5FTSA

Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
301
structure length
296
Chain Sequence
HHHHKRKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLGSASQRQTGASVFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIATLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLLTETVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
publication title Allosteric Competitive Inhibitors of the Glucose-1-Phosphate Thymidylyltransferase (Rmla) from Pseudomonas Aeruginosa.
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 98
structure length 296
sequence length 301
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.24: Glucose-1-phosphate thymidylyltransferase.
pdb deposition date 2016-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5ftsA00
3K8EA 1V83A 4AYLA 4EEGA 3I0LA 2CU2A 3I0DA 4ASJA 1O7OA 1HV9A 1ZJ1A 1TVYA 2BO6A 2JCKA 2W0WA 2XWNA 3V0QA 1R7UA 1H7QA 1MC3A 4KC2A 5BXCA 3TQDA 2FY7A 1MP3A 1FXJA 2PGYA 3D5NA 4FRDA 2X5SA 1G0RA 5C4FA 5C1GA 5C3DA 3OH2A 3CKVA 3F1CA 3V0MA 3OGZA 2FYDB 1WT2A 3SX3A 1H7TA 4FRAA 2MZBA 5CMIA 1G3LA 4EE3A 3OH3A 1R80A 3OC9A 4G3QA 4KRVA 1GA8A 4Y6UA 3CKQA 4Y64A 1FOAA 5CMHA 2V0HA 3V91A 3OH1A 5C4CA 1S4PA 1YP2A 4YS8A 2AM4A 5DDVA 4KQLA 2RJ7A 4B3UA 3LW6A 3IOHA 3F1YA 2WVLA 4KNXA 1S4NA 2P73A 1R7TA 2V0IA 5C1HA 1H5SC 2VXMA 3U2XA 1IIMA 1O0RA 1XZ6A 3ZGFA 4LW3A 1LZJA 4HO9A 1EYRA 1ZIZA 1PZTA 2Q4JA 3O3PA 2RITA 4MNDA 4D11C 5I1FA 2FYAA 3Q7UA 3RMVA 4D11A 3CU0A 4D48A 4G3PA 3V0NA 2XWMA 2YQCA 4FQWA 3Q80A 1NQIB 4K6RA 5IDSA 3KIAA 2RJ8A 3U2UA 4AC3A 1FXOA 2O1FA 1G1LA 1LZIA 3CGXA 1ZDFA 5DDTA 2QH5A 3BRKX 1FZWA 3OAMA 4IRPA 3TZTA 4AAWA 1ZCUA 4LW6A 5L6SA 1NWGB 2PX7A 4M4KA 2X60A 3I0JA 2OI6A 4EVWA 4HO5A 4ARWA 5C4DA 1GWWA 2FYCB 1FO9A 1WT0A 3RMWA 4DDZA 3EE5A 1ZJPA 1ZI4A 3Q4SA 2ZU7A 2ZU8A 4EE4A 4DE7A 2YC3A 4Y7UA 3SXGA 5C36A 5C8RA 3ST8A 1LZ0A 3CKOA 3JUJA 1O23B 3I0KA 4NAIA 1VM8A 2D7RA 4C2SA 2JCLA 2YQJA 4HO3A 1NF5B 5EJZA 3SXBA 3D98A 5JQQA 1OMZA 4NANA 2RJ9A 2AE7A 5CQNX 3DJ4A 5AJNA 4KC4A 1ZJ2A 1ZJOA 3POLA 4R7PA 4Y9XA 4Y63A 3SX5A 1VH3A 1YROB 3T7OA 3ZF8A 5C38A 3I0FA 2P6WA 1IINA 3N9WA 1G97A 4Y6NA 1YP4A 2ICYA 2O1GA 5FV9A 1R7VA 4FRBA 2Y6PA 4FREA 1VICA 4B4MA 1G9RA 1FR9A 5C4BA 1TW1A 1GWVA 2E3DA 2YQSA 2WEEA 4EE5A 4Y7GA 3V90A 4G3SA 4KXOA 1ZCYA 2RIZA 1JV1A 1ON6A 1JVGA 3V8ZA 2RJ0A 1H4DA 1WT3A 2VS5A 5CMFX 4XWIA 3R2WA 1ZCTA 1VZXA 3OH4A 4M2AA 2VS3A 3E26A 4E1KA 5C49A 1V82A 4NALA 1FWYA 5FU0A 5AJPA 1WT1A 4FRMA 1G8OA 2FFVA 4M28A 5HS2A 3FWWA 2JCOA 1G95A 2APCA 2GGQA 1ZJ3A 5FYEA 2FYBA 3U0XA 5IDTA 1ZJ0A 1H5TB 1LL3A 2WVMA 2PA4A 1O7QA 1VH1A 3I0IX 4BMAA 1QWJA 4MYBA 3U2WA 1KWSA 2RJ6A 5FTVA 1H5TA 4Y7VA 4B2WA 4JD0A 3U2VA 1VZTA 1WSZA 2XWLA 4G87A 3ZLLA 2P72A 1R82A 4Y62A 2RJ5A 1G23A 4KNRA 1LL2A 4HO6A 1FGXA 3K8DA 4Y7TA 1VPAA 4CJ8A 2OI5A 4D0ZA 2NXVA 5FUHA 4DECA 5C4EA 1R7XA 2I5KA 3T7NA 3SXCA 1H7EA 2QGIA 2WGZA 3IOIA 5J49A 2VSIA 1XHBA 4BQHA 1QGQA 1W57A 1K4VA 4HO8A 4CJBA 2RJ1A 2WVKA 1TW5A 2RIXA 3OH0A 2YCMA 3SXEA 1FG5N 1FO8A 2VS4A 3V0LA 1NMMB 3V8YA 2A8WA 4GBPA 1LL0A 4EEAA 3USQA 3CKNA 4D0TA 4FRLA 4L41C 1FGGA 3U2TA 3USRA 4B42A 2AH9A 3SX7A 1ZHJA 1VGWA 2E8BA 2W0VA 2V0JA 2UX8A 3D8VA 1ZI1A 4HG6A 3SXDA 3FOQA 1LZ7A 2RJ4A 3SX8A 1HM8A 5FTSA 5CMGX 4HO4A 4ECMA 3DK5A 2AESA 1H3MA 2VD4A 1HM0A 1EZIA 3JUKA 3I0GA 2Y7AA 2OEFA 2WAWA 3CKJA 4KPZA 5CQLX 4FRQA 1ON8A 3ZGGA 1GQCA 2D0JA 2X65A 2WE9A 4B4BA 5CMJA 2I7BA 4HO0A 1VGTA 2X5ZA 3HL3A 1HJJA 4HO2A 2AGDA 1GX0A 4Y7FA 1HM9A 4FROA 2OI7A 3OKRA 1I52A 3PNNA 3I0CA 4FRPA 5CQOA 1FRWA 3NGWA 1ZI5A 3DUVA 3GUEA 4HOCA 1HJLA 4KC1A 2YESA 2V0LA 1GQ9A 2DPWA 4B4GA 4FCUA 4EEOA 