1WT1A

Mutant abo(h) blood group glycosyltransferase with bound udp and acceptor
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
283
structure length
263
Chain Sequence
MVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGRFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histo-blood group ABO system transferase
publication title Structural basis for the inactivity of human blood group o2 glycosyltransferase
pubmed doi rcsb
source organism Homo sapiens
total genus 80
structure length 263
sequence length 283
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2004-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1wt1A00
1JVGA 1NF5B 4CJCA 4G3QA 3Q4SA 4EEMA 5C1LA 4M2BA 4L41C 3SXBA 2VXLA 3DUVA 5C4DA 4XWIA 1H5SA 3IOJA 2E8BA 2AM3A 3I0JA 5J49A 2RJ0A 4FRBA 2AM5A 2ZU9A 4G87A 1MC3A 1WT0A 3V0MA 1YP4A 2Q4JA 5C1GA 3ZGGA 1FG5N 5BXCA 1W77A 2RIYA 1ZJ1A 1PZYB 3DJ4A 5C3AA 2FFUA 1QG8A 5L6VA 2GGQA 3F1YA 4B3UA 1FGXA 1WVCA 2P72A 2Y4MA 4YS8A 4CVHA 4G3SA 2QKXA 4ASYA 1MP4A 1VGWA 4FRQA 4LW3A 4Y6UA 2Z86A 2I7BA 4P00A 4DDZA 1H4CA 2AESA 2YQHA 5AJOA 2QGIA 5C3BA 4D11A 1W57A 2AH9A 4LW6A 3OC9A 5DDVA 1WSZA 3SXDA 5EIYA 1VZTA 4Y64A 1LZIA 5HS2A 1NWGB 5EJ1A 2XWMA 1H5SB 2X5ZA 3JUJA 4Y7TA 4FRHA 1R7TA 4IRQA 5FU0A 4EEOA 2XMEA 3ZF8A 3CKNA 4HCQA 4HO8A 4KNXA 1NHEB 1VZUA 2AECA 3V0PA 4EEGA 4B4BA 1G0RA 2A8UA 5AJNA 4ARWA 2X65A 3U0YA 4FRDA 1K4VA 1PZTA 1HM0A 1WT1A 2ZU8A 2VXMA 4DECA 1FRWA 1QGQA 1VGUA 4HO3A 4HO4A 1LVWA 1Z90A 1JV1A 2JCJA 3Q7UA 3DK5A 4CJBA 2JCOA 2RITA 2Z87A 1VPAA 2JCLA 5CMIA 5JQQA 4Y6NA 1IIMA 3GUEA 1HV9A 2YCMA 4ECMA 1HJJA 4EVWA 1VZXA 4NANA 2PGYA 4AYJA 1VH3A 1FGGA 4B42A 4KQLA 3I0DA 4UEGA 1ZJ3A 4KRVA 5CMJA 3OGZA 3OAMA 4D48A 4HG6A 1VH1A 2BO7A 3IOIA 5CQOA 1R7XA 4HO0A 4M4KA 3RMWA 3SXCA 3SXAA 2ZU7A 3V0OA 3SXGA 1G1LA 1LL0A 1H7EA 3CKOA 2O1FA 3BRKX 3USQA 1FWYA 3JUKA 1S4OA 4Y62A 4MNDA 1LZJA 1TZFA 2RJ6A 3CKVA 2FYDB 2RJ9A 4KPZA 2FYCB 3CGXA 4GBPA 2YESA 3I0EA 2O1HA 1INJA 4B5BA 1H4EA 3I0KA 1ZCTA 3K8EA 1FZWA 2APCA 3USRA 3V91A 4Y7FA 2Y4JA 4Y9XA 5IDTA 2V0HA 3T7MA 1FXOA 2D7RA 2V0JA 4HO2A 1ZI3A 2WEEA 1HJLA 3D98A 4EE5A 3POLA 1TW5A 1R82A 4AC3A 1YP2A 2FY7A 2FYBA 2FFVA 2RJ4A 1GX4A 2XWNA 3SX8A 2QH5A 1JYLA 1G97A 5CQLX 2RJ1A 5FV9A 1R7VA 1JYKA 2Y6PA 2VSIA 3N9WA 1YROB 2AGDA 1FXJA 1ZCYA 3OH0A 1NKHB 1HM9A 5AJPA 1H7TA 1ON8A 2RJ7A 2I5KA 5C38A 2DPWA 3JTJA 4D0TA 1S4NA 1HM8A 5C3DA 3SX5A 4Y7UA 1R7UA 5CQPA 3CKJA 1VGZA 1LL3A 3V0QA 1O23B 1XHBA 4Y63A 1VICA 2OEGA 2E3DA 1ZJ0A 4AYLA 3E26A 1G23A 1H7LA 5DDTA 5CMGX 3OH2A 2WVLA 1ZHJA 2YC5A 1H5SC 2GGOA 2MZBA 2D0JA 1W55A 2RIZA 3TZTA 3LW6A 1NMMB 4FRMA 4IRPA 4KC2A 2X5SA 4NALA 1H3MA 2ICXA 3I0HA 1H4DA 1ON6A 5FYEA 1FO9A 2RJ5A 4B2XA 1E5KA 3I0FA 4AAWA 1GWVA 1S4PA 3V8YA 2UX8A 3I0CA 3K8DA 3PNNA 3V90A 4B2WA 4KC4A 4M28A 3PKQA 4MYBA 3U0XA 2VS5A 4M2AA 2X60A 1G95A 2WVKA 1SS9A 2WVMA 3SX7A 1OMXA 1O0RA 1MP5A 4D11C 5IFYA 4FREA 3D8VA 2YQJA 2W0VA 2VFZA 5C4CA 5EJZA 4DE7A 1H5RB 1ZDFA 3BCVA 2W0WA 1OMZA 4FRAA 5I1FA 4HOCA 3OKRA 2V0LA 3R3IA 2YC3A 5FTSA 2ICYA 3CKQA 3IOHA 4R7PA 3OH4A 2WGZA 3I0LA 3V0LA 2VS4A 2YQCA 3E25A 4JD0A 3U2WA 2PX7A 4BMAA 2AM4A 3T7OA 1YP3A 4J18A 5CMFX 2V0KA 2XWLA 1VGTA 3U2UA 4B4GA 3SPTA 3V8ZA 5C8RA 1V83A 1GWWA 1JV3A 1ZCVA 4E1KA 1JVDA 1EYRA 3F1CA 5C4EA 3SXEA 2BO8A 1ZIZA 1G3LA 2YQSA 4CJ8A 1INIA 4EE3A 1O7OA 1LZ0A 2NXVA 1R7YA 2JCKA 4FROA 1ZI1A 1GA8A 1ZJPA 1FOAA 1FR9A 5L6SA 1NQIB 1VM8A 3T7NA 5CQNX 1ZJOA 1H7GA 2Y4LA 2I5EA 3EE5A 1ZDGA 1G9RA 2XMHA 1ZCUA 1TVYA 4FQWA 4KC1A 5C4BA 2FYAA 1FR8A 4HO9A 3OH3A 1H5SD 1MP3A 3U2XA 3Q80A 3ZGFA 4EEAA 1EZIA 3PKPA 4JISA 3I0IX 