;  4DDZ A;  2RIX A;  4Y7F A;  2FFU A;  4B4B A;  3CKQ A;  4IRQ A;  1FGX A;  4Y6N A;  3SXD A;  1FOA A;  1NHE B;  5FYE A;  3OH4 A;  1VGW A;  2VSH A;  1V84 A;  1WVC A;  2RJ9 A;  2WAW A;  1Z90 A;  4M2A A;  1NKH B;  2ZU8 A;  3OH3 A;  4B2W A;  4KPZ A;  3OC9 A;  2O1H A;  5C1H A;  1ZJP A;  2PGV A;  2D7I A;  1FRW A;  2A8W A;  2OI7 A;  1R81 A;  2YQS A;  1INI A;  4D11 A;  1H5S C;  3I0L A;  1G23 A;  2AM5 A;  1GA8 A;  5C4C A;  2RJ6 A;  4ARW A;  5IDS A;  1FXJ A;  4M2B A;  1OQM B;  1JV1 A;  4FRP A;  5CQL X;  1TZF A;  3V0O A;  4HO8 A;  1ZIZ A;  4FQW A;  5L6S A;  3CKJ A;  2V0I A;  3OH1 A;  2GGQ A;  3F1Y A;  3U0Y A;  3JUJ A;  4P00 A;  2XWL A;  1HJL A;  5C4D A;  1OMX A;  4HO5 A;  5CMI A;  3T7O A;  2YES A;  3CKN A;  3I0C A;  2PA4 A;  4Y9X A;  4FCE A;  1JYK A;  1G93 A;  3V0L A;  2AEC A;  5CQN X;  4ASY A;  4BQH A;  2QKX A;  1H7G A;  1LL0 A;  3FWW A;  3Q80 A;  5C48 A;  1H5T B;  1VM8 A;  4FRM A;  1VIC A;  1H5R A;  3ZGF A;  5FUH A;  2FYA A;  2OEF A;  1R7V A;  4M28 A;  1YRO B;  2Y4J A;  4M4K A;  2JCO A;  3I0G A;  2P72 A;  5FTS A;  4E1K A;  4AYJ A;  2VXL A;  3R3I A;  1NF5 B;  1INJ A;  4GBP A;  3ZLL A;  3OAM A;  4BMA A;  1ZJ3 A;  1JVD A;  4HO6 A;  3SX3 A;  1ZI3 A;  4FRQ A;  5CMF X;  1W55 A;  2O1F A;  1ZI4 A;  2VS4 A;  2JCJ A;  1VH3 A;  2YC5 A;  4D11 C;  2Y4M A;  1W77 A;  3I0E A;  3R2W A;  1ZJ1 A;  2AGD A;  3RSB A;  2YQJ A;  3V0N A;  1ZCV A;  3QVB A;  1G2V A;  2RJ5 A;  5C3A A;  2GGO A;  2RJ8 A;  3V90 A;  3JTJ A;  5L6V A;  2P73 A;  1MP3 A;  2FYB A;  1ZJ2 A;  2Z87 A;  4B42 A;  4KPX A;  3CKO A;  1XZ6 A;  4HO0 A;  3ZLK A;  2BO8 A;  1VGU A;  4Y7U A;  2W0V A;  1WT1 A;  1FWY A;  1R7U A;  5J49 A;  1H5S B;  2I5E A;  2YQC A;  2RJ4 A;  1LVW A;  1S4N A;  1XHB A;  2A8U A;  5EIY A;  4FRB A;  4Y7G A;  4KXO A;  1FR9 A;  4EE3 A;  5C1L A;  5CMH A;  4JIS A;  3U2W A;  1FR8 A;  1GWV A;  3I0F A;  3SXC A;  4FRL A;  4KC4 A;  1R7T A;  1FG5 N;  5C36 A;  1R80 A;  3K8E A;  2X5S A;  3Q4S A;  2APC A;  2OEG A;  4EEM A;  2QH5 A;  2Q4J A;  1G97 A;  1H5S D;  1PZY B;  1IIM A;  2XWN A;  5JQQ A;  3SX7 A;  