5CQPA 1INJA 1FR8A 4CJCA 1H4CA 4FRHA 1H5SD 1MP4A 1VGZA 1GX4A 3V0OA 2AECA 1H5SB 4M2BA 1G2VA 1OMXA 3ZLKA 1W55A 2Y4JA 1W77A 1R81A 3I0HA 1H7HA 1MP5A 3V0PA 1QG8A 1H5SA 1ZCVA 4CVHA 5IFYA 2PGVA 3SPTA 1INIA 1PZYB 3PKPA 4J18A 1H4EA 5AJOA 2BO8A 4KPXA 1QGSA 3T7MA 2AM3A 1VZUA 2FFUA 2VSHA 1S4OA 2XMHA 1YP3A 1H7GA 1NKHB 4IRQA 4P02A 1ZI3A 2YC5A 1LVWA 2BO4A 1VGUA 4AYJA 4ASYA 2VFZA 5C3BA 1G93A 3IOJA 4P00A 2RIYA 4NAKA 3PKQA 1H5RB 2Y4KA 3R3IA 2GGOA 2Y4LA 4ZDQA 2ICXA 1SS9A 5C47A 2VXLA 4B2XA 1JYLA 1WVCA 3RSBA 2Z86A 2BO7A 2QKXA 1TZFA 2OEGA 1H7LA 1H5RA 1Z90A 3SXAA 3E25A 2I5EA 2A8UA 2Z87A 3QVBA 2JCJA 4KT7A 2AM5A 5C48A 2O1HA 3BCVA 5EIYA 5FU8A 3U0YA 4HCQA 5CQMX 1R7YA 5L6VA 1NHEB 3I0EA 1JV3A 1ZDGA 1JYKA 1OQMB 1JVDA 5C3AA 1V84A 1E5KA 5EJ1A 2Y4MA 2D7IA 4UEGA 4JISA 5C1LA 2ZU9A 2V0KA 4FCEA 4EEMA 2XMEA 2YQHA 3JTJA 4B5BA 1H7FA
chains in the Genus database with same CATH superfamily
3K8EA 1V83A 4AYLA 4EEGA 3I0LA 2CU2A 3I0DA 4ASJA 1O7OA 1HV9A 1ZJ1A 1TVYA 2BO6A 2JCKA 2W0WA 2XWNA 3V0QA 1R7UA 1H7QA 1MC3A 4MIXA 4KC2A 5BXCA 3TQDA 2FY7A 1MP3A 1FXJA 2PGYA 3D5NA 4FRDA 2X5SA 1G0RA 5C4FA 5C1GA 5C3DA 3OH2A 3CKVA 3F1CA 3V0MA 3OGZA 2FYDB 1WT2A 3SX3A 1H7TA 4FRAA 2MZBA 5CMIA 1G3LA 4EE3A 3OH3A 1R80A 3OC9A 4G3QA 4KRVA 1GA8A 4Y6UA 3CKQA 4Y64A 1FOAA 5CMHA 2V0HA 3V91A 3OH1A 5C4CA 1S4PA 1YP2A 4YS8A 2AM4A 5DDVA 4KQLA 2RJ7A 4B3UA 3LW6A 3IOHA 3F1YA 2WVLA 4KNXA 1S4NA 2P73A 1R7TA 2V0IA 5C1HA 1H5SC 2VXMA 3U2XA 1IIMA 1O0RA 1XZ6A 3ZGFA 4LW3A 1LZJA 4HO9A 1EYRA 1ZIZA 1PZTA 2Q4JA 3O3PA 2RITA 4MNDA 4D11C 5I1FA 2FYAA 3Q7UA 3RMVA 4D11A 3CU0A 4D48A 4G3PA 3V0NA 2XWMA 2YQCA 4FQWA 3Q80A 2C0NA 1NQIB 4K6RA 5IDSA 3KIAA 2RJ8A 3U2UA 2J0AA 4AC3A 1FXOA 2O1FA 1G1LA 1LZIA 3CGXA 1ZDFA 5DDTA 2QH5A 3BRKX 1FZWA 3OAMA 4IRPA 3TZTA 4AAWA 1ZCUA 4LW6A 5L6SA 1NWGB 5D92A 2PX7A 4M4KA 2X60A 3I0JA 2OI6A 4EVWA 4HO5A 4ARWA 5C4DA 1GWWA 2FYCB 1FO9A 1WT0A 3RMWA 4DDZA 3EE5A 1ZJPA 1ZI4A 3Q4SA 2ZU7A 2ZU8A 4EE4A 4DE7A 2YC3A 4Y7UA 3SXGA 5C36A 5C8RA 4O6MA 3ST8A 1LZ0A 4O6NA 3CKOA 5D91A 3JUJA 1O23B 3I0KA 4NAIA 1VM8A 2D7RA 4C2SA 2JCLA 2YQJA 4HO3A 1NF5B 5EJZA 3SXBA 4FIXA 3D98A 5JQQA 1OMZA 4NANA 2RJ9A 2AE7A 5CQNX 3DJ4A 5AJNA 4KC4A 1ZJ2A 1ZJOA 3POLA 4R7PA 4Y9XA 4Y63A 3SX5A 1VH3A 1YROB 3T7OA 3ZF8A 5C38A 3I0FA 2P6WA 1IINA 3N9WA 1G97A 4Y6NA 1YP4A 2ICYA 2O1GA 5FV9A 1R7VA 4FRBA 2Y6PA 4FREA 1VICA 4B4MA 1G9RA 1FR9A 5C4BA 1TW1A 1GWVA 2E3DA 2YQSA 2WEEA 4EE5A 4Y7GA 3V90A 4G3SA 4KXOA 1ZCYA 2RIZA 1JV1A 1ON6A 1JVGA 3V8ZA 2RJ0A 1H4DA 1WT3A 2VS5A 5CMFX 4XWIA 3R2WA 1ZCTA 1VZXA 3OH4A 4M2AA 2VS3A 3E26A 4E1KA 2J0BA 5C49A 1V82A 4NALA 1FWYA 5FU0A 5AJPA 1WT1A 4FRMA 1G8OA 2FFVA 4M28A 5HS2A 3FWWA 2JCOA 1G95A 2APCA 2GGQA 1ZJ3A 2VK9A 5FYEA 2FYBA 3U0XA 5IDTA 1ZJ0A 1H5TB 1LL3A 2WVMA 2PA4A 1O7QA 1VH1A 3I0IX 4BMAA 1QWJA 4MYBA 3U2WA 1KWSA 2RJ6A 5FTVA 1H5TA 4Y7VA 4B2WA 4JD0A 3U2VA 1VZTA 1WSZA 2XWLA 4G87A 3ZLLA 2P72A 1R82A 4Y62A 2RJ5A 1G23A 4KNRA 1LL2A 4HO6A 1FGXA 3K8DA 4FIYA 4Y7TA 1VPAA 4CJ8A 2OI5A 4D0ZA 2NXVA 5FUHA 4DECA 5C4EA 1R7XA 2I5KA 3T7NA 3SXCA 1H7EA 2QGIA 2WGZA 3IOIA 5J49A 2VSIA 1XHBA 4BQHA 1QGQA 1W57A 1K4VA 4HO8A 4Q7CA 4CJBA 2RJ1A 2WVKA 1TW5A 2RIXA 3OH0A 2YCMA 3SXEA 1FG5N 1FO8A 2VS4A 3V0LA 1NMMB 3V8YA 2A8WA 4GBPA 1LL0A 4EEAA 3USQA 3CKNA 4D0TA 4FRLA 4L41C 1FGGA 3U2TA 3USRA 4B42A 2AH9A 3SX7A 1ZHJA 1VGWA 2E8BA 2W0VA 2V0JA 2UX8A 3D8VA 1ZI1A 4HG6A 3SXDA 3FOQA 1LZ7A 2RJ4A 3SX8A 1HM8A 5FTSA 5CMGX 4HO4A 4ECMA 3DK5A 2AESA 1H3MA 2VD4A 1HM0A 1EZIA 3JUKA 3I0GA 2Y7AA 2OEFA 2WAWA 3CKJA 4KPZA 5CQLX 4FRQA 1ON8A 3ZGGA 1GQCA 2D0JA 2X65A 2WE9A 4B4BA 5CMJA 2I7BA 4HO0A 1VGTA 2X5ZA 3HL3A 1HJJA 4HO2A 