1WT2A 3O3PA 5IDSA 1GX0A 1GQCA 4FCUA 1H7FA 3RSBA 3U2VA 1H5TA 5CQMX 3HL3A 4KNRA 1G2VA 4FRLA 1KWSA 1H5RA 2P73A 2A8WA 1XZ6A 2O1GA 4KPXA 4Y7GA 2RIXA 5CMHA 2WE9A 2BO4A 1G93A 4HO6A 3ZLKA 3KIAA 4K6RA 2Y4KA 1I52A 3SX3A 1ZJ2A 2V0IA 1ZI4A 5FUHA 5C1HA 1IINA 2P6WA 3R2WA 1TW1A 3I0GA 3TQDA 4KXOA 2PGVA 2VS3A 5C4FA 1V82A 5FTVA 1H7QA 4C2SA 3NGWA 3ZLLA 1R80A 3V0NA 3FOQA 1GQ9A 1QWJA 4NAKA 2VSHA 4B4MA 1H5TB 3D5NA 1O7QA 4Y7VA 1FO8A 2AE7A 2OI5A 4P02A 3CU0A 5C47A 1R81A 4ASJA 4D0ZA 1WT3A 5C49A 2Y7AA 5C36A 1ZI5A 3ST8A 3RMVA 2PA4A 2OI6A 4KT7A 2OEFA 2VD4A 3QVBA 4FRPA 1V84A 2D7IA 2WAWA 4G3PA 4BQHA 3U2TA 5C48A 4HO5A 1OQMB 4FCEA 4EE4A 3OH1A 3FWWA 2RJ8A 2CU2A 2BO6A 2OI7A 5FU8A 1LZ7A 1LL2A 1QGSA 4NAIA 4ZDQA 1G8OA 1H7HA
chains in the Genus database with same CATH superfamily
1JVGA 1NF5B 4CJCA 4G3QA 3Q4SA 4EEMA 5C1LA 4M2BA 4L41C 3SXBA 2VXLA 3DUVA 5C4DA 4XWIA 1H5SA 3IOJA 2E8BA 2AM3A 3I0JA 5J49A 2RJ0A 4FRBA 2AM5A 2ZU9A 4G87A 1MC3A 1WT0A 3V0MA 1YP4A 2Q4JA 4O6NA 5C1GA 3ZGGA 1FG5N 5BXCA 1W77A 2RIYA 1ZJ1A 1PZYB 3DJ4A 5C3AA 2J0AA 2FFUA 1QG8A 5L6VA 2GGQA 3F1YA 4B3UA 1FGXA 1WVCA 2P72A 2Y4MA 4YS8A 4CVHA 4G3SA 2QKXA 4ASYA 1MP4A 1VGWA 4FRQA 4LW3A 4Y6UA 2Z86A 2I7BA 4P00A 4DDZA 1H4CA 2AESA 2YQHA 5AJOA 2QGIA 5C3BA 4D11A 1W57A 2AH9A 4LW6A 3OC9A 5DDVA 1WSZA 3SXDA 5EIYA 1VZTA 4Y64A 1LZIA 5HS2A 1NWGB 5EJ1A 2XWMA 1H5SB 2X5ZA 3JUJA 4Y7TA 4FRHA 1R7TA 4IRQA 5FU0A 4EEOA 2XMEA 3ZF8A 3CKNA 4HCQA 4HO8A 4KNXA 1NHEB 1VZUA 2AECA 3V0PA 4EEGA 4B4BA 1G0RA 2A8UA 5AJNA 4ARWA 2X65A 3U0YA 4FRDA 1K4VA 1PZTA 1HM0A 1WT1A 2ZU8A 2VXMA 4DECA 1FRWA 1QGQA 1VGUA 4HO3A 4HO4A 1LVWA 1Z90A 1JV1A 2JCJA 3Q7UA 3DK5A 4CJBA 2JCOA 2RITA 2Z87A 1VPAA 2JCLA 5CMIA 5JQQA 4Y6NA 1IIMA 3GUEA 1HV9A 2YCMA 4ECMA 1HJJA 4EVWA 1VZXA 4NANA 2PGYA 4AYJA 1VH3A 1FGGA 4B42A 4KQLA 3I0DA 4UEGA 1ZJ3A 4KRVA 5CMJA 3OGZA 3OAMA 4D48A 4HG6A 1VH1A 2BO7A 3IOIA 5CQOA 1R7XA 4HO0A 4M4KA 3RMWA 3SXCA 3SXAA 2ZU7A 3V0OA 3SXGA 1G1LA 1LL0A 1H7EA 3CKOA 2O1FA 3BRKX 3USQA 1FWYA 3JUKA 1S4OA 4Y62A 4MNDA 1LZJA 1TZFA 2RJ6A 3CKVA 2FYDB 2RJ9A 4KPZA 2FYCB 3CGXA 4GBPA 2YESA 3I0EA 2O1HA 1INJA 4B5BA 1H4EA 3I0KA 1ZCTA 3K8EA 1FZWA 2APCA 3USRA 3V91A 4Y7FA 2C0NA 2Y4JA 4Y9XA 5IDTA 2V0HA 3T7MA 1FXOA 2D7RA 2V0JA 4HO2A 1ZI3A 2WEEA 1HJLA 3D98A 4EE5A 3POLA 1TW5A 1R82A 4AC3A 1YP2A 2FY7A 2FYBA 2FFVA 2RJ4A 1GX4A 2XWNA 3SX8A 2QH5A 1JYLA 1G97A 5CQLX 2RJ1A 5FV9A 1R7VA 1JYKA 2Y6PA 2VSIA 3N9WA 1YROB 2AGDA 1FXJA 1ZCYA 3OH0A 1NKHB 1HM9A 5AJPA 1H7TA 1ON8A 2RJ7A 2I5KA 5C38A 2DPWA 3JTJA 4D0TA 1S4NA 1HM8A 5C3DA 3SX5A 4Y7UA 1R7UA 5CQPA 3CKJA 1VGZA 1LL3A 3V0QA 1O23B 1XHBA 4Y63A 1VICA 2OEGA 2E3DA 1ZJ0A 4AYLA 3E26A 1G23A 1H7LA 5DDTA 5CMGX 3OH2A 2WVLA 1ZHJA 2YC5A 1H5SC 2GGOA 2MZBA 2D0JA 1W55A 2RIZA 3TZTA 3LW6A 1NMMB 4FRMA 4IRPA 4KC2A 2X5SA 4NALA 1H3MA 2ICXA 3I0HA 1H4DA 1ON6A 5FYEA 1FO9A 2RJ5A 4B2XA 1E5KA 3I0FA 4AAWA 1GWVA 1S4PA 3V8YA 2UX8A 3I0CA 3K8DA 3PNNA 3V90A 4B2WA 4KC4A 4M28A 3PKQA 4MYBA 3U0XA 2VS5A 4M2AA 2X60A 1G95A 2WVKA 1SS9A 2WVMA 3SX7A 1OMXA 1O0RA 1MP5A 4D11C 5IFYA 4FREA 3D8VA 2YQJA 2W0VA 2VFZA 5C4CA 4O6MA 5EJZA 4DE7A 1H5RB 1ZDFA 3BCVA 2W0WA 1OMZA 4FRAA 5I1FA 4HOCA 3OKRA 2V0LA 3R3IA 2YC3A 5FTSA 2ICYA 3CKQA 3IOHA 4R7PA 3OH4A 2WGZA 3I0LA 3V0LA 2VS4A 2YQCA 3E25A 4JD0A 3U2WA 2PX7A 4BMAA 2AM4A 3T7OA 1YP3A 4J18A 5CMFX 2V0KA 2XWLA 1VGTA 3U2UA 4B4GA 3SPTA 3V8ZA 5C8RA 4FIYA 1V83A 5D92A 4MIXA 1GWWA 1JV3A 1ZCVA 4E1KA 2J0BA 1JVDA 1EYRA 3F1CA 5C4EA 3SXEA 2BO8A 4Q7CA 1ZIZA 1G3LA 2YQSA 4CJ8A 1INIA 4EE3A 1O7OA 1LZ0A 2NXVA 1R7YA 2JCKA 4FROA 1ZI1A 1GA8A 1ZJPA 1FOAA 1FR9A 5L6SA 1NQIB 1VM8A 3T7NA 5CQNX 1ZJOA 