1FR8A

Crystal structure of the bovine beta 1,4 galactosyltransferase (b4galt1) catalytic domain complexed with uridine diphosphogalactose
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
271
structure length
271
Chain Sequence
TACPEESPLLVGPMLIEFNIPVDLKLVEQQNPKVKLGGRYTPMDCISPHKVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGESMFNRAKLLNVGFKEALKDYDYNCFVFSDVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLSINGFPNNYWGWGGEDDDIYNRLAFRGMSVSRPNAVIGKCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYMVLEVQRYPLYTKITVDIGTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords BETA 1,4 GALACTOSYLTRANSFERASE
publication title Crystal structures of the bovine beta4galactosyltransferase catalytic domain and its complex with uridine diphosphogalactose.
pubmed doi rcsb
source organism Bos taurus
total genus 85
structure length 271
sequence length 271
chains with identical sequence B
ec nomenclature ec 2.4.1.22: Lactose synthase.
pdb deposition date 2000-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02709 Glyco_transf_7C N-terminal domain of galactosyltransferase
A PF13733 Glyco_transf_7N N-terminal region of glycosyl transferase group 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1fr8A00
5FYEA 4JD0A 1GWWA 4KT7A 5CMIA 4HO3A 4Y7FA 2YQCA 2DPWA 4NANA 2I7BA 4G3PA 1HM0A 2A8UA 3I0CA 3DK5A 4DDZA 4HOCA 3TQDA 2V0JA 2AGDA 5IDTA 2XWNA 2I5KA 4EEMA 2NXVA 4FCEA 1FZWA 1INIA 1G3LA 1O0RA 2RJ7A 2V0LA 1G1LA 4NAKA 5IDSA 1VGTA 3FOQA 3BCVA 4HO8A 1VPAA 1H7QA 4MYBA 2Y4JA 3Q4SA 4KQLA 3ST8A 1VICA 2Z86A 1H5TA 5C1HA 1R80A 1XHBA 3SXDA 3RSBA 5FU0A 3I0JA 4D0ZA 1ON6A 3T7OA 1H5RB 2I5EA 4HO5A 1ZIZA 2RJ6A 2Z87A 1QG8A 2OEGA 4B2WA 1O7QA 4KC4A 4FRMA 1H5SB 4AAWA 4AYJA 5C48A 1PZYB 4NALA 5FTSA 5CMGX 5C4EA 3I0LA 5IFYA 1NHEB 2OI5A 4BQHA 3SX5A 3N9WA 4D0TA 1QWJA 4FRLA 1FWYA 1VH1A 2JCKA 4P02A 1GQ9A 2AM3A 1NF5B 1H4EA 3D5NA 1FR9A 3U0YA 1FXJA 3I0HA 2UX8A 3OH1A 4EE3A 2VD4A 5CQLX 1TZFA 2O1GA 1JYLA 3OH3A 3POLA 3CKQA 3F1YA 4Y6NA 2RJ8A 3SXEA 3I0IX 5DDTA 4D48A 1H7EA 2AESA 3SX8A 1TW5A 2BO7A 1EZIA 3QVBA 3V0QA 1S4PA 2V0IA 1MC3A 1V83A 1GWVA 1ZI3A 