2AGDA 1GX0A 4Y7FA 1HM9A 4FROA 2OI7A 3OKRA 1I52A 3PNNA 3I0CA 4FRPA 5CQOA 1FRWA 3NGWA 1ZI5A 3DUVA 3GUEA 4HOCA 1HJLA 4KC1A 2YESA 2V0LA 1GQ9A 2DPWA 4B4GA 4FCUA 4EEOA 5CQPA 1INJA 1FR8A 4CJCA 1H4CA 4FRHA 1H5SD 1MP4A 1VGZA 1GX4A 3V0OA 2AECA 1H5SB 4M2BA 1G2VA 1OMXA 3ZLKA 1W55A 2Y4JA 1W77A 1R81A 3I0HA 1H7HA 1MP5A 3V0PA 1QG8A 1H5SA 1ZCVA 4CVHA 5IFYA 2PGVA 3SPTA 1INIA 1PZYB 3PKPA 4J18A 1H4EA 5AJOA 2BO8A 4KPXA 1QGSA 3T7MA 2AM3A 1VZUA 2FFUA 2VSHA 1S4OA 2XMHA 1YP3A 1H7GA 1NKHB 4IRQA 4P02A 1ZI3A 2YC5A 1LVWA 2BO4A 1VGUA 4AYJA 4ASYA 2VFZA 5C3BA 1G93A 3IOJA 4P00A 2RIYA 4NAKA 3PKQA 1H5RB 2Y4KA 3R3IA 2GGOA 2Y4LA 4ZDQA 2ICXA 1SS9A 5C47A 2VXLA 4B2XA 1JYLA 1WVCA 3RSBA 2Z86A 2BO7A 2QKXA 1TZFA 2OEGA 1H7LA 1H5RA 1Z90A 3SXAA 3E25A 2I5EA 2A8UA 2Z87A 3QVBA 2JCJA 4KT7A 2AM5A 5C48A 2O1HA 3BCVA 5EIYA 5FU8A 3U0YA 4HCQA 5CQMX 1R7YA 5L6VA 1NHEB 3I0EA 1JV3A 1ZDGA 1JYKA 1OQMB 1JVDA 5C3AA 1V84A 1E5KA 5EJ1A 2Y4MA 2D7IA 4UEGA 4JISA 5C1LA 2ZU9A 2V0KA 4FCEA 4EEMA 2XMEA 2YQHA 3JTJA 4B5BA 1H7FA
chains in the Genus database with same CATH topology
3K8EA 1V83A 4AYLA 4EEGA 3I0LA 2CU2A 3I0DA 4ASJA 1O7OA 1HV9A 1ZJ1A 1TVYA 2BO6A 2JCKA 2W0WA 2XWNA 3V0QA 1R7UA 1H7QA 1MC3A 4MIXA 4KC2A 5BXCA 3TQDA 2FY7A 1MP3A 1FXJA 2PGYA 3D5NA 4FRDA 2X5SA 1G0RA 5C4FA 5C1GA 5C3DA 3OH2A 3CKVA 3F1CA 3V0MA 3OGZA 2FYDB 1WT2A 3SX3A 1H7TA 4FRAA 2MZBA 5CMIA 1G3LA 4EE3A 3OH3A 1R80A 3OC9A 4G3QA 4KRVA 1GA8A 4Y6UA 3CKQA 4Y64A 1FOAA 5CMHA 2V0HA 3V91A 3OH1A 5C4CA 1S4PA 1YP2A 4YS8A 2AM4A 5DDVA 4KQLA 2RJ7A 4B3UA 3LW6A 3IOHA 3F1YA 2WVLA 4KNXA 1S4NA 2P73A 1R7TA 2V0IA 5C1HA 1H5SC 2VXMA 3U2XA 1IIMA 1O0RA 1XZ6A 3ZGFA 4LW3A 1LZJA 4HO9A 1EYRA 1ZIZA 1PZTA 2Q4JA 3O3PA 2RITA 4MNDA 4D11C 5I1FA 2FYAA 3Q7UA 3RMVA 4D11A 3CU0A 4D48A 4G3PA 3V0NA 2XWMA 2YQCA 4FQWA 3Q80A 2C0NA 1NQIB 4K6RA 5IDSA 3KIAA 2RJ8A 3U2UA 2J0AA 4AC3A 1FXOA 2O1FA 1G1LA 1LZIA 3CGXA 1ZDFA 5DDTA 2QH5A 3BRKX 1FZWA 3OAMA 4IRPA 3TZTA 4AAWA 1ZCUA 4LW6A 5L6SA 1NWGB 5D92A 2PX7A 4M4KA 2X60A 3I0JA 2OI6A 4EVWA 4HO5A 4ARWA 5C4DA 1GWWA 2FYCB 1FO9A 1WT0A 3RMWA 4DDZA 3EE5A 1ZJPA 1ZI4A 3Q4SA 2ZU7A 2ZU8A 4EE4A 4DE7A 2YC3A 4Y7UA 3SXGA 5C36A 5C8RA 4O6MA 3ST8A 1LZ0A 4O6NA 3CKOA 5D91A 3JUJA 1O23B 3I0KA 4NAIA 1VM8A 2D7RA 4C2SA 2JCLA 2YQJA 4HO3A 1NF5B 5EJZA 3SXBA 4FIXA 3D98A 5JQQA 1OMZA 4NANA 2RJ9A 2AE7A 5CQNX 3DJ4A 5AJNA 4KC4A 1ZJ2A 1ZJOA 3POLA 4R7PA 4Y9XA 4Y63A 3SX5A 1VH3A 1YROB 3T7OA 3ZF8A 5C38A 3I0FA 2P6WA 1IINA 3N9WA 1G97A 4Y6NA 1YP4A 2ICYA 2O1GA 5FV9A 1R7VA 4FRBA 2Y6PA 4FREA 1VICA 4B4MA 1G9RA 1FR9A 5C4BA 1TW1A 1GWVA 2E3DA 2YQSA 2WEEA 4EE5A 4Y7GA 3V90A 4G3SA 4KXOA 1ZCYA 2RIZA 1JV1A 1ON6A 1JVGA 3V8ZA 2RJ0A 1H4DA 1WT3A 2VS5A 5CMFX 4XWIA 3R2WA 1ZCTA 1VZXA 3OH4A 4M2AA 2VS3A 3E26A 4E1KA 2J0BA 5C49A 1V82A 4NALA 1FWYA 5FU0A 5AJPA 1WT1A 4FRMA 1G8OA 2FFVA 4M28A 5HS2A 3FWWA 2JCOA 1G95A 2APCA 2GGQA 1ZJ3A 2VK9A 5FYEA 2FYBA 3U0XA 5IDTA 1ZJ0A 1H5TB 1LL3A 2WVMA 2PA4A 1O7QA 1VH1A 3I0IX 4BMAA 1QWJA 4MYBA 3U2WA 1KWSA 2RJ6A 5FTVA 1H5TA 4Y7VA 4B2WA 4JD0A 3U2VA 1VZTA 1WSZA 2XWLA 4G87A 3ZLLA 2P72A 1R82A 4Y62A 2RJ5A 1G23A 4KNRA 1LL2A 4HO6A 1FGXA 3K8DA 4FIYA 4Y7TA 1VPAA 4CJ8A 2OI5A 4D0ZA 2NXVA 5FUHA 4DECA 5C4EA 1R7XA 2I5KA 3T7NA 3SXCA 1H7EA 2QGIA 2WGZA 3IOIA 5J49A 2VSIA 1XHBA 4BQHA 1QGQA 1W57A 1K4VA 4HO8A 4Q7CA 4CJBA 2RJ1A 2WVKA 1TW5A 2RIXA 3OH0A 2YCMA 3SXEA 1FG5N 1FO8A 2VS4A 3V0LA 1NMMB 3V8YA 2A8WA 4GBPA 1LL0A 4EEAA 3USQA 3CKNA 4D0TA 4FRLA 4L41C 1FGGA 3U2TA 3USRA 4B42A 2AH9A 3SX7A 1ZHJA 1VGWA 2E8BA 2W0VA 2V0JA 2UX8A 3D8VA 1ZI1A 4HG6A 3SXDA 3FOQA 1LZ7A 2RJ4A 3SX8A 1HM8A 5FTSA 5CMGX 4HO4A 4ECMA 3DK5A 2AESA 1H3MA 2VD4A 