1H7GA 2Y4LA 2I5EA 3EE5A 1ZDGA 1G9RA 2XMHA 1ZCUA 1TVYA 4FQWA 4KC1A 5C4BA 2FYAA 1FR8A 4HO9A 3OH3A 1H5SD 1MP3A 3U2XA 3Q80A 3ZGFA 4EEAA 1EZIA 3PKPA 4JISA 3I0IX 1WT2A 3O3PA 5IDSA 1GX0A 1GQCA 4FCUA 1H7FA 3RSBA 3U2VA 1H5TA 5CQMX 3HL3A 4KNRA 1G2VA 4FRLA 1KWSA 1H5RA 2P73A 2A8WA 1XZ6A 2O1GA 2VK9A 4KPXA 4Y7GA 2RIXA 5CMHA 2WE9A 2BO4A 1G93A 4HO6A 3ZLKA 3KIAA 4K6RA 2Y4KA 1I52A 3SX3A 1ZJ2A 2V0IA 1ZI4A 5FUHA 5C1HA 1IINA 2P6WA 3R2WA 1TW1A 3I0GA 3TQDA 4KXOA 2PGVA 2VS3A 5C4FA 1V82A 5FTVA 1H7QA 4C2SA 3NGWA 3ZLLA 1R80A 5D91A 3V0NA 3FOQA 1GQ9A 1QWJA 4NAKA 2VSHA 4B4MA 1H5TB 3D5NA 1O7QA 4Y7VA 1FO8A 2AE7A 2OI5A 4P02A 3CU0A 5C47A 1R81A 4ASJA 4D0ZA 1WT3A 5C49A 2Y7AA 5C36A 1ZI5A 3ST8A 3RMVA 2PA4A 2OI6A 4KT7A 2OEFA 2VD4A 3QVBA 4FRPA 1V84A 2D7IA 2WAWA 4G3PA 4BQHA 3U2TA 5C48A 4HO5A 1OQMB 4FCEA 4EE4A 3OH1A 3FWWA 2RJ8A 2CU2A 2BO6A 2OI7A 5FU8A 1LZ7A 1LL2A 4FIXA 1QGSA 4NAIA 4ZDQA 1G8OA 1H7HA
chains in the Genus database with same CATH topology
1JVGA 1NF5B 4CJCA 4G3QA 3Q4SA 4EEMA 5C1LA 4M2BA 4L41C 3SXBA 2VXLA 3DUVA 5C4DA 4XWIA 1H5SA 3IOJA 2E8BA 2AM3A 3I0JA 5J49A 2RJ0A 4FRBA 2AM5A 2ZU9A 4G87A 1MC3A 1WT0A 3V0MA 1YP4A 2Q4JA 4O6NA 5C1GA 3ZGGA 1FG5N 5BXCA 1W77A 2RIYA 1ZJ1A 1PZYB 3DJ4A 5C3AA 2J0AA 2FFUA 1QG8A 5L6VA 2GGQA 3F1YA 4B3UA 1FGXA 1WVCA 2P72A 2Y4MA 4YS8A 4CVHA 4G3SA 2QKXA 4ASYA 1MP4A 1VGWA 4FRQA 4LW3A 4Y6UA 2Z86A 2I7BA 4P00A 4DDZA 1H4CA 2AESA 2YQHA 5AJOA 2QGIA 5C3BA 4D11A 1W57A 2AH9A 4LW6A 3OC9A 5DDVA 1WSZA 3SXDA 5EIYA 1VZTA 4Y64A 1LZIA 5HS2A 1NWGB 5EJ1A 2XWMA 1H5SB 2X5ZA 3JUJA 4Y7TA 4FRHA 1R7TA 4IRQA 5FU0A 4EEOA 2XMEA 3ZF8A 3CKNA 4HCQA 4HO8A 4KNXA 1NHEB 1VZUA 2AECA 3V0PA 4EEGA 4B4BA 1G0RA 2A8UA 5AJNA 4ARWA 2X65A 3U0YA 4FRDA 1K4VA 1PZTA 1HM0A 1WT1A 2ZU8A 2VXMA 4DECA 1FRWA 1QGQA 1VGUA 4HO3A 4HO4A 1LVWA 1Z90A 1JV1A 2JCJA 3Q7UA 3DK5A 4CJBA 2JCOA 2RITA 2Z87A 1VPAA 2JCLA 5CMIA 5JQQA 4Y6NA 1IIMA 3GUEA 1HV9A 2YCMA 4ECMA 1HJJA 4EVWA 1VZXA 4NANA 2PGYA 4AYJA 1VH3A 1FGGA 4B42A 4KQLA 3I0DA 4UEGA 1ZJ3A 4KRVA 5CMJA 3OGZA 3OAMA 4D48A 4HG6A 1VH1A 2BO7A 3IOIA 5CQOA 1R7XA 4HO0A 4M4KA 3RMWA 3SXCA 3SXAA 2ZU7A 3V0OA 3SXGA 1G1LA 1LL0A 1H7EA 3CKOA 2O1FA 3BRKX 3USQA 1FWYA 3JUKA 1S4OA 4Y62A 4MNDA 1LZJA 1TZFA 2RJ6A 3CKVA 2FYDB 2RJ9A 4KPZA 2FYCB 3CGXA 4GBPA 2YESA 3I0EA 2O1HA 1INJA 4B5BA 1H4EA 3I0KA 1ZCTA 3K8EA 1FZWA 2APCA 3USRA 3V91A 4Y7FA 2C0NA 2Y4JA 4Y9XA 5IDTA 2V0HA 3T7MA 1FXOA 2D7RA 2V0JA 4HO2A 1ZI3A 2WEEA 1HJLA 3D98A 4EE5A 3POLA 1TW5A 1R82A 4AC3A 1YP2A 2FY7A 2FYBA 2FFVA 2RJ4A 1GX4A 2XWNA 3SX8A 2QH5A 1JYLA 1G97A 5CQLX 2RJ1A 5FV9A 1R7VA 1JYKA 2Y6PA 2VSIA 3N9WA 1YROB 2AGDA 1FXJA 1ZCYA 3OH0A 1NKHB 1HM9A 5AJPA 1H7TA 1ON8A 2RJ7A 2I5KA 5C38A 2DPWA 3JTJA 4D0TA 1S4NA 1HM8A 5C3DA 3SX5A 4Y7UA 1R7UA 5CQPA 3CKJA 1VGZA 1LL3A 3V0QA 1O23B 1XHBA 4Y63A 1VICA 2OEGA 2E3DA 1ZJ0A 4AYLA 3E26A 1G23A 1H7LA 5DDTA 5CMGX 3OH2A 2WVLA 1ZHJA 2YC5A 1H5SC 2GGOA 2MZBA 2D0JA 1W55A 2RIZA 3TZTA 3LW6A 1NMMB 4FRMA 4IRPA 4KC2A 2X5SA 4NALA 1H3MA 2ICXA 3I0HA 1H4DA 1ON6A 5FYEA 1FO9A 2RJ5A 4B2XA 1E5KA 3I0FA 4AAWA 1GWVA 1S4PA 3V8YA 2UX8A 3I0CA 3K8DA 3PNNA 3V90A 4B2WA 4KC4A 4M28A 3PKQA 4MYBA 3U0XA 2VS5A 4M2AA 2X60A 1G95A 2WVKA 1SS9A 2WVMA 3SX7A 1OMXA 1O0RA 1MP5A 4D11C 5IFYA 4FREA 3D8VA 2YQJA 2W0VA 2VFZA 5C4CA 4O6MA 5EJZA 4DE7A 1H5RB 1ZDFA 3BCVA 2W0WA 1OMZA 4FRAA 5I1FA 4HOCA 3OKRA 2V0LA 3R3IA 2YC3A 5FTSA 2ICYA 3CKQA 3IOHA 4R7PA 3OH4A 2WGZA 3I0LA 3V0LA 2VS4A 2YQCA 3E25A 4JD0A 3U2WA 2PX7A 4BMAA 2AM4A 3T7OA 1YP3A 4J18A 5CMFX 2V0KA 2XWLA 1VGTA 3U2UA 4B4GA 3SPTA 3V8ZA 5C8RA 4FIYA 1V83A 5D92A 4MIXA 1GWWA 1JV3A 1ZCVA 4E1KA 2J0BA 1JVDA 