4UEG A;  5EJ1 A;  1ZCY A;  2RJ0 A;  1LL2 A;  1NWG B;  3JUK A;  1O23 B;  2P6W A;  3IOI A;  2E3D A;  1VPA A;  2WVM A;  4HG6 A;  2FYD B;  4Y7T A;  5C4B A;  4B5B A;  1S4P A;  1MC3 A;  1QGS A;  1LL3 A;  4HO2 A;  1QGQ A;  3POL A;  3D98 A;  4D0T A;  5HS2 A;  2RJ1 A;  3F1C A;  1G9R A;  4NAL A;  3V91 A;  1G3L A;  1IIN A;  5FTV A;  2AM4 A;  3T7M A;  5AJO A;  5C3B A;  5C47 A;  4Y63 A;  5C4E A;  5AJN A;  3BRK X;  1V82 A;  4KRV A;  2OI6 A;  3TZT A;  4K6R A;  4Y64 A;  4EVW A;  2O1G A;  1H3M A;  2VD4 A;  4FRH A;  3RMV A;  1WT3 A;  1ON6 A;  4AAW A;  5BXC A;  3O3P A;  1LZ0 A;  4AC3 A;  5CMJ A;  2I7B A;  4L41 C;  2WGZ A;  3DJ4 A;  1G0R A;  4YS8 A;  3D5N A;  5IFY A;  4J18 A;  1WT2 A;  5FU8 A;  4IRP A;  3I0I X;  1I52 A;  3SXB A;  2ICX A;  4NAI A;  3IOH A;  2RIZ A;  3V0P A;  4HO9 A;  1H7Q A;  1W57 A;  2FY7 A;  3U0X A;  1H4C A;  4Y6U A;  1ZI5 A;  2VS5 A;  4FRD A;  3NGW A;  4G87 A;  1E5K A;  1R7X A;  2BO6 A;  2FFV A;  2DPW A;  2Y6P A;  2ZU7 A;  2VXM A;  2RIY A;  3KIA A;  4EEA A;  2ZU9 A;  1JYL A;  5CQO A;  3SPT A;  1GQC A;  3U2U A;  3TQD A;  1FXO A;  1H7F A;  1EYR A;  1TW1 A;  3FOQ A;  5C3D A;  3I0H A;  2WVL A;  4ZDQ A;  1EZI A;  4JD0 A;  1FO9 A;  3E25 A;  1ZI1 A;  4C2S A;  1H5R B;  1PZT A;  4CJ8 A;  2XMH A;  1ZCT A;  3OGZ A;  1ZDF A;  1YP4 A;  3E26 A;  3CGX A;  3T7N A;  1G1L A;  1KWS A;  2MZB A;  2V0H A;  2VS3 A;  4G3Q A;  3N9W A;  1HM9 A;  2PX7 A;  4KT7 A;  1ZJ0 A;  5C49 A;  4Y7V A;  4KNR A;  3PKP A;  3V0M A;  4MYB A;  3PNN A;  2BO7 A;  3OH2 A;  5EJZ A;  4FRE A;  1YP3 A;  1WSZ A;  4LW3 A;  1ZHJ A;  3USR A;  2WVK A;  3V0Q A;  5AJP A;  4B4G A;  1H7L A;  1S4O A;  1GX4 A;  2FYC B;  2VSI A;  3D8V A;  5FV9 A;  2CU2 A;  2AH9 A;  4HCQ A;  4B3U A;  3IOJ A;  1R7Y A;  5DDV A;  3I0J A;  2AE7 A;  2XWM A;  1H5T A;  3EE5 A;  4HO4 A;  2V0K A;  5CMG X;  3Q7U A;  3U2X A;  5C1G A;  1GX0 A;  1MP4 A;  2RJ7 A;  3SX5 A;  2Z86 A;  4CJB A;  2VFZ A;  2YC3 A;  1TVY A;  4D0Z A;  5I1F A;  1VGT A;  1H4E A;  1TW5 A;  2QGI A;  1ON8 A;  2X5Z A;  3DUV A;  5C4F A;  2OI5 A;  1FGG A;  1ZJO A;  4KNX