1HM0A 1EZIA 3JUKA 3I0GA 2Y7AA 2OEFA 2WAWA 3CKJA 4KPZA 5CQLX 4FRQA 1ON8A 3ZGGA 1GQCA 2D0JA 2X65A 2WE9A 4B4BA 5CMJA 2I7BA 4HO0A 1VGTA 2X5ZA 3HL3A 1HJJA 4HO2A 2AGDA 1GX0A 4Y7FA 1HM9A 4FROA 2OI7A 3OKRA 1I52A 3PNNA 3I0CA 4FRPA 5CQOA 1FRWA 3NGWA 1ZI5A 3DUVA 3GUEA 4HOCA 1HJLA 4KC1A 2YESA 2V0LA 1GQ9A 2DPWA 4B4GA 4FCUA 4EEOA 5CQPA 1INJA 1FR8A 4CJCA 1H4CA 4FRHA 1H5SD 1MP4A 1VGZA 1GX4A 3V0OA 2AECA 1H5SB 4M2BA 1G2VA 1OMXA 3ZLKA 1W55A 2Y4JA 1W77A 1R81A 3I0HA 1H7HA 1MP5A 3V0PA 1QG8A 1H5SA 1ZCVA 4CVHA 5IFYA 2PGVA 3SPTA 1INIA 1PZYB 3PKPA 4J18A 1H4EA 5AJOA 2BO8A 4KPXA 1QGSA 3T7MA 2AM3A 1VZUA 2FFUA 2VSHA 1S4OA 2XMHA 1YP3A 1H7GA 1NKHB 4IRQA 4P02A 1ZI3A 2YC5A 1LVWA 2BO4A 1VGUA 4AYJA 4ASYA 2VFZA 5C3BA 1G93A 3IOJA 4P00A 2RIYA 4NAKA 3PKQA 1H5RB 2Y4KA 3R3IA 2GGOA 2Y4LA 4ZDQA 2ICXA 1SS9A 5C47A 2VXLA 4B2XA 1JYLA 1WVCA 3RSBA 2Z86A 2BO7A 2QKXA 1TZFA 2OEGA 1H7LA 1H5RA 1Z90A 3SXAA 3E25A 2I5EA 2A8UA 2Z87A 3QVBA 2JCJA 4KT7A 2AM5A 5C48A 2O1HA 3BCVA 5EIYA 5FU8A 3U0YA 4HCQA 5CQMX 1R7YA 5L6VA 1NHEB 3I0EA 1JV3A 1ZDGA 1JYKA 1OQMB 1JVDA 5C3AA 1V84A 1E5KA 5EJ1A 2Y4MA 2D7IA 4UEGA 4JISA 5C1LA 2ZU9A 2V0KA 4FCEA 4EEMA 2XMEA 2YQHA 3JTJA 4B5BA 1H7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K8E A;  1V83 A;  4AYL A;  4EEG A;  3I0L A;  2CU2 A;  3I0D A;  4ASJ A;  1O7O A;  1HV9 A;  1ZJ1 A;  1TVY A;  2BO6 A;  2JCK A;  2W0W A;  2XWN A;  3V0Q A;  1R7U A;  1H7Q A;  1MC3 A;  4KC2 A;  5BXC A;  3TQD A;  2FY7 A;  1MP3 A;  1FXJ A;  2PGY A;  3D5N A;  4FRD A;  2X5S A;  1G0R A;  5C4F A;  5C1G A;  5C3D A;  3OH2 A;  3CKV A;  3F1C A;  3V0M A;  3OGZ A;  2FYD B;  1WT2 A;  3SX3 A;  1H7T A;  4FRA A;  2MZB A;  5CMI A;  1G3L A;  4EE3 A;  3OH3 A;  1R80 A;  3OC9 A;  4G3Q A;  4KRV A;  1GA8 A;  4Y6U A;  3CKQ A;  4Y64 A;  1FOA A;  5CMH A;  2V0H A;  3V91 A;  3OH1 A;  5C4C A;  1S4P A;  1YP2 A;  4YS8 A;  2AM4 A;  5DDV A;  4KQL A;  2RJ7 A;  4B3U A;  3LW6 A;  3IOH A;  3F1Y A;  2WVL A;  4KNX A;  1S4N A;  2P73 A;  1R7T A;  2V0I A;  5C1H A;  1H5S C;  2VXM A;  3U2X A;  1IIM A;  1O0R A;  1XZ6 A;  3ZGF A;  4LW3 A;  1LZJ A;  4HO9 A;  1EYR A;  1ZIZ A;  1PZT A;  2Q4J A;  3O3P A;  2RIT A;  4MND A;  4D11 C;  5I1F A;  2FYA A;  3Q7U A;  3RMV A;  4D11 A;  3CU0 A;  4D48 A;  4G3P A;  3V0N A;  2XWM A;  2YQC A;  4FQW A;  3Q80 A;  1NQI B;  4K6R A;  5IDS A;  3KIA A;  2RJ8 A;  3U2U A;  4AC3 A;  1FXO A;  2O1F A;  1G1L A;  1LZI A;  3CGX A;  1ZDF A;  5DDT A;  2QH5 A;  3BRK X;  1FZW A;  3OAM A;  4IRP A;  3TZT A;  4AAW A;  1ZCU A;  4LW6 A;  5L6S A;  1NWG B;  2PX7 A;  4M4K A;  2X60 A;  3I0J A;  2OI6 A;  4EVW A;  4HO5 A;  4ARW A;  5C4D A;  1GWW A;  2FYC B;  1FO9 A;  1WT0 A;  3RMW A;  4DDZ A;  3EE5 A;  1ZJP A;  1ZI4 A;  3Q4S A;  2ZU7 A;  2ZU8 A;  4EE4 A;  4DE7 A;  2YC3 A;  4Y7U A;  3SXG A;  5C36 A;  5C8R A;  3ST8 A;  1LZ0 A;  3CKO A;  3JUJ A;  1O23 B;  3I0K A;  4NAI A;  1VM8 A;  2D7R A;  4C2S A;  2JCL A;  2YQJ A;  4HO3 A;  1NF5 B;  5EJZ A;  3SXB A;  3D98 A;  5JQQ A;  1OMZ A;  4NAN A;  2RJ9 A;  2AE7 A;  5CQN X;  3DJ4 A;  5AJN A;  4KC4 A;  1ZJ2 A;  1ZJO A;  3POL A;  4R7P A;  4Y9X A;  4Y63 A;  3SX5 A;  1VH3 A;  1YRO B;  3T7O A;  3ZF8 A;  5C38 A;  3I0F A;  2P6W A;  1IIN A;  3N9W A;  1G97 A;  4Y6N A;  1YP4 A;  2ICY A;  2O1G A;  5FV9 A;  1R7V A;  4FRB A;  2Y6P A;  4FRE A;  1VIC A;  4B4M A;  1G9R A;  1FR9 A;  5C4B A;  1TW1 A;  1GWV A;  2E3D A;  2YQS A;  2WEE A;  4EE5 A;  4Y7G A;  3V90 A;  4G3S A;  4KXO A;  1ZCY A;  2RIZ A;  1JV1 A;  1ON6 A;  1JVG A;  3V8Z A;  2RJ0 A;  1H4D A;  1WT3 A;  2VS5 A;  5CMF X;  4XWI A;  3R2W A;  1ZCT A;  1VZX A;  3OH4 A;  