1EYRA 3F1CA 5C4EA 3SXEA 2BO8A 4Q7CA 1ZIZA 1G3LA 2YQSA 4CJ8A 1INIA 4EE3A 1O7OA 1LZ0A 2NXVA 1R7YA 2JCKA 4FROA 1ZI1A 1GA8A 1ZJPA 1FOAA 1FR9A 5L6SA 1NQIB 1VM8A 3T7NA 5CQNX 1ZJOA 1H7GA 2Y4LA 2I5EA 3EE5A 1ZDGA 1G9RA 2XMHA 1ZCUA 1TVYA 4FQWA 4KC1A 5C4BA 2FYAA 1FR8A 4HO9A 3OH3A 1H5SD 1MP3A 3U2XA 3Q80A 3ZGFA 4EEAA 1EZIA 3PKPA 4JISA 3I0IX 1WT2A 3O3PA 5IDSA 1GX0A 1GQCA 4FCUA 1H7FA 3RSBA 3U2VA 1H5TA 5CQMX 3HL3A 4KNRA 1G2VA 4FRLA 1KWSA 1H5RA 2P73A 2A8WA 1XZ6A 2O1GA 2VK9A 4KPXA 4Y7GA 2RIXA 5CMHA 2WE9A 2BO4A 1G93A 4HO6A 3ZLKA 3KIAA 4K6RA 2Y4KA 1I52A 3SX3A 1ZJ2A 2V0IA 1ZI4A 5FUHA 5C1HA 1IINA 2P6WA 3R2WA 1TW1A 3I0GA 3TQDA 4KXOA 2PGVA 2VS3A 5C4FA 1V82A 5FTVA 1H7QA 4C2SA 3NGWA 3ZLLA 1R80A 5D91A 3V0NA 3FOQA 1GQ9A 1QWJA 4NAKA 2VSHA 4B4MA 1H5TB 3D5NA 1O7QA 4Y7VA 1FO8A 2AE7A 2OI5A 4P02A 3CU0A 5C47A 1R81A 4ASJA 4D0ZA 1WT3A 5C49A 2Y7AA 5C36A 1ZI5A 3ST8A 3RMVA 2PA4A 2OI6A 4KT7A 2OEFA 2VD4A 3QVBA 4FRPA 1V84A 2D7IA 2WAWA 4G3PA 4BQHA 3U2TA 5C48A 4HO5A 1OQMB 4FCEA 4EE4A 3OH1A 3FWWA 2RJ8A 2CU2A 2BO6A 2OI7A 5FU8A 1LZ7A 1LL2A 4FIXA 1QGSA 4NAIA 4ZDQA 1G8OA 1H7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JVG A;  1NF5 B;  4CJC A;  4G3Q A;  3Q4S A;  4EEM A;  5C1L A;  4M2B A;  4L41 C;  3SXB A;  2VXL A;  3DUV A;  5C4D A;  4XWI A;  1H5S A;  3IOJ A;  2E8B A;  2AM3 A;  3I0J A;  5J49 A;  2RJ0 A;  4FRB A;  2AM5 A;  2ZU9 A;  4G87 A;  1MC3 A;  1WT0 A;  3V0M A;  1YP4 A;  2Q4J A;  5C1G A;  3ZGG A;  1FG5 N;  5BXC A;  1W77 A;  2RIY A;  1ZJ1 A;  1PZY B;  3DJ4 A;  5C3A A;  2FFU A;  1QG8 A;  5L6V A;  2GGQ A;  3F1Y A;  4B3U A;  1FGX A;  1WVC A;  2P72 A;  2Y4M A;  4YS8 A;  4CVH A;  4G3S A;  2QKX A;  4ASY A;  1MP4 A;  1VGW A;  4FRQ A;  4LW3 A;  4Y6U A;  2Z86 A;  2I7B A;  4P00 A;  4DDZ A;  1H4C A;  2AES A;  2YQH A;  5AJO A;  2QGI A;  5C3B A;  4D11 A;  1W57 A;  2AH9 A;  4LW6 A;  3OC9 A;  5DDV A;  1WSZ A;  3SXD A;  5EIY A;  1VZT A;  4Y64 A;  1LZI A;  5HS2 A;  1NWG B;  5EJ1 A;  2XWM A;  1H5S B;  2X5Z A;  3JUJ A;  4Y7T A;  4FRH A;  1R7T A;  4IRQ A;  5FU0 A;  4EEO A;  2XME A;  3ZF8 A;  3CKN A;  4HCQ A;  4HO8 A;  4KNX A;  1NHE B;  1VZU A;  2AEC A;  3V0P A;  4EEG A;  4B4B A;  1G0R A;  2A8U A;  5AJN A;  4ARW A;  2X65 A;  3U0Y A;  4FRD A;  1K4V A;  1PZT A;  1HM0 A;  1WT1 A;  2ZU8 A;  2VXM A;  4DEC A;  1FRW A;  1QGQ A;  1VGU A;  4HO3 A;  4HO4 A;  1LVW A;  1Z90 A;  1JV1 A;  2JCJ A;  3Q7U A;  3DK5 A;  4CJB A;  2JCO A;  2RIT A;  2Z87 A;  1VPA A;  2JCL A;  5CMI A;  5JQQ A;  4Y6N A;  1IIM A;  3GUE A;  1HV9 A;  2YCM A;  4ECM A;  1HJJ A;  4EVW A;  1VZX A;  4NAN A;  2PGY A;  4AYJ A;  1VH3 A;  1FGG A;  4B42 A;  4KQL A;  3I0D A;  4UEG A;  1ZJ3 A;  4KRV A;  5CMJ A;  3OGZ A;  3OAM A;  4D48 A;  4HG6 A;  1VH1 A;  2BO7 A;  3IOI A;  5CQO A;  1R7X A;  4HO0 A;  4M4K A;  3RMW A;  3SXC A;  3SXA A;  2ZU7 A;  3V0O A;  3SXG A;  1G1L A;  1LL0 A;  1H7E A;  3CKO A;  2O1F A;  3BRK X;  3USQ A;  1FWY A;  3JUK A;  1S4O A;  4Y62 A;  4MND A;  1LZJ A;  1TZF A;  2RJ6 A;  3CKV A;  2FYD B;  2RJ9 A;  4KPZ A;  2FYC B;  3CGX A;  4GBP A;  2YES A;  3I0E A;  2O1H A;  1INJ A;  4B5B A;  1H4E A;  3I0K A;  1ZCT A;  3K8E A;  1FZW A;  2APC A;  3USR A;  3V91 A;  4Y7F A;  2Y4J A;  4Y9X A;  5IDT A;  2V0H A;  3T7M A;  1FXO A;  2D7R A;  2V0J A;  4HO2 A;  1ZI3 A;  2WEE A;  1HJL A;  3D98 A;  4EE5 A;  3POL A;  1TW5 A;  1R82 A;  4AC3 A;  1YP2 A;  2FY7 A;  2FYB A;  2FFV A;  2RJ4 A;  1GX4 A;  2XWN A;  3SX8 A;  2QH5 A;  1JYL A;  1G97 A;  5CQL X;  2RJ1 A;  5FV9 A;  1R7V A;  1JYK A;  2Y6P A;  2VSI A;  3N9W A;  1YRO B;  2AGD A;  1FXJ A;  1ZCY