2ZU8A 4HCQA 4EE4A 2Q4JA 2PX7A 3T7MA 3U2VA 5CQNX 4HG6A 3CKNA 4IRPA 1LL3A 4E1KA 1G93A 2JCOA 5FUHA 2VXLA 3CU0A 4EVWA 5AJPA 4IRQA 5C3BA 3F1CA 3USQA 4Y6UA 3ZF8A 2Y7AA 1H7HA 1VZUA 1OMZA 5FTVA 3JTJA 1LZ7A 4B42A 1G95A 5C4CA 5FV9A 1H3MA 2QH5A 3V0PA 2WGZA 2WEEA 2PGYA 1WT0A 1Z90A 3I0KA 4L41C 2FYBA 4Y7GA 5C4DA 2Y6PA 1INJA 5J49A 1O23B 5CQOA 1ZJPA 1YROB 3I0DA 2V0HA 2X5SA 3IOHA 5CQMX 1ON8A 4FRAA 1W77A 3V8YA 1FGXA 3SXGA 1TVYA 5C8RA 2VSHA 3I0GA 5DDVA 1H5SD 4G3QA 4XWIA 5FU8A 2ICXA 3U2TA 2YCMA 4CVHA 1NKHB 1QGQA 4B2XA 3JUKA 3U2UA 1VZTA 3OH0A 2O1FA 5C38A 1R7TA 3V0MA 3E26A 1JV3A 5CMFX 2YQSA 2XWLA 4C2SA 3IOIA 3PKPA 1H5SC 4FRQA 2E8BA 1OMXA 2WVLA 2W0WA 4KXOA 1ZCUA 4KC1A 5C3DA 3CKVA 1ZCTA 4B4GA 3JUJA 1LZJA 4G87A 4Y62A 3CKJA 1ZHJA 1WSZA 4ECMA 3ZGFA 3ZLLA 1W55A 2P6WA 2PGVA 1JYKA 4EEAA 1R7UA 1SS9A 2AM5A 1ZI4A 3V91A 4ZDQA 4CJ8A 5HS2A 1GX0A 1G97A 4CJCA 2VS4A 1ZCYA 2JCJA 2RJ0A 3Q80A 1H5RA 3I0FA 5C1LA 4YS8A 2FYCB 3EE5A 3RMVA 2RITA 1G2VA 3V0OA 1H5SA 1HV9A 5CMHA 1MP4A 2RIZA 2AE7A 3SX3A 1XZ6A 2AM4A 4KPZA 4CJBA 2E3DA 1LL2A 4FCUA 2GGOA 2JCLA 1VM8A 1R82A 1ZI5A 4UEGA 2APCA 4HO4A 4P00A 1NWGB 1G0RA 1H7GA 3CKOA 4HO9A 1TW1A 1YP2A 1ZI1A 1GQCA 4HO2A 1LZ0A 2D7IA 3V0NA 1GX4A 3DUVA 1JV1A 4M28A 5EJZA 5C3AA 4D11C 1YP4A 2XWMA 4KC2A 1JVGA 5C49A 1VGWA 3IOJA 1WT3A 3LW6A 1G23A 4FQWA 1ZJ2A 5EIYA 1FXOA 1K4VA 2XMEA 5AJNA 2CU2A 2X5ZA 2FY7A 1PZTA 4M4KA 4EE5A 1S4NA 1H7TA 2Y4KA 4Y7VA 5CMJA 2XMHA 1R7XA 1FO9A 2VXMA 2Y4LA 4ASYA 4FREA 3USRA 4BMAA 4KNRA 2VFZA 1H4CA 3RMWA 1ZJ3A 3R2WA 4G3SA 2Y4MA 3OH2A 3ZGGA 4Y7TA 4D11A 2RJ5A 1FO8A 4KPXA 4FRBA 5JQQA 3OAMA 2RIXA 4Y7UA 5L6VA 4B4BA 2RJ9A 2X65A 2W0VA 3ZLKA 4AYLA 2GGQA 4LW6A 2X60A 4Y64A 1LL0A 1VGZA 1ZDFA 5L6SA 4HO6A 1WT2A 1ZJ0A 5C47A 1FGGA 2RIYA 5BXCA 1H5TB 4EEOA 4FRHA 2ZU9A 4Y9XA 3T7NA 4KRVA 2BO8A 1H7LA 4HO0A 5C1GA 1FRWA 4FROA 1R7VA 4J18A 4B3UA 4GBPA 4EEGA 5C36A 1IINA 1FG5N 2MZBA 1NMMB 3TZTA 1HJLA 2FFUA 2D0JA 1R7YA 3PNNA 3SXCA 1ZCVA 1I52A 3OH4A 2WVMA 3OC9A 4K6RA 2QGIA 2QKXA 3U2XA 4NAIA 2FFVA 4DE7A 4KNXA 3KIAA 1W57A 1NQIB 2YC3A 2FYAA 3R3IA 2ICYA 4MNDA 1H4DA 1O7OA 4ASJA 4JISA 4M2AA 3V8ZA 1EYRA 3SX7A 2VS5A 2P72A 1VH3A 2VSIA 2WAWA 3E25A 