4M2A A;  2VS3 A;  3E26 A;  4E1K A;  5C49 A;  1V82 A;  4NAL A;  1FWY A;  5FU0 A;  5AJP A;  1WT1 A;  4FRM A;  1G8O A;  2FFV A;  4M28 A;  5HS2 A;  3FWW A;  2JCO A;  1G95 A;  2APC A;  2GGQ A;  1ZJ3 A;  5FYE A;  2FYB A;  3U0X A;  5IDT A;  1ZJ0 A;  1H5T B;  1LL3 A;  2WVM A;  2PA4 A;  1O7Q A;  1VH1 A;  3I0I X;  4BMA A;  1QWJ A;  4MYB A;  3U2W A;  1KWS A;  2RJ6 A;  5FTV A;  1H5T A;  4Y7V A;  4B2W A;  4JD0 A;  3U2V A;  1VZT A;  1WSZ A;  2XWL A;  4G87 A;  3ZLL A;  2P72 A;  1R82 A;  4Y62 A;  2RJ5 A;  1G23 A;  4KNR A;  1LL2 A;  4HO6 A;  1FGX A;  3K8D A;  4Y7T A;  1VPA A;  4CJ8 A;  2OI5 A;  4D0Z A;  2NXV A;  5FUH A;  4DEC A;  5C4E A;  1R7X A;  2I5K A;  3T7N A;  3SXC A;  1H7E A;  2QGI A;  2WGZ A;  3IOI A;  5J49 A;  2VSI A;  1XHB A;  4BQH A;  1QGQ A;  1W57 A;  1K4V A;  4HO8 A;  4CJB A;  2RJ1 A;  2WVK A;  1TW5 A;  2RIX A;  3OH0 A;  2YCM A;  3SXE A;  1FG5 N;  1FO8 A;  2VS4 A;  3V0L A;  1NMM B;  3V8Y A;  2A8W A;  4GBP A;  1LL0 A;  4EEA A;  3USQ A;  3CKN A;  4D0T A;  4FRL A;  4L41 C;  1FGG A;  3U2T A;  3USR A;  4B42 A;  2AH9 A;  3SX7 A;  1ZHJ A;  1VGW A;  2E8B A;  2W0V A;  2V0J A;  2UX8 A;  3D8V A;  1ZI1 A;  4HG6 A;  3SXD A;  3FOQ A;  1LZ7 A;  2RJ4 A;  3SX8 A;  1HM8 A;  5FTS A;  5CMG X;  4HO4 A;  4ECM A;  3DK5 A;  2AES A;  1H3M A;  2VD4 A;  1HM0 A;  1EZI A;  3JUK A;  3I0G A;  2Y7A A;  2OEF A;  2WAW A;  3CKJ A;  4KPZ A;  5CQL X;  4FRQ A;  1ON8 A;  3ZGG A;  1GQC A;  2D0J A;  2X65 A;  2WE9 A;  4B4B A;  5CMJ A;  2I7B A;  4HO0 A;  1VGT A;  2X5Z A;  3HL3 A;  1HJJ A;  4HO2 A;  2AGD A;  1GX0 A;  4Y7F A;  1HM9 A;  4FRO A;  2OI7 A;  3OKR A;  1I52 A;  3PNN A;  3I0C A;  4FRP A;  5CQO A;  1FRW A;  3NGW A;  1ZI5 A;  3DUV A;  3GUE A;  4HOC A;  1HJL A;  4KC1 A;  2YES A;  2V0L A;  1GQ9 A;  2DPW A;  4B4G A;  4FCU A;  4EEO A;  5CQP A;  1INJ A;  1FR8 A;  4CJC A;  1H4C A;  4FRH A;  1H5S D;  1MP4 A;  1VGZ A;  1GX4 A;  3V0O A;  2AEC A;  1H5S B;  4M2B A;  1G2V A;  1OMX A;  3ZLK A;  1W55 A;  2Y4J A;  1W77 A;  1R81 A;  3I0H A;  1H7H A;  1MP5 A;  3V0P A;  1QG8 A;  1H5S A;  1ZCV A;  4CVH A;  5IFY A;  2PGV A;  3SPT A;  1INI A;  1PZY B;  3PKP A;  4J18 A;  1H4E A;  5AJO A;  2BO8 A;  4KPX A;  1QGS A;  3T7M A;  2AM3 A;  1VZU A;  2FFU A;  2VSH A;  1S4O A;  2XMH A;  1YP3 A;  1H7G A;  1NKH B;  4IRQ A;  4P02 A;  1ZI3 A;  2YC5 A;  1LVW A;  2BO4 A;  1VGU A;  4AYJ A;  4ASY A;  2VFZ A;  5C3B A;  1G93 A;  3IOJ A;  4P00 A;  2RIY A;  4NAK A;  3PKQ A;  1H5R B;  2Y4K A;  3R3I A;  2GGO A;  2Y4L A;  4ZDQ A;  2ICX A;  1SS9 A;  5C47 A;  2VXL A;  4B2X A;  1JYL A;  1WVC A;  3RSB A;  2Z86 A;  2BO7 A;  2QKX A;  1TZF A;  2OEG A;  1H7L A;  1H5R A;  1Z90 A;  3SXA A;  3E25 A;  2I5E A;  2A8U A;  2Z87 A;  3QVB A;  2JCJ A;  4KT7 A;  2AM5 A;  5C48 A;  2O1H A;  3BCV A;  5EIY A;  5FU8 A;  3U0Y A;  4HCQ A;  5CQM X;  1R7Y A;  5L6V A;  1NHE B;  3I0E A;  1JV3 A;  1ZDG A;  1JYK A;  1OQM B;  1JVD A;  5C3A A;  1V84 A;  1E5K A;  5EJ1 A;  2Y4M A;  2D7I A;  4UEG A;  4JIS A;  5C1L A;  2ZU9 A;  2V0K A;  4FCE A;  4EEM A;  2XME A;  2YQH A;  3JTJ A;  4B5B A;  1H7F A; 
#chains in the Genus database with same CATH topology