A;  3OH0 A;  1NKH B;  1HM9 A;  5AJP A;  1H7T A;  1ON8 A;  2RJ7 A;  2I5K A;  5C38 A;  2DPW A;  3JTJ A;  4D0T A;  1S4N A;  1HM8 A;  5C3D A;  3SX5 A;  4Y7U A;  1R7U A;  5CQP A;  3CKJ A;  1VGZ A;  1LL3 A;  3V0Q A;  1O23 B;  1XHB A;  4Y63 A;  1VIC A;  2OEG A;  2E3D A;  1ZJ0 A;  4AYL A;  3E26 A;  1G23 A;  1H7L A;  5DDT A;  5CMG X;  3OH2 A;  2WVL A;  1ZHJ A;  2YC5 A;  1H5S C;  2GGO A;  2MZB A;  2D0J A;  1W55 A;  2RIZ A;  3TZT A;  3LW6 A;  1NMM B;  4FRM A;  4IRP A;  4KC2 A;  2X5S A;  4NAL A;  1H3M A;  2ICX A;  3I0H A;  1H4D A;  1ON6 A;  5FYE A;  1FO9 A;  2RJ5 A;  4B2X A;  1E5K A;  3I0F A;  4AAW A;  1GWV A;  1S4P A;  3V8Y A;  2UX8 A;  3I0C A;  3K8D A;  3PNN A;  3V90 A;  4B2W A;  4KC4 A;  4M28 A;  3PKQ A;  4MYB A;  3U0X A;  2VS5 A;  4M2A A;  2X60 A;  1G95 A;  2WVK A;  1SS9 A;  2WVM A;  3SX7 A;  1OMX A;  1O0R A;  1MP5 A;  4D11 C;  5IFY A;  4FRE A;  3D8V A;  2YQJ A;  2W0V A;  2VFZ A;  5C4C A;  5EJZ A;  4DE7 A;  1H5R B;  1ZDF A;  3BCV A;  2W0W A;  1OMZ A;  4FRA A;  5I1F A;  4HOC A;  3OKR A;  2V0L A;  3R3I A;  2YC3 A;  5FTS A;  2ICY A;  3CKQ A;  3IOH A;  4R7P A;  3OH4 A;  2WGZ A;  3I0L A;  3V0L A;  2VS4 A;  2YQC A;  3E25 A;  4JD0 A;  3U2W A;  2PX7 A;  4BMA A;  2AM4 A;  3T7O A;  1YP3 A;  4J18 A;  5CMF X;  2V0K A;  2XWL A;  1VGT A;  3U2U A;  4B4G A;  3SPT A;  3V8Z A;  5C8R A;  1V83 A;  1GWW A;  1JV3 A;  1ZCV A;  4E1K A;  1JVD A;  1EYR A;  3F1C A;  5C4E A;  3SXE A;  2BO8 A;  1ZIZ A;  1G3L A;  2YQS A;  4CJ8 A;  1INI A;  4EE3 A;  1O7O A;  1LZ0 A;  2NXV A;  1R7Y A;  2JCK A;  4FRO A;  1ZI1 A;  1GA8 A;  1ZJP A;  1FOA A;  1FR9 A;  5L6S A;  1NQI B;  1VM8 A;  3T7N A;  5CQN X;  1ZJO A;  1H7G A;  2Y4L A;  2I5E A;  3EE5 A;  1ZDG A;  1G9R A;  2XMH A;  1ZCU A;  1TVY A;  4FQW A;  4KC1 A;  5C4B A;  2FYA A;  1FR8 A;  4HO9 A;  3OH3 A;  1H5S D;  1MP3 A;  3U2X A;  3Q80 A;  3ZGF A;  4EEA A;  1EZI A;  3PKP A;  4JIS A;  3I0I X;  1WT2 A;  3O3P A;  5IDS A;  1GX0 A;  1GQC A;  4FCU A;  1H7F A;  3RSB A;  3U2V A;  1H5T A;  5CQM X;  3HL3 A;  4KNR A;  1G2V A;  4FRL A;  1KWS A;  1H5R A;  2P73 A;  2A8W A;  1XZ6 A;  2O1G A;  4KPX A;  4Y7G A;  2RIX A;  5CMH A;  2WE9 A;  2BO4 A;  1G93 A;  4HO6 A;  3ZLK A;  3KIA A;  4K6R A;  2Y4K A;  1I52 A;  3SX3 A;  1ZJ2 A;  2V0I A;  1ZI4 A;  5FUH A;  5C1H A;  1IIN A;  2P6W A;  3R2W A;  1TW1 A;  3I0G A;  3TQD A;  4KXO A;  2PGV A;  2VS3 A;  5C4F A;  1V82 A;  5FTV A;  1H7Q A;  4C2S A;  3NGW A;  3ZLL A;  1R80 A;  3V0N A;  3FOQ A;  1GQ9 A;  1QWJ A;  4NAK A;  2VSH A;  4B4M A;  1H5T B;  3D5N A;  1O7Q A;  4Y7V A;  1FO8 A;  2AE7 A;  2OI5 A;  4P02 A;  3CU0 A;  5C47 A;  1R81 A;  4ASJ A;  4D0Z A;  1WT3 A;  5C49 A;  2Y7A A;  5C36 A;  1ZI5 A;  3ST8 A;  3RMV A;  2PA4 A;  2OI6 A;  4KT7 A;  2OEF A;  2VD4 A;  3QVB A;  4FRP A;  1V84 A;  2D7I A;  2WAW A;  4G3P A;  4BQH A;  3U2T A;  5C48 A;  4HO5 A;  1OQM B;  4FCE A;  4EE4 A;  3OH1 A;  3FWW A;  2RJ8 A;  2CU2 A;  2BO6 A;  2OI7 A;  5FU8 A;  1LZ7 A;  1LL2 A;  1QGS A;  4NAI A;  4ZDQ A;  1G8O A;  1H7H A; 
#chains in the Genus database with same CATH topology