A;  4CJC A;  2NXV A;  1QWJ A;  4P02 A;  3USQ A;  3ZGG A;  1JV3 A;  2X65 A;  1VZU A;  1QG8 A;  4B2X A;  4AYL A;  1R82 A;  1HM0 A;  2WE9 A;  3CU0 A;  1ZCU A;  4KQL A;  1G8O A;  4MND A;  2X60 A;  3K8D A;  1HM8 A;  4XWI A;  4DE7 A;  2YCM A;  1G95 A;  4G3P A;  1VZX A;  2Y4K A;  2AES A;  2D7R A;  1H7E A;  1H7H A;  3HL3 A;  1VGZ A;  1NMM B;  2Y4L A;  4NAN A;  3I0D A;  3PKQ A;  4KC2 A;  5CQM X;  3SX8 A;  3SXG A;  1WT0 A;  2JCL A;  3SXE A;  4NAK A;  1O0R A;  1O7O A;  1OMZ A;  2E8B A;  1HJJ A;  3RMW A;  3CKV A;  2I5K A;  3GUE A;  2V0J A;  3V8Z A;  2BO4 A;  1GQ9 A;  3ST8 A;  4ECM A;  4R7P A;  1LZJ A;  4EE5 A;  1O7Q A;  4CVH A;  3LW6 A;  1H5S A;  4HOC A;  4Y62 A;  4FCU A;  1NQI B;  4KC1 A;  2WEE A;  2V0L A;  5IDT A;  2YQH A;  1MP5 A;  2XME A;  5CQP A;  1YP2 A;  4EEG A;  4ASJ A;  1GWW A;  1H7T A;  1K4V A;  3V8Y A;  2JCK A;  2UX8 A;  2W0W A;  1FO8 A;  3DK5 A;  2ICY A;  1JVG A;  4D48 A;  2Y7A A;  1SS9 A;  3OKR A;  2D0J A;  5DDT A;  3U2T A;  3BCV A;  1FZW A;  3ZF8 A;  4FRO A;  4DEC A;  5C38 A;  2PGY A;  5C8R A;  2AM3 A;  1LZI A;  3OH0 A;  1LZ7 A;  1HV9 A;  4B4M A;  3U2V A;  4LW6 A;  2RIT A;  1H4D A;  4HO3 A;  4FRA A;  4EE4 A;  1VZT A;  1ZDG A;  3I0K A; 
#chains in the Genus database with same CATH topology
 4EEO A;  1V83 A;  1VH1 A;  5FU0 A;  3SXA A;  4G3S A;  4DDZ A;  2RIX A;  4Y7F A;  2FFU A;  4B4B A;  3CKQ A;  4IRQ A;  1FGX A;  4Y6N A;  3SXD A;  1FOA A;  1NHE B;  5FYE A;  3OH4 A;  1VGW A;  2VSH A;  1V84 A;  1WVC A;  2RJ9 A;  2WAW A;  1Z90 A;  4M2A A;  1NKH B;  2ZU8 A;  3OH3 A;  4B2W A;  4KPZ A;  3OC9 A;  2O1H A;  5C1H A;  1ZJP A;  2PGV A;  2D7I A;  1FRW A;  2A8W A;  2OI7 A;  1R81 A;  2YQS A;  1INI A;  4D11 A;  1H5S C;  3I0L A;  1G23 A;  2AM5 A;  1GA8 A;  5C4C A;  2RJ6 A;  4ARW A;  5IDS A;  1FXJ A;  4M2B A;  1OQM B;  1JV1 A;  4FRP A;  5CQL X;  1TZF A;  3V0O A;  4HO8 A;  1ZIZ A;  4FQW A;  5L6S A;  3CKJ A;  2V0I A;  3OH1 A;  2GGQ A;  3F1Y A;  3U0Y A;  3JUJ A;  4P00 A;  2XWL A;  1HJL A;  5C4D A;  1OMX A;  4HO5 A;  5CMI A;  3T7O A;  2YES A;  3CKN A;  3I0C