 3K8E A;  1V83 A;  4AYL A;  4EEG A;  3I0L A;  2CU2 A;  3I0D A;  4ASJ A;  1O7O A;  1HV9 A;  1ZJ1 A;  1TVY A;  2BO6 A;  2JCK A;  2W0W A;  2XWN A;  3V0Q A;  1R7U A;  1H7Q A;  1MC3 A;  4MIX A;  4KC2 A;  5BXC A;  3TQD A;  2FY7 A;  1MP3 A;  1FXJ A;  2PGY A;  3D5N A;  4FRD A;  2X5S A;  1G0R A;  5C4F A;  5C1G A;  5C3D A;  3OH2 A;  3CKV A;  3F1C A;  3V0M A;  3OGZ A;  2FYD B;  1WT2 A;  3SX3 A;  1H7T A;  4FRA A;  2MZB A;  5CMI A;  1G3L A;  4EE3 A;  3OH3 A;  1R80 A;  3OC9 A;  4G3Q A;  4KRV A;  1GA8 A;  4Y6U A;  3CKQ A;  4Y64 A;  1FOA A;  5CMH A;  2V0H A;  3V91 A;  3OH1 A;  5C4C A;  1S4P A;  1YP2 A;  4YS8 A;  2AM4 A;  5DDV A;  4KQL A;  2RJ7 A;  4B3U A;  3LW6 A;  3IOH A;  3F1Y A;  2WVL A;  4KNX A;  1S4N A;  2P73 A;  1R7T A;  2V0I A;  5C1H A;  1H5S C;  2VXM A;  3U2X A;  1IIM A;  1O0R A;  1XZ6 A;  3ZGF A;  4LW3 A;  1LZJ A;  4HO9 A;  1EYR A;  1ZIZ A;  1PZT A;  2Q4J A;  3O3P A;  2RIT A;  4MND A;  4D11 C;  5I1F A;  2FYA A;  3Q7U A;  3RMV A;  4D11 A;  3CU0 A;  4D48 A;  4G3P A;  3V0N A;  2XWM A;  2YQC A;  4FQW A;  3Q80 A;  2C0N A;  1NQI B;  4K6R A;  5IDS A;  3KIA A;  2RJ8 A;  3U2U A;  2J0A A;  4AC3 A;  1FXO A;  2O1F A;  1G1L A;  1LZI A;  3CGX A;  1ZDF A;  5DDT A;  2QH5 A;  3BRK X;  1FZW A;  3OAM A;  4IRP A;  3TZT A;  4AAW A;  1ZCU A;  4LW6 A;  5L6S A;  1NWG B;  5D92 A;  2PX7 A;  4M4K A;  2X60 A;  3I0J A;  2OI6 A;  4EVW A;  4HO5 A;  4ARW A;  5C4D A;  1GWW A;  2FYC B;  1FO9 A;  1WT0 A;  3RMW A;  4DDZ A;  3EE5 A;  1ZJP A;  1ZI4 A;  3Q4S A;  2ZU7 A;  2ZU8 A;  4EE4 A;  4DE7 A;  2YC3 A;  4Y7U A;  3SXG A;  5C36 A;  5C8R A;  4O6M A;  3ST8 A;  1LZ0 A;  4O6N A;  3CKO A;  5D91 A;  3JUJ A;  1O23 B;  3I0K A;  4NAI A;  1VM8 A;  2D7R A;  4C2S A;  2JCL A;  2YQJ A;  4HO3 A;  1NF5 B;  5EJZ A;  3SXB A;  4FIX A;  3D98 A;  5JQQ A;  1OMZ A;  4NAN A;  2RJ9 A;  2AE7 A;  5CQN X;  3DJ4 A;  5AJN A;  4KC4 A;  1ZJ2 A;  1ZJO A;  3POL A;  4R7P A;  4Y9X A;  4Y63 A;  3SX5 A;  1VH3 A;  1YRO B;  3T7O A;  3ZF8 A;  5C38 A;  3I0F A;  2P6W A;  1IIN A;  3N9W A;  1G97 A;  4Y6N A;  1YP4 A;  2ICY A;  2O1G A;  5FV9 A;  1R7V A;  4FRB A;  2Y6P A;  4FRE A;  1VIC A;  4B4M A;  1G9R A;  1FR9 A;  5C4B A;  1TW1 A;  1GWV A;  2E3D A;  2YQS A;  2WEE A;  4EE5 A;  4Y7G A;  3V90 A;  4G3S A;  4KXO A;  1ZCY A;  2RIZ A;  1JV1 A;  1ON6 A;  1JVG A;  3V8Z A;  2RJ0 A;  1H4D A;  1WT3 A;  2VS5 A;  5CMF X;  4XWI A;  3R2W A;  1ZCT A;  1VZX A;  3OH4 A;  4M2A A;  2VS3 A;  3E26 A;  4E1K A;  2J0B A;  5C49 A;  1V82 A;  4NAL A;  1FWY A;  5FU0 A;  5AJP A;  1WT1 A;  4FRM A;  1G8O A;  2FFV A;  4M28 A;  5HS2 A;  3FWW A;  2JCO A;  1G95 A;  2APC A;  2GGQ A;  1ZJ3 A;  2VK9 A;  5FYE A;  2FYB A;  3U0X A;  5IDT A;  1ZJ0 A;  1H5T B;  1LL3 A;  2WVM A;  2PA4 A;  1O7Q A;  1VH1 A;  3I0I X;  4BMA A;  1QWJ A;  4MYB A;  3U2W A;  1KWS A;  2RJ6 A;  5FTV A;  1H5T A;  4Y7V A;  4B2W A;  4JD0 A;  3U2V A;  1VZT A;  1WSZ A;  2XWL A;  4G87 A;  3ZLL A;  2P72 A;  1R82 A;  4Y62 A;  2RJ5 A;  1G23 A;  4KNR A;  1LL2 A;  4HO6 A;  1FGX A;  3K8D A;  4FIY A;  4Y7T A;  1VPA A;  4CJ8 A;  2OI5 A;  4D0Z A;  2NXV A;  5FUH A;  4DEC A;  5C4E A;  1R7X A;  2I5K A;  3T7N A;  3SXC A;  1H7E A;  2QGI A;  2WGZ A;  3IOI A;  5J49 A;  2VSI A;  1XHB A;  4BQH A;  1QGQ A;  1W57 A;  1K4V A;  4HO8 A;  4Q7C A;  4CJB A;  2RJ1 A;  2WVK A;  1TW5 A;  2RIX A;  3OH0 A;  2YCM A;  3SXE A;  1FG5 N;  1FO8 A;  2VS4 A;  3V0L A;  1NMM B;  3V8Y A;  2A8W A;  4GBP A;  1LL0 A;  4EEA A;  3USQ A;  3CKN A;  4D0T A;  4FRL A;  4L41 C;  1FGG A;  3U2T A;  3USR A;  4B42 A;  2AH9 A;  3SX7 A;  1ZHJ A;  1VGW A;  2E8B A;  2W0V A;  2V0J A;  2UX8 A;  3D8V A;  1ZI1 A;  4HG6 A;  3SXD A;  3FOQ A;  1LZ7 A;  2RJ4 A;  3SX8 A;  1HM8 A;  5FTS A;  5CMG X;  4HO4 A;  4ECM A;  3DK5 A;  2AES A;  1H3M A;  2VD4 A;  1HM0 A;  1EZI A;  3JUK A;  3I0G A;  2Y7A A;  2OEF A;  2WAW A;  3CKJ A;  4KPZ A;  5CQL X;  4FRQ A;  1ON8 A;  3ZGG A;  1GQC A;  2D0J A;  2X65 A;  2WE9 A;  4B4B A;  5CMJ A;  2I7B A;  4HO0 A;  1VGT A;  2X5Z A;  3HL3 A;  1HJJ A;  4HO2 A;  2AGD A;  