 1JVG A;  1NF5 B;  4CJC A;  4G3Q A;  3Q4S A;  4EEM A;  5C1L A;  4M2B A;  4L41 C;  3SXB A;  2VXL A;  3DUV A;  5C4D A;  4XWI A;  1H5S A;  3IOJ A;  2E8B A;  2AM3 A;  3I0J A;  5J49 A;  2RJ0 A;  4FRB A;  2AM5 A;  2ZU9 A;  4G87 A;  1MC3 A;  1WT0 A;  3V0M A;  1YP4 A;  2Q4J A;  4O6N A;  5C1G A;  3ZGG A;  1FG5 N;  5BXC A;  1W77 A;  2RIY A;  1ZJ1 A;  1PZY B;  3DJ4 A;  5C3A A;  2J0A A;  2FFU A;  1QG8 A;  5L6V A;  2GGQ A;  3F1Y A;  4B3U A;  1FGX A;  1WVC A;  2P72 A;  2Y4M A;  4YS8 A;  4CVH A;  4G3S A;  2QKX A;  4ASY A;  1MP4 A;  1VGW A;  4FRQ A;  4LW3 A;  4Y6U A;  2Z86 A;  2I7B A;  4P00 A;  4DDZ A;  1H4C A;  2AES A;  2YQH A;  5AJO A;  2QGI A;  5C3B A;  4D11 A;  1W57 A;  2AH9 A;  4LW6 A;  3OC9 A;  5DDV A;  1WSZ A;  3SXD A;  5EIY A;  1VZT A;  4Y64 A;  1LZI A;  5HS2 A;  1NWG B;  5EJ1 A;  2XWM A;  1H5S B;  2X5Z A;  3JUJ A;  4Y7T A;  4FRH A;  1R7T A;  4IRQ A;  5FU0 A;  4EEO A;  2XME A;  3ZF8 A;  3CKN A;  4HCQ A;  4HO8 A;  4KNX A;  1NHE B;  1VZU A;  2AEC A;  3V0P A;  4EEG A;  4B4B A;  1G0R A;  2A8U A;  5AJN A;  4ARW A;  2X65 A;  3U0Y A;  4FRD A;  1K4V A;  1PZT A;  1HM0 A;  1WT1 A;  2ZU8 A;  2VXM A;  4DEC A;  1FRW A;  1QGQ A;  1VGU A;  4HO3 A;  4HO4 A;  1LVW A;  1Z90 A;  1JV1 A;  2JCJ A;  3Q7U A;  3DK5 A;  4CJB A;  2JCO A;  2RIT A;  2Z87 A;  1VPA A;  2JCL A;  5CMI A;  5JQQ A;  4Y6N A;  1IIM A;  3GUE A;  1HV9 A;  2YCM A;  4ECM A;  1HJJ A;  4EVW A;  1VZX A;  4NAN A;  2PGY A;  4AYJ A;  1VH3 A;  1FGG A;  4B42 A;  4KQL A;  3I0D A;  4UEG A;  1ZJ3 A;  4KRV A;  5CMJ A;  3OGZ A;  3OAM A;  4D48 A;  4HG6 A;  1VH1 A;  2BO7 A;  3IOI A;  5CQO A;  1R7X A;  4HO0 A;  4M4K A;  3RMW A;  3SXC A;  3SXA A;  2ZU7 A;  3V0O A;  3SXG A;  1G1L A;  1LL0 A;  1H7E A;  3CKO A;  2O1F A;  3BRK X;  3USQ A;  1FWY A;  3JUK A;  1S4O A;  4Y62 A;  4MND A;  1LZJ A;  1TZF A;  2RJ6 A;  3CKV A;  2FYD B;  2RJ9 A;  4KPZ A;  2FYC B;  3CGX A;  4GBP A;  2YES A;  3I0E A;  2O1H A;  1INJ A;  4B5B A;  1H4E A;  3I0K A;  1ZCT A;  3K8E A;  1FZW A;  2APC A;  3USR A;  3V91 A;  4Y7F A;  2C0N A;  2Y4J A;  4Y9X A;  5IDT A;  2V0H A;  3T7M A;  1FXO A;  2D7R A;  2V0J A;  4HO2 A;  1ZI3 A;  2WEE A;  1HJL A;  3D98 A;  4EE5 A;  3POL A;  1TW5 A;  1R82 A;  4AC3 A;  1YP2 A;  2FY7 A;  2FYB A;  2FFV A;  2RJ4 A;  1GX4 A;  2XWN A;  3SX8 A;  2QH5 A;  1JYL A;  1G97 A;  5CQL X;  2RJ1 A;  5FV9 A;  1R7V A;  1JYK A;  2Y6P A;  2VSI A;  3N9W A;  1YRO B;  2AGD A;  1FXJ A;  1ZCY A;  3OH0 A;  1NKH B;  1HM9 A;  5AJP A;  1H7T A;  1ON8 A;  2RJ7 A;  2I5K A;  5C38 A;  2DPW A;  3JTJ A;  4D0T A;  1S4N A;  1HM8 A;  5C3D A;  3SX5 A;  4Y7U A;  1R7U A;  5CQP A;  3CKJ A;  1VGZ A;  1LL3 A;  3V0Q A;  1O23 B;  1XHB A;  4Y63 A;  1VIC A;  2OEG A;  2E3D A;  1ZJ0 A;  4AYL A;  3E26 A;  1G23 A;  1H7L A;  5DDT A;  5CMG X;  3OH2 A;  2WVL A;  1ZHJ A;  2YC5 A;  1H5S C;  2GGO A;  2MZB A;  2D0J A;  1W55 A;  2RIZ A;  3TZT A;  3LW6 A;  1NMM B;  4FRM A;  4IRP A;  4KC2 A;  2X5S A;  4NAL A;  1H3M A;  2ICX A;  3I0H A;  1H4D A;  1ON6 A;  5FYE A;  1FO9 A;  2RJ5 A;  4B2X A;  1E5K A;  3I0F A;  4AAW A;  1GWV A;  1S4P A;  3V8Y A;  2UX8 A;  3I0C A;  3K8D A;  3PNN A;  3V90 A;  4B2W A;  4KC4 A;  4M28 A;  3PKQ A;  4MYB A;  3U0X A;  2VS5 A;  4M2A A;  2X60 A;  1G95 A;  2WVK A;  1SS9 A;  2WVM A;  3SX7 A;  1OMX A;  1O0R A;  1MP5 A;  4D11 C;  5IFY A;  4FRE A;  3D8V A;  2YQJ A;  2W0V A;  2VFZ A;  5C4C A;  4O6M A;  5EJZ A;  4DE7 A;  1H5R B;  1ZDF A;  3BCV A;  2W0W A;  1OMZ A;  4FRA A;  5I1F A;  4HOC A;  3OKR A;  2V0L A;  3R3I A;  2YC3 A;  5FTS A;  2ICY A;  3CKQ A;  3IOH A;  4R7P A;  3OH4 A;  2WGZ A;  3I0L A;  3V0L A;  2VS4 A;  2YQC A;  3E25 A;  4JD0 A;  3U2W A;  2PX7 A;  4BMA A;  2AM4 A;  3T7O A;  1YP3 A;  4J18 A;  5CMF X;  2V0K A;  2XWL A;  1VGT A;  3U2U A;  4B4G A;  3SPT A;  3V8Z A;  5C8R A;  4FIY A;  1V83 A;  5D92 A;  4MIX A;  1GWW A;  1JV3 A;  1ZCV A;  4E1K A;  2J0B A;  1JVD A;  1EYR A;  3F1C A;  5C4E A;  3SXE A;  2BO8 A;  4Q7C A;  1ZIZ A;  1G3L A;  2YQS A;  4CJ8 A;  1INI A;  4EE3 A;  1O7O A;  1LZ0 A;  2NXV A;  1R7Y A;  2JCK A;  4FRO