A;  2PA4 A;  4Y9X A;  4FCE A;  5D91 A;  1JYK A;  1G93 A;  3V0L A;  2AEC A;  5CQN X;  4ASY A;  4BQH A;  2QKX A;  1H7G A;  1LL0 A;  3FWW A;  3Q80 A;  5C48 A;  1H5T B;  1VM8 A;  4FRM A;  1VIC A;  1H5R A;  3ZGF A;  5FUH A;  2FYA A;  2OEF A;  1R7V A;  4M28 A;  1YRO B;  2Y4J A;  4M4K A;  2JCO A;  3I0G A;  2P72 A;  5FTS A;  4E1K A;  4AYJ A;  2VXL A;  3R3I A;  1NF5 B;  1INJ A;  4GBP A;  3ZLL A;  3OAM A;  4BMA A;  1ZJ3 A;  1JVD A;  4HO6 A;  3SX3 A;  1ZI3 A;  4FRQ A;  5CMF X;  1W55 A;  2O1F A;  1ZI4 A;  2VS4 A;  2JCJ A;  1VH3 A;  2YC5 A;  4D11 C;  2Y4M A;  1W77 A;  3I0E A;  3R2W A;  1ZJ1 A;  2AGD A;  3RSB A;  2YQJ A;  3V0N A;  1ZCV A;  3QVB A;  1G2V A;  2RJ5 A;  5C3A A;  2GGO A;  2RJ8 A;  3V90 A;  3JTJ A;  5L6V A;  2P73 A;  1MP3 A;  2FYB A;  1ZJ2 A;  2Z87 A;  4B42 A;  4KPX A;  3CKO A;  1XZ6 A;  4HO0 A;  3ZLK A;  2BO8 A;  1VGU A;  4Y7U A;  2W0V A;  1WT1 A;  1FWY A;  1R7U A;  5J49 A;  1H5S B;  2I5E A;  2YQC A;  2RJ4 A;  1LVW A;  1S4N A;  1XHB A;  2A8U A;  5EIY A;  4FRB A;  4Y7G A;  4KXO A;  1FR9 A;  4EE3 A;  5C1L A;  5CMH A;  4JIS A;  3U2W A;  1FR8 A;  1GWV A;  3I0F A;  3SXC A;  4FRL A;  4KC4 A;  1R7T A;  1FG5 N;  5C36 A;  1R80 A;  3K8E A;  2X5S A;  3Q4S A;  2APC A;  2OEG A;  4EEM A;  2QH5 A;  2Q4J A;  1G97 A;  1H5S D;  1PZY B;  1IIM A;  2XWN A;  5JQQ A;  3SX7 A;  4UEG A;  5EJ1 A;  1ZCY A;  2RJ0 A;  1LL2 A;  1NWG B;  3JUK A;  1O23 B;  2P6W A;  3IOI A;  2E3D A;  1VPA A;  2WVM A;  4HG6 A;  2FYD B;  4Y7T A;  5C4B A;  4B5B A;  1S4P A;  1MC3 A;  1QGS A;  1LL3 A;  4HO2 A;  1QGQ A;  3POL A;  3D98 A;  4D0T A;  5HS2 A;  2RJ1 A;  3F1C A;  1G9R A;  4NAL A;  3V91 A;  1G3L A;  1IIN A;  5FTV A;  2AM4 A;  3T7M A;  5AJO A;  5C3B A;  5C47 A;  4Y63 A;  5C4E A;  5AJN A;  3BRK X;  1V82 A;  4KRV A;  2OI6 A;  3TZT A;  4K6R A;  4Y64 A;  4EVW A;  2O1G A;  1H3M A;  2VD4 A;  4FRH A;  3RMV A;  1WT3 A;  1ON6 A;  4AAW A;  5BXC A;  3O3P A;  1LZ0 A;  4AC3 A;  5CMJ A;  2I7B A;  4L41 C;  2WGZ A;  3DJ4 A;  1G0R A;  4YS8 A;  3D5N A;  5IFY A;  4J18 A;  1WT2 A;  5FU8 A;  4IRP A;  3I0I X;  