1GX0 A;  4Y7F A;  1HM9 A;  4FRO A;  2OI7 A;  3OKR A;  1I52 A;  3PNN A;  3I0C A;  4FRP A;  5CQO A;  1FRW A;  3NGW A;  1ZI5 A;  3DUV A;  3GUE A;  4HOC A;  1HJL A;  4KC1 A;  2YES A;  2V0L A;  1GQ9 A;  2DPW A;  4B4G A;  4FCU A;  4EEO A;  5CQP A;  1INJ A;  1FR8 A;  4CJC A;  1H4C A;  4FRH A;  1H5S D;  1MP4 A;  1VGZ A;  1GX4 A;  3V0O A;  2AEC A;  1H5S B;  4M2B A;  1G2V A;  1OMX A;  3ZLK A;  1W55 A;  2Y4J A;  1W77 A;  1R81 A;  3I0H A;  1H7H A;  1MP5 A;  3V0P A;  1QG8 A;  1H5S A;  1ZCV A;  4CVH A;  5IFY A;  2PGV A;  3SPT A;  1INI A;  1PZY B;  3PKP A;  4J18 A;  1H4E A;  5AJO A;  2BO8 A;  4KPX A;  1QGS A;  3T7M A;  2AM3 A;  1VZU A;  2FFU A;  2VSH A;  1S4O A;  2XMH A;  1YP3 A;  1H7G A;  1NKH B;  4IRQ A;  4P02 A;  1ZI3 A;  2YC5 A;  1LVW A;  2BO4 A;  1VGU A;  4AYJ A;  4ASY A;  2VFZ A;  5C3B A;  1G93 A;  3IOJ A;  4P00 A;  2RIY A;  4NAK A;  3PKQ A;  1H5R B;  2Y4K A;  3R3I A;  2GGO A;  2Y4L A;  4ZDQ A;  2ICX A;  1SS9 A;  5C47 A;  2VXL A;  4B2X A;  1JYL A;  1WVC A;  3RSB A;  2Z86 A;  2BO7 A;  2QKX A;  1TZF A;  2OEG A;  1H7L A;  1H5R A;  1Z90 A;  3SXA A;  3E25 A;  2I5E A;  2A8U A;  2Z87 A;  3QVB A;  2JCJ A;  4KT7 A;  2AM5 A;  5C48 A;  2O1H A;  3BCV A;  5EIY A;  5FU8 A;  3U0Y A;  4HCQ A;  5CQM X;  1R7Y A;  5L6V A;  1NHE B;  3I0E A;  1JV3 A;  1ZDG A;  1JYK A;  1OQM B;  1JVD A;  5C3A A;  1V84 A;  1E5K A;  5EJ1 A;  2Y4M A;  2D7I A;  4UEG A;  4JIS A;  5C1L A;  2ZU9 A;  2V0K A;  4FCE A;  4EEM A;  2XME A;  2YQH A;  3JTJ A;  4B5B A;  1H7F A; 
#chains in the Genus database with same CATH homology
 3K8E A;  1V83 A;  4AYL A;  4EEG A;  3I0L A;  2CU2 A;  3I0D A;  4ASJ A;  1O7O A;  1HV9 A;  1ZJ1 A;  1TVY A;  2BO6 A;  2JCK A;  2W0W A;  2XWN A;  3V0Q A;  1R7U A;  1H7Q A;  1MC3 A;  4MIX A;  4KC2 A;  5BXC A;  3TQD A;  2FY7 A;  1MP3 A;  1FXJ A;  2PGY A;  3D5N A;  4FRD A;  2X5S A;  1G0R A;  5C4F A;  5C1G A;  5C3D A;  3OH2 A;  3CKV A;  3F1C A;  3V0M A;  3OGZ A;  2FYD B;  1WT2 A;  3SX3 A;  1H7T A;  4FRA A;  2MZB A;  5CMI A;  1G3L A;  4EE3 A;  3OH3 A;  1R80 A;  3OC9 A;  4G3Q A;  4KRV A;  1GA8 A;  4Y6U A;  3CKQ A;  4Y64 A;  1FOA A;  5CMH A;  2V0H A;  3V91 A;  3OH1 A;  5C4C A;  1S4P A;  1YP2 A;  4YS8 A;  2AM4 A;  5DDV A;  4KQL A;  2RJ7 A;  4B3U A;  3LW6 A;  3IOH A;  3F1Y A;  2WVL A;  4KNX A;  1S4N A;  2P73 A;  1R7T A;  2V0I A;  5C1H A;  1H5S C;  2VXM A;  3U2X A;  1IIM A;  1O0R A;  1XZ6 A;  3ZGF A;  4LW3 A;  1LZJ A;  4HO9 A;  1EYR A;  1ZIZ A;  1PZT A;  2Q4J A;  3O3P A;  2RIT A;  4MND A;  4D11 C;  5I1F A;  2FYA A;  3Q7U A;  3RMV A;  4D11 A;  3CU0 A;  4D48 A;  4G3P A;  3V0N A;  2XWM A;  2YQC A;  4FQW A;  3Q80 A;  2C0N A;  1NQI B;  4K6R A;  5IDS A;  3KIA A;  2RJ8 A;  3U2U A;  2J0A A;  4AC3 A;  1FXO A;  2O1F A;  1G1L A;  1LZI A;  3CGX A;  1ZDF A;  5DDT A;  2QH5 A;  3BRK X;  1FZW A;  3OAM A;  4IRP A;  3TZT A;  4AAW A;  1ZCU A;  4LW6 A;  5L6S A;  1NWG B;  5D92 A;  2PX7 A;  4M4K A;  2X60 A;  3I0J A;  2OI6 A;  4EVW A;  4HO5 A;  4ARW A;  5C4D A;  1GWW A;  2FYC B;  1FO9 A;  1WT0 A;  3RMW A;  4DDZ A;  3EE5 A;  1ZJP A;  1ZI4 A;  3Q4S A;  2ZU7 A;  2ZU8 A;  4EE4 A;  4DE7 A;  2YC3 A;  4Y7U A;  3SXG A;  5C36 A;  5C8R A;  4O6M A;  3ST8 A;  1LZ0 A;  4O6N A;  3CKO A;  5D91 A;  3JUJ A;  1O23 B;  3I0K A;  4NAI A;  1VM8 A;  2D7R A;  4C2S A;  2JCL A;  2YQJ A;  4HO3 A;  1NF5 B;  5EJZ A;  3SXB A;  4FIX A;  3D98 A;  5JQQ A;  1OMZ A;  4NAN A;  2RJ9 A;  2AE7 A;  5CQN X;  3DJ4 A;  5AJN A;  4KC4 A;  1ZJ2 A;  1ZJO A;  3POL A;  4R7P A;  4Y9X A;  4Y63 A;  3SX5 A;  1VH3 A;  1YRO B;  3T7O A;  3ZF8 A;  5C38 A;  3I0F A;  2P6W