A;  1ZI1 A;  1GA8 A;  1ZJP A;  1FOA A;  1FR9 A;  5L6S A;  1NQI B;  1VM8 A;  3T7N A;  5CQN X;  1ZJO A;  1H7G A;  2Y4L A;  2I5E A;  3EE5 A;  1ZDG A;  1G9R A;  2XMH A;  1ZCU A;  1TVY A;  4FQW A;  4KC1 A;  5C4B A;  2FYA A;  1FR8 A;  4HO9 A;  3OH3 A;  1H5S D;  1MP3 A;  3U2X A;  3Q80 A;  3ZGF A;  4EEA A;  1EZI A;  3PKP A;  4JIS A;  3I0I X;  1WT2 A;  3O3P A;  5IDS A;  1GX0 A;  1GQC A;  4FCU A;  1H7F A;  3RSB A;  3U2V A;  1H5T A;  5CQM X;  3HL3 A;  4KNR A;  1G2V A;  4FRL A;  1KWS A;  1H5R A;  2P73 A;  2A8W A;  1XZ6 A;  2O1G A;  2VK9 A;  4KPX A;  4Y7G A;  2RIX A;  5CMH A;  2WE9 A;  2BO4 A;  1G93 A;  4HO6 A;  3ZLK A;  3KIA A;  4K6R A;  2Y4K A;  1I52 A;  3SX3 A;  1ZJ2 A;  2V0I A;  1ZI4 A;  5FUH A;  5C1H A;  1IIN A;  2P6W A;  3R2W A;  1TW1 A;  3I0G A;  3TQD A;  4KXO A;  2PGV A;  2VS3 A;  5C4F A;  1V82 A;  5FTV A;  1H7Q A;  4C2S A;  3NGW A;  3ZLL A;  1R80 A;  5D91 A;  3V0N A;  3FOQ A;  1GQ9 A;  1QWJ A;  4NAK A;  2VSH A;  4B4M A;  1H5T B;  3D5N A;  1O7Q A;  4Y7V A;  1FO8 A;  2AE7 A;  2OI5 A;  4P02 A;  3CU0 A;  5C47 A;  1R81 A;  4ASJ A;  4D0Z A;  1WT3 A;  5C49 A;  2Y7A A;  5C36 A;  1ZI5 A;  3ST8 A;  3RMV A;  2PA4 A;  2OI6 A;  4KT7 A;  2OEF A;  2VD4 A;  3QVB A;  4FRP A;  1V84 A;  2D7I A;  2WAW A;  4G3P A;  4BQH A;  3U2T A;  5C48 A;  4HO5 A;  1OQM B;  4FCE A;  4EE4 A;  3OH1 A;  3FWW A;  2RJ8 A;  2CU2 A;  2BO6 A;  2OI7 A;  5FU8 A;  1LZ7 A;  1LL2 A;  4FIX A;  1QGS A;  4NAI A;  4ZDQ A;  1G8O A;  1H7H A; 
#chains in the Genus database with same CATH homology
 1JVG A;  1NF5 B;  4CJC A;  4G3Q A;  3Q4S A;  4EEM A;  5C1L A;  4M2B A;  4L41 C;  3SXB A;  2VXL A;  3DUV A;  5C4D A;  4XWI A;  1H5S A;  3IOJ A;  2E8B A;  2AM3 A;  3I0J A;  5J49 A;  2RJ0 A;  4FRB A;  2AM5 A;  2ZU9 A;  4G87 A;  1MC3 A;  1WT0 A;  3V0M A;  1YP4 A;  2Q4J A;  4O6N A;  5C1G A;  3ZGG A;  1FG5 N;  5BXC A;  1W77 A;  2RIY A;  1ZJ1 A;  1PZY B;  3DJ4 A;  5C3A A;  2J0A A;  2FFU A;  1QG8 A;  5L6V A;  2GGQ A;  3F1Y A;  4B3U A;  1FGX A;  1WVC A;  2P72 A;  2Y4M A;  4YS8 A;  4CVH A;  4G3S A;  2QKX A;  4ASY A;  1MP4 A;  1VGW A;  4FRQ A;  4LW3 A;  4Y6U A;  2Z86 A;  2I7B A;  4P00 A;  4DDZ A;  1H4C A;  2AES A;  2YQH A;  5AJO A;  2QGI A;  5C3B A;  4D11 A;  1W57 A;  2AH9 A;  4LW6 A;  3OC9 A;  5DDV A;  1WSZ A;  3SXD A;  5EIY A;  1VZT A;  4Y64 A;  1LZI A;  5HS2 A;  1NWG B;  5EJ1 A;  2XWM A;  1H5S B;  2X5Z A;  3JUJ A;  4Y7T A;  4FRH A;  1R7T A;  4IRQ A;  5FU0 A;  4EEO A;  2XME A;  3ZF8 A;  3CKN A;  4HCQ A;  4HO8 A;  4KNX A;  1NHE B;  1VZU A;  2AEC A;  3V0P A;  4EEG A;  4B4B A;  1G0R A;  2A8U A;  5AJN A;  4ARW A;  2X65 A;  3U0Y A;  4FRD A;  1K4V A;  1PZT A;  1HM0 A;  1WT1 A;  2ZU8 A;  2VXM A;  4DEC A;  1FRW A;  1QGQ A;  1VGU A;  4HO3 A;  4HO4 A;  1LVW A;  1Z90 A;  1JV1 A;  2JCJ A;  3Q7U A;  3DK5 A;  4CJB A;  2JCO A;  2RIT A;  2Z87 A;  1VPA A;  2JCL A;  5CMI A;  5JQQ A;  4Y6N A;  1IIM A;  3GUE A;  1HV9 A;  2YCM A;  4ECM A;  1HJJ A;  4EVW A;  1VZX A;  4NAN A;  2PGY A;  4AYJ A;  1VH3 A;  1FGG A;  4B42 A;  4KQL A;  3I0D A;  4UEG A;  1ZJ3 A;  4KRV A;  5CMJ A;  3OGZ A;  3OAM A;  4D48 A;  4HG6 A;  1VH1 A;  2BO7 A;  3IOI A;  5CQO A;  1R7X A;  4HO0 A;  4M4K A;  3RMW A;  3SXC A;  3SXA A;  2ZU7 A;  3V0O A;  3SXG A;  1G1L A;  1LL0 A;  1H7E A;  3CKO A;  2O1F A;  3BRK X;  3USQ A;  1FWY A;  3JUK A;  1S4O A;  4Y62 A;  4MND A;  1LZJ A;  1TZF A;  2RJ6 A;  3CKV A;  2FYD B;  2RJ9 A;  4KPZ A;  2FYC B;  3CGX A;  4GBP A;  2YES A;  3I0E A;  2O1H A;  1INJ A;  4B5B A;  1H4E A;  3I0K A;  1ZCT A;  3K8E A;  1FZW A;  2APC A;  3USR A;  