1I52 A;  3SXB A;  2ICX A;  4NAI A;  3IOH A;  2RIZ A;  3V0P A;  4HO9 A;  1H7Q A;  1W57 A;  2FY7 A;  3U0X A;  1H4C A;  4Y6U A;  1ZI5 A;  2VS5 A;  4FIY A;  3NGW A;  4FRD A;  4G87 A;  1E5K A;  1R7X A;  2BO6 A;  2FFV A;  2DPW A;  2Y6P A;  2ZU7 A;  2VXM A;  2RIY A;  3KIA A;  4EEA A;  2ZU9 A;  1JYL A;  5CQO A;  3SPT A;  1GQC A;  3U2U A;  3TQD A;  1FXO A;  1H7F A;  1EYR A;  1TW1 A;  3FOQ A;  5C3D A;  3I0H A;  2WVL A;  4ZDQ A;  1EZI A;  4JD0 A;  1FO9 A;  2VK9 A;  3E25 A;  1ZI1 A;  4C2S A;  4FIX A;  1H5R B;  1PZT A;  4CJ8 A;  2XMH A;  1ZCT A;  3OGZ A;  1ZDF A;  1YP4 A;  3E26 A;  3CGX A;  3T7N A;  1G1L A;  1KWS A;  2MZB A;  2V0H A;  2VS3 A;  4G3Q A;  3N9W A;  1HM9 A;  2PX7 A;  4KT7 A;  1ZJ0 A;  5C49 A;  4Y7V A;  4KNR A;  3PKP A;  3V0M A;  4MYB A;  3PNN A;  2BO7 A;  3OH2 A;  5EJZ A;  4FRE A;  1YP3 A;  1WSZ A;  4LW3 A;  1ZHJ A;  3USR A;  2J0A A;  2WVK A;  3V0Q A;  5AJP A;  4B4G A;  1H7L A;  1S4O A;  1GX4 A;  2FYC B;  2VSI A;  3D8V A;  5FV9 A;  2CU2 A;  2AH9 A;  4HCQ A;  4B3U A;  3IOJ A;  1R7Y A;  5DDV A;  3I0J A;  2AE7 A;  2XWM A;  1H5T A;  3EE5 A;  4HO4 A;  2V0K A;  5CMG X;  3Q7U A;  3U2X A;  5C1G A;  1GX0 A;  1MP4 A;  2RJ7 A;  3SX5 A;  2Z86 A;  4CJB A;  2VFZ A;  2YC3 A;  1TVY A;  4D0Z A;  5I1F A;  1VGT A;  1H4E A;  1TW5 A;  2QGI A;  1ON8 A;  2X5Z A;  3DUV A;  5C4F A;  2OI5 A;  4MIX A;  1FGG A;  1ZJO A;  4KNX A;  4CJC A;  2NXV A;  1QWJ A;  4O6M A;  4P02 A;  3USQ A;  1JV3 A;  3ZGG A;  2X65 A;  1VZU A;  1QG8 A;  4B2X A;  4AYL A;  1R82 A;  1HM0 A;  2WE9 A;  3CU0 A;  1ZCU A;  4O6N A;  4KQL A;  1G8O A;  4MND A;  2X60 A;  3K8D A;  1HM8 A;  4XWI A;  4DE7 A;  2YCM A;  1G95 A;  4G3P A;  1VZX A;  2Y4K A;  2AES A;  2D7R A;  2C0N A;  1H7E A;  1H7H A;  3HL3 A;  1VGZ A;  1NMM B;  2Y4L A;  4NAN A;  3I0D A;  3PKQ A;  4KC2 A;  5CQM X;  3SX8 A;  3SXG A;  1WT0 A;  2JCL A;  3SXE A;  4NAK A;  1O0R A;  1O7O A;  1OMZ A;  2E8B A;  1HJJ A;  3RMW A;  3CKV A;  2I5K A;  3GUE A;  2V0J A;  3V8Z A;  2BO4 A;  1GQ9 A;  3ST8 A;  4ECM A;  4Q7C A;  4R7P A;  1LZJ A;  4EE5 A;  1O7Q A;  5D92 