A;  1IIN A;  3N9W A;  1G97 A;  4Y6N A;  1YP4 A;  2ICY A;  2O1G A;  5FV9 A;  1R7V A;  4FRB A;  2Y6P A;  4FRE A;  1VIC A;  4B4M A;  1G9R A;  1FR9 A;  5C4B A;  1TW1 A;  1GWV A;  2E3D A;  2YQS A;  2WEE A;  4EE5 A;  4Y7G A;  3V90 A;  4G3S A;  4KXO A;  1ZCY A;  2RIZ A;  1JV1 A;  1ON6 A;  1JVG A;  3V8Z A;  2RJ0 A;  1H4D A;  1WT3 A;  2VS5 A;  5CMF X;  4XWI A;  3R2W A;  1ZCT A;  1VZX A;  3OH4 A;  4M2A A;  2VS3 A;  3E26 A;  4E1K A;  2J0B A;  5C49 A;  1V82 A;  4NAL A;  1FWY A;  5FU0 A;  5AJP A;  1WT1 A;  4FRM A;  1G8O A;  2FFV A;  4M28 A;  5HS2 A;  3FWW A;  2JCO A;  1G95 A;  2APC A;  2GGQ A;  1ZJ3 A;  2VK9 A;  5FYE A;  2FYB A;  3U0X A;  5IDT A;  1ZJ0 A;  1H5T B;  1LL3 A;  2WVM A;  2PA4 A;  1O7Q A;  1VH1 A;  3I0I X;  4BMA A;  1QWJ A;  4MYB A;  3U2W A;  1KWS A;  2RJ6 A;  5FTV A;  1H5T A;  4Y7V A;  4B2W A;  4JD0 A;  3U2V A;  1VZT A;  1WSZ A;  2XWL A;  4G87 A;  3ZLL A;  2P72 A;  1R82 A;  4Y62 A;  2RJ5 A;  1G23 A;  4KNR A;  1LL2 A;  4HO6 A;  1FGX A;  3K8D A;  4FIY A;  4Y7T A;  1VPA A;  4CJ8 A;  2OI5 A;  4D0Z A;  2NXV A;  5FUH A;  4DEC A;  5C4E A;  1R7X A;  2I5K A;  3T7N A;  3SXC A;  1H7E A;  2QGI A;  2WGZ A;  3IOI A;  5J49 A;  2VSI A;  1XHB A;  4BQH A;  1QGQ A;  1W57 A;  1K4V A;  4HO8 A;  4Q7C A;  4CJB A;  2RJ1 A;  2WVK A;  1TW5 A;  2RIX A;  3OH0 A;  2YCM A;  3SXE A;  1FG5 N;  1FO8 A;  2VS4 A;  3V0L A;  1NMM B;  3V8Y A;  2A8W A;  4GBP A;  1LL0 A;  4EEA A;  3USQ A;  3CKN A;  4D0T A;  4FRL A;  4L41 C;  1FGG A;  3U2T A;  3USR A;  4B42 A;  2AH9 A;  3SX7 A;  1ZHJ A;  1VGW A;  2E8B A;  2W0V A;  2V0J A;  2UX8 A;  3D8V A;  1ZI1 A;  4HG6 A;  3SXD A;  3FOQ A;  1LZ7 A;  2RJ4 A;  3SX8 A;  1HM8 A;  5FTS A;  5CMG X;  4HO4 A;  4ECM A;  3DK5 A;  2AES A;  1H3M A;  2VD4 A;  1HM0 A;  1EZI A;  3JUK A;  3I0G A;  2Y7A A;  2OEF A;  2WAW A;  3CKJ A;  4KPZ A;  5CQL X;  4FRQ A;  1ON8 A;  3ZGG A;  1GQC A;  2D0J A;  2X65 A;  2WE9 A;  4B4B A;  5CMJ A;  2I7B A;  4HO0 A;  1VGT A;  2X5Z A;  3HL3 A;  1HJJ A;  4HO2 A;  2AGD A;  1GX0 A;  4Y7F A;  1HM9 A;  4FRO A;  2OI7 A;  3OKR A;  1I52 A;  3PNN A;  3I0C A;  4FRP A;  5CQO A;  1FRW A;  3NGW A;  1ZI5 A;  3DUV A;  3GUE A;  4HOC A;  1HJL A;  4KC1 A;  2YES A;  2V0L A;  1GQ9 A;  2DPW A;  4B4G A;  4FCU A;  4EEO A;  5CQP A;  1INJ A;  1FR8 A;  4CJC A;  1H4C A;  4FRH A;  1H5S D;  1MP4 A;  1VGZ A;  1GX4 A;  3V0O A;  2AEC A;  1H5S B;  4M2B A;  1G2V A;  1OMX A;  3ZLK A;  1W55 A;  2Y4J A;  1W77 A;  1R81 A;  3I0H A;  1H7H A;  1MP5 A;  3V0P A;  1QG8 A;  1H5S A;  1ZCV A;  4CVH A;  5IFY A;  2PGV A;  3SPT A;  1INI A;  1PZY B;  3PKP A;  4J18 A;  1H4E A;  5AJO A;  2BO8 A;  4KPX A;  1QGS A;  3T7M A;  2AM3 A;  1VZU A;  2FFU A;  2VSH A;  1S4O A;  2XMH A;  1YP3 A;  1H7G A;  1NKH B;  4IRQ A;  4P02 A;  1ZI3 A;  2YC5 A;  1LVW A;  2BO4 A;  1VGU A;  4AYJ A;  4ASY A;  2VFZ A;  5C3B A;  1G93 A;  3IOJ A;  4P00 A;  2RIY A;  4NAK A;  3PKQ A;  1H5R B;  2Y4K A;  3R3I A;  2GGO A;  2Y4L A;  4ZDQ A;  2ICX A;  1SS9 A;  5C47 A;  2VXL A;  4B2X A;  1JYL A;  1WVC A;  3RSB A;  2Z86 A;  2BO7 A;  2QKX A;  1TZF A;  2OEG A;  1H7L A;  1H5R A;  1Z90 A;  3SXA A;  3E25 A;  2I5E A;  2A8U A;  2Z87 A;  3QVB A;  2JCJ A;  4KT7 A;  2AM5 A;  5C48 A;  2O1H A;  3BCV A;  5EIY A;  5FU8 A;  3U0Y A;  4HCQ A;  5CQM X;  1R7Y A;  5L6V A;  1NHE B;  3I0E A;  1JV3 A;  1ZDG A;  1JYK A;  1OQM B;  1JVD A;  5C3A A;  1V84 A;  1E5K A;  5EJ1 A;  2Y4M A;  2D7I A;  4UEG A;  4JIS A;  5C1L A;  2ZU9 A;  2V0K A;  4FCE A;  4EEM A;  2XME A;  2YQH A;  3JTJ A;  4B5B A;  1H7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...