3V91 A;  4Y7F A;  2C0N A;  2Y4J A;  4Y9X A;  5IDT A;  2V0H A;  3T7M A;  1FXO A;  2D7R A;  2V0J A;  4HO2 A;  1ZI3 A;  2WEE A;  1HJL A;  3D98 A;  4EE5 A;  3POL A;  1TW5 A;  1R82 A;  4AC3 A;  1YP2 A;  2FY7 A;  2FYB A;  2FFV A;  2RJ4 A;  1GX4 A;  2XWN A;  3SX8 A;  2QH5 A;  1JYL A;  1G97 A;  5CQL X;  2RJ1 A;  5FV9 A;  1R7V A;  1JYK A;  2Y6P A;  2VSI A;  3N9W A;  1YRO B;  2AGD A;  1FXJ A;  1ZCY A;  3OH0 A;  1NKH B;  1HM9 A;  5AJP A;  1H7T A;  1ON8 A;  2RJ7 A;  2I5K A;  5C38 A;  2DPW A;  3JTJ A;  4D0T A;  1S4N A;  1HM8 A;  5C3D A;  3SX5 A;  4Y7U A;  1R7U A;  5CQP A;  3CKJ A;  1VGZ A;  1LL3 A;  3V0Q A;  1O23 B;  1XHB A;  4Y63 A;  1VIC A;  2OEG A;  2E3D A;  1ZJ0 A;  4AYL A;  3E26 A;  1G23 A;  1H7L A;  5DDT A;  5CMG X;  3OH2 A;  2WVL A;  1ZHJ A;  2YC5 A;  1H5S C;  2GGO A;  2MZB A;  2D0J A;  1W55 A;  2RIZ A;  3TZT A;  3LW6 A;  1NMM B;  4FRM A;  4IRP A;  4KC2 A;  2X5S A;  4NAL A;  1H3M A;  2ICX A;  3I0H A;  1H4D A;  1ON6 A;  5FYE A;  1FO9 A;  2RJ5 A;  4B2X A;  1E5K A;  3I0F A;  4AAW A;  1GWV A;  1S4P A;  3V8Y A;  2UX8 A;  3I0C A;  3K8D A;  3PNN A;  3V90 A;  4B2W A;  4KC4 A;  4M28 A;  3PKQ A;  4MYB A;  3U0X A;  2VS5 A;  4M2A A;  2X60 A;  1G95 A;  2WVK A;  1SS9 A;  2WVM A;  3SX7 A;  1OMX A;  1O0R A;  1MP5 A;  4D11 C;  5IFY A;  4FRE A;  3D8V A;  2YQJ A;  2W0V A;  2VFZ A;  5C4C A;  4O6M A;  5EJZ A;  4DE7 A;  1H5R B;  1ZDF A;  3BCV A;  2W0W A;  1OMZ A;  4FRA A;  5I1F A;  4HOC A;  3OKR A;  2V0L A;  3R3I A;  2YC3 A;  5FTS A;  2ICY A;  3CKQ A;  3IOH A;  4R7P A;  3OH4 A;  2WGZ A;  3I0L A;  3V0L A;  2VS4 A;  2YQC A;  3E25 A;  4JD0 A;  3U2W A;  2PX7 A;  4BMA A;  2AM4 A;  3T7O A;  1YP3 A;  4J18 A;  5CMF X;  2V0K A;  2XWL A;  1VGT A;  3U2U A;  4B4G A;  3SPT A;  3V8Z A;  5C8R A;  4FIY A;  1V83 A;  5D92 A;  4MIX A;  1GWW A;  1JV3 A;  1ZCV A;  4E1K A;  2J0B A;  1JVD A;  1EYR A;  3F1C A;  5C4E A;  3SXE A;  2BO8 A;  4Q7C A;  1ZIZ A;  1G3L A;  2YQS A;  4CJ8 A;  1INI A;  4EE3 A;  1O7O A;  1LZ0 A;  2NXV A;  1R7Y A;  2JCK A;  4FRO A;  1ZI1 A;  1GA8 A;  1ZJP A;  1FOA A;  1FR9 A;  5L6S A;  1NQI B;  1VM8 A;  3T7N A;  5CQN X;  1ZJO A;  1H7G A;  2Y4L A;  2I5E A;  3EE5 A;  1ZDG A;  1G9R A;  2XMH A;  1ZCU A;  1TVY A;  4FQW A;  4KC1 A;  5C4B A;  2FYA A;  1FR8 A;  4HO9 A;  3OH3 A;  1H5S D;  1MP3 A;  3U2X A;  3Q80 A;  3ZGF A;  4EEA A;  1EZI A;  3PKP A;  4JIS A;  3I0I X;  1WT2 A;  3O3P A;  5IDS A;  1GX0 A;  1GQC A;  4FCU A;  1H7F A;  3RSB A;  3U2V A;  1H5T A;  5CQM X;  3HL3 A;  4KNR A;  1G2V A;  4FRL A;  1KWS A;  1H5R A;  2P73 A;  2A8W A;  1XZ6 A;  2O1G A;  2VK9 A;  4KPX A;  4Y7G A;  2RIX A;  5CMH A;  2WE9 A;  2BO4 A;  1G93 A;  4HO6 A;  3ZLK A;  3KIA A;  4K6R A;  2Y4K A;  1I52 A;  3SX3 A;  1ZJ2 A;  2V0I A;  1ZI4 A;  5FUH A;  5C1H A;  1IIN A;  2P6W A;  3R2W A;  1TW1 A;  3I0G A;  3TQD A;  4KXO A;  2PGV A;  2VS3 A;  5C4F A;  1V82 A;  5FTV A;  1H7Q A;  4C2S A;  3NGW A;  3ZLL A;  1R80 A;  5D91 A;  3V0N A;  3FOQ A;  1GQ9 A;  1QWJ A;  4NAK A;  2VSH A;  4B4M A;  1H5T B;  3D5N A;  1O7Q A;  4Y7V A;  1FO8 A;  2AE7 A;  2OI5 A;  4P02 A;  3CU0 A;  5C47 A;  1R81 A;  4ASJ A;  4D0Z A;  1WT3 A;  5C49 A;  2Y7A A;  5C36 A;  1ZI5 A;  3ST8 A;  3RMV A;  2PA4 A;  2OI6 A;  4KT7 A;  2OEF A;  2VD4 A;  3QVB A;  4FRP A;  1V84 A;  2D7I A;  2WAW A;  4G3P A;  4BQH A;  3U2T A;  5C48 A;  4HO5 A;  1OQM B;  4FCE A;  4EE4 A;  3OH1 A;  3FWW A;  2RJ8 A;  2CU2 A;  2BO6 A;  2OI7 A;  5FU8 A;  1LZ7 A;  1LL2 A;  4FIX A;  1QGS A;  4NAI A;  4ZDQ A;  1G8O A;  1H7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...