A;  4CVH A;  3LW6 A;  1H5S A;  4HOC A;  4Y62 A;  4FCU A;  1NQI B;  4KC1 A;  2WEE A;  2V0L A;  5IDT A;  2YQH A;  1MP5 A;  2XME A;  5CQP A;  1YP2 A;  4EEG A;  4ASJ A;  1GWW A;  1H7T A;  1K4V A;  3V8Y A;  2JCK A;  2UX8 A;  2W0W A;  1FO8 A;  3DK5 A;  2ICY A;  1JVG A;  4D48 A;  2Y7A A;  1SS9 A;  3OKR A;  2D0J A;  5DDT A;  3U2T A;  3BCV A;  1FZW A;  2J0B A;  3ZF8 A;  4FRO A;  4DEC A;  5C38 A;  2PGY A;  5C8R A;  2AM3 A;  1LZI A;  3OH0 A;  1LZ7 A;  1HV9 A;  4B4M A;  3U2V A;  4LW6 A;  2RIT A;  1H4D A;  4HO3 A;  4FRA A;  4EE4 A;  1VZT A;  1ZDG A;  3I0K A; 
#chains in the Genus database with same CATH homology
 4EEO A;  1V83 A;  1VH1 A;  5FU0 A;  3SXA A;  4G3S A;  4DDZ A;  2RIX A;  4Y7F A;  2FFU A;  4B4B A;  3CKQ A;  4IRQ A;  1FGX A;  4Y6N A;  3SXD A;  1FOA A;  1NHE B;  5FYE A;  3OH4 A;  1VGW A;  2VSH A;  1V84 A;  1WVC A;  2RJ9 A;  2WAW A;  1Z90 A;  4M2A A;  1NKH B;  2ZU8 A;  3OH3 A;  4B2W A;  4KPZ A;  3OC9 A;  2O1H A;  5C1H A;  1ZJP A;  2PGV A;  2D7I A;  1FRW A;  2A8W A;  2OI7 A;  1R81 A;  2YQS A;  1INI A;  4D11 A;  1H5S C;  3I0L A;  1G23 A;  2AM5 A;  1GA8 A;  5C4C A;  2RJ6 A;  4ARW A;  5IDS A;  1FXJ A;  4M2B A;  1OQM B;  1JV1 A;  4FRP A;  5CQL X;  1TZF A;  3V0O A;  4HO8 A;  1ZIZ A;  4FQW A;  5L6S A;  3CKJ A;  2V0I A;  3OH1 A;  2GGQ A;  3F1Y A;  3U0Y A;  3JUJ A;  4P00 A;  2XWL A;  1HJL A;  5C4D A;  1OMX A;  4HO5 A;  5CMI A;  3T7O A;  2YES A;  3CKN A;  3I0C A;  2PA4 A;  4Y9X A;  4FCE A;  5D91 A;  1JYK A;  1G93 A;  3V0L A;  2AEC A;  5CQN X;  4ASY A;  4BQH A;  2QKX A;  1H7G A;  1LL0 A;  3FWW A;  3Q80 A;  5C48 A;  1H5T B;  1VM8 A;  4FRM A;  1VIC A;  1H5R A;  3ZGF A;  5FUH A;  2FYA A;  2OEF A;  1R7V A;  4M28 A;  1YRO B;  2Y4J A;  4M4K A;  2JCO A;  3I0G A;  2P72 A;  5FTS A;  4E1K A;  4AYJ A;  2VXL A;  3R3I A;  1NF5 B;  1INJ A;  4GBP A;  3ZLL A;  3OAM A;  4BMA A;  1ZJ3 A;  1JVD A;  4HO6 A;  3SX3 A;  1ZI3 A;  4FRQ A;  5CMF X;  1W55 A;  2O1F A;  1ZI4 A;  2VS4 A;  2JCJ A;  1VH3 A;  2YC5 A;  4D11 C;  2Y4M A;  1W77 A;  3I0E A;  3R2W A;  1ZJ1 A;  2AGD A;  3RSB A;  2YQJ A;  3V0N A;  1ZCV A;  3QVB A;  1G2V A;  2RJ5 A;  5C3A A;  2GGO A;  2RJ8 A;  3V90 A;  3JTJ A;  5L6V A;  2P73 A;  1MP3 A;  2FYB A;  1ZJ2 A;  2Z87 A;  4B42 A;  4KPX A;  3CKO A;  1XZ6 A;  4HO0 A;  3ZLK A;  2BO8 A;  1VGU A;  4Y7U A;  2W0V A;  1WT1 A;  1FWY A;  1R7U A;  5J49 A;  1H5S B;  2I5E A;  2YQC A;  2RJ4 A;  1LVW A;  1S4N A;  1XHB A;  2A8U A;  5EIY A;  4FRB A;  4Y7G A;  4KXO A;  1FR9 A;  4EE3 A;  5C1L A;  5CMH A;  4JIS A;  3U2W A;  1FR8 A;  1GWV A;  3I0F A;  3SXC A;  4FRL A;  4KC4 A;  1R7T A;  1FG5 N;  5C36 A;  1R80 A;  3K8E A;  2X5S A;  3Q4S A;  2APC A;  2OEG A;  4EEM A;  2QH5 A;  2Q4J A;  1G97 A;  1H5S D;  1PZY B;  1IIM A;  2XWN A;  5JQQ A;  3SX7 A;  4UEG A;  5EJ1 A;  1ZCY A;  2RJ0 A;  1LL2 A;  1NWG B;  3JUK A;  1O23 B;  2P6W A;  3IOI A;  2E3D A;  1VPA A;  2WVM A;  4HG6 A;  2FYD B;  4Y7T A;  5C4B A;  4B5B A;  1S4P A;  1MC3 A;  1QGS A;  1LL3 A;  4HO2 A;  1QGQ A;  3POL A;  3D98 A;  4D0T A;  5HS2 A;  2RJ1 A;  3F1C A;  1G9R A;  4NAL A;  3V91 A;  1G3L A;  1IIN A;  5FTV A;  2AM4 A;  3T7M A;  5AJO A;  5C3B A;  5C47 A;  4Y63 A;  5C4E A;  5AJN A;  3BRK X;  1V82 A;  4KRV A;  2OI6 A;  3TZT A;  4K6R A;  4Y64 A;  4EVW A;  2O1G A;  1H3M A;  2VD4 A;  4FRH A;  3RMV A;  1WT3 A;  1ON6 A;  4AAW A;  5BXC A;  3O3P A;  1LZ0 A;  4AC3 A;  5CMJ A;  2I7B A;  4L41 C;  2WGZ A;  3DJ4 A;  1G0R A;  4YS8 A;  3D5N A;  5IFY A;  4J18 A;  1WT2 A;  5FU8 A;  4IRP A;  3I0I X;  1I52 A;  3SXB A;  2ICX A;  4NAI A;  3IOH A;  2RIZ A;  3V0P A;  4HO9 A;  1H7Q A;  1W57 A;  2FY7 A;  3U0X A;  1H4C A;  4Y6U A;  1ZI5 A;  2VS5 A;  4FIY A;  3NGW A;  4FRD A;  4G87 A;  1E5K A;  1R7X A;  2BO6 A;  2FFV A;  2DPW A;  2Y6P A;  2ZU7 A;  2VXM A;  2RIY A;  3KIA A;  4EEA A;  2ZU9 A;  1JYL A;  5CQO A;  3SPT A;  1GQC A;  3U2U A;  3TQD A;  1FXO A;  1H7F A;  1EYR A;  1TW1 A;  3FOQ A;  5C3D A;  3I0H A;  2WVL A;  4ZDQ A;  1EZI A;  4JD0 A;  1FO9 A;  2VK9 A;  3E25 A;  1ZI1 A;  4C2S A;  4FIX A;  1H5R B;  1PZT A;  4CJ8 A;  2XMH A;  1ZCT A;  3OGZ A;  1ZDF A;  1YP4 A;  3E26 A;  3CGX A;  3T7N A;  1G1L A;  1KWS A;  2MZB A;  2V0H A;  2VS3 A;  4G3Q A;  3N9W A;  1HM9 A;  2PX7 A;  4KT7 A;  1ZJ0 A;  5C49 A;  4Y7V A;  4KNR A;  3PKP A;  3V0M A;  4MYB A;  3PNN A;  2BO7 A;  3OH2 A;  5EJZ A;  4FRE A;  1YP3 A;  1WSZ A;  4LW3 A;  1ZHJ A;  3USR A;  2J0A A;  2WVK A;  3V0Q A;  5AJP A;  4B4G A;  1H7L A;  1S4O A;  1GX4 A;  2FYC B;  2VSI A;  3D8V A;  5FV9 A;  2CU2 A;  2AH9 A;  4HCQ A;  4B3U A;  3IOJ A;  1R7Y A;  5DDV A;  3I0J A;  2AE7 A;  2XWM A;  1H5T A;  3EE5 A;  4HO4 A;  2V0K A;  5CMG X;  3Q7U A;  3U2X A;  5C1G A;  1GX0 A;  1MP4 A;  2RJ7 A;  3SX5 A;  2Z86 A;  4CJB A;  2VFZ A;  2YC3 A;  1TVY A;  4D0Z A;  5I1F A;  1VGT A;  1H4E A;  1TW5 A;  2QGI A;  1ON8 A;  2X5Z A;  3DUV A;  5C4F A;  2OI5 A;  4MIX A;  1FGG A;  1ZJO A;  4KNX A;  4CJC A;  2NXV A;  1QWJ A;  4O6M A;  4P02 A;  3USQ A;  1JV3 A;  3ZGG A;  2X65 A;  1VZU A;  1QG8 A;  4B2X A;  4AYL A;  1R82 A;  1HM0 A;  2WE9 A;  3CU0 A;  1ZCU A;  4O6N A;  4KQL A;  1G8O A;  4MND A;  2X60 A;  3K8D A;  1HM8 A;  4XWI A;  4DE7 A;  2YCM A;  1G95 A;  4G3P A;  1VZX A;  2Y4K A;  2AES A;  2D7R A;  2C0N A;  1H7E A;  1H7H A;  3HL3 A;  1VGZ A;  1NMM B;  2Y4L A;  4NAN A;  3I0D A;  3PKQ A;  4KC2 A;  5CQM X;  3SX8 A;  3SXG A;  1WT0 A;  2JCL A;  3SXE A;  4NAK A;  1O0R A;  1O7O A;  1OMZ A;  2E8B A;  1HJJ A;  3RMW A;  3CKV A;  2I5K A;  3GUE A;  2V0J A;  3V8Z A;  2BO4 A;  1GQ9 A;  3ST8 A;  4ECM A;  4Q7C A;  4R7P A;  1LZJ A;  4EE5 A;  1O7Q A;  5D92 A;  4CVH A;  3LW6 A;  1H5S A;  4HOC A;  4Y62 A;  4FCU A;  1NQI B;  4KC1 A;  2WEE A;  2V0L A;  5IDT A;  2YQH A;  1MP5 A;  2XME A;  5CQP A;  1YP2 A;  4EEG A;  4ASJ A;  1GWW A;  1H7T A;  1K4V A;  3V8Y A;  2JCK A;  2UX8 A;  2W0W A;  1FO8 A;  3DK5 A;  2ICY A;  1JVG A;  4D48 A;  2Y7A A;  1SS9 A;  3OKR A;  2D0J A;  5DDT A;  3U2T A;  3BCV A;  1FZW A;  2J0B A;  3ZF8 A;  4FRO A;  4DEC A;  5C38 A;  2PGY A;  5C8R A;  2AM3 A;  1LZI A;  3OH0 A;  1LZ7 A;  1HV9 A;  4B4M A;  3U2V A;  4LW6 A;  2RIT A;  1H4D A;  4HO3 A;  4FRA A;  4EE4 A;  1VZT A;  1ZDG A;  3I0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...