1H7FA 2A8WA 2RJ1A 2YQJA 2P73A 2OI7A 1KWSA 4LW3A 3V0LA 5EJ1A 1MP5A 2ZU7A 1LZIA 2BO4A 1R81A 1MP3A 3PKQA 2AH9A 1S4OA 2AECA 1JVDA 2YC5A 2WVKA 3O3PA 2FYDB 3SXAA 3K8DA 3SXBA 1WT1A 5C4BA 3U0XA 3I0EA 4B5BA 3CGXA 3NGWA 1FR8A 5C4FA 4B4MA 1G8OA 1OQMB 4FRDA 1FOAA 1HM8A 3FWWA 1VZXA 3D8VA 1GA8A 2RJ4A 1G9RA 4Y63A 3BRKX 3OGZA 2PA4A 3DJ4A 1HJJA 4R7PA 1VGUA 1ZDGA 2YESA 1V82A 1ZJOA 3D98A 4M2BA 2YQHA 2OEFA 2V0KA 2BO6A 4FRPA 1YP3A 3U2WA 1ZJ1A 3SPTA 5CQPA 2OI6A 4AC3A 3Q7UA 4ARWA 5I1FA 3GUEA 2D7RA 3V90A 1LVWA 2VS3A 1WVCA 1IIMA 1HM9A 4DECA 1E5KA 2WE9A 5AJOA 1V84A 2O1HA 3K8EA 1QGSA 3HL3A 3OKRA
chains in the Genus database with same CATH superfamily
5FYEA 4JD0A 1GWWA 4KT7A 4MIXA 5CMIA 4HO3A 4Y7FA 2YQCA 2DPWA 4NANA 2I7BA 4G3PA 1HM0A 2A8UA 4O6MA 3I0CA 3DK5A 4DDZA 4HOCA 3TQDA 2V0JA 2AGDA 5IDTA 2XWNA 2I5KA 4EEMA 2NXVA 4FCEA 1FZWA 1INIA 1G3LA 1O0RA 2RJ7A 2V0LA 1G1LA 4NAKA 5IDSA 1VGTA 3FOQA 3BCVA 4HO8A 1VPAA 1H7QA 4MYBA 2Y4JA 3Q4SA 4KQLA 3ST8A 1VICA 2Z86A 1H5TA 5C1HA 1R80A 1XHBA 3SXDA 3RSBA 5FU0A 3I0JA 4D0ZA 1ON6A 3T7OA 1H5RB 2I5EA 4HO5A 1ZIZA 2RJ6A 2Z87A 1QG8A 2OEGA 4B2WA 1O7QA 4KC4A 4FRMA 1H5SB 4AAWA 4AYJA 5C48A 1PZYB 4NALA 5FTSA 5CMGX 5C4EA 3I0LA 5IFYA 1NHEB 2OI5A 4BQHA 3SX5A 3N9WA 4D0TA 1QWJA 4FRLA 1FWYA 1VH1A 2JCKA 4P02A 1GQ9A 2AM3A 1NF5B 1H4EA 3D5NA 1FR9A 3U0YA 1FXJA 3I0HA 2UX8A 3OH1A 4EE3A 2VD4A 5CQLX 1TZFA 2O1GA 1JYLA 3OH3A 3POLA 3CKQA 3F1YA 4Y6NA 2RJ8A 3SXEA 3I0IX 5DDTA 4D48A 1H7EA 2AESA 3SX8A 1TW5A 2BO7A 2J0BA 1EZIA 3QVBA 3V0QA 1S4PA 2V0IA 1MC3A 1V83A 1GWVA 1ZI3A 2ZU8A 4HCQA 4O6NA 4EE4A 2Q4JA 2PX7A 3T7MA 3U2VA 4FIXA 5CQNX 4HG6A 3CKNA 4IRPA 1LL3A 4E1KA 1G93A 5D91A 2JCOA 5FUHA 2VXLA 3CU0A 4EVWA 5AJPA 4IRQA 5C3BA 3F1CA 3USQA 4Y6UA 3ZF8A 2Y7AA 1H7HA 1VZUA 1OMZA 5FTVA 3JTJA 1LZ7A 4B42A 1G95A 5C4CA 5FV9A 1H3MA 2QH5A 3V0PA 2WGZA 4FIYA 2WEEA 2PGYA 1WT0A 1Z90A 3I0KA 4L41C 2FYBA 4Y7GA 5C4DA 2Y6PA 1INJA 5J49A 1O23B 5CQOA 1ZJPA 1YROB 3I0DA 2V0HA 2X5SA 3IOHA 5CQMX 1ON8A 4FRAA 1W77A 3V8YA 1FGXA 3SXGA 1TVYA 5C8RA 2VSHA 3I0GA 5DDVA 1H5SD 4G3QA 4XWIA 5FU8A 2ICXA 3U2TA 2YCMA 4CVHA 1NKHB 1QGQA 4B2XA 3JUKA 3U2UA 1VZTA 3OH0A 2O1FA 5C38A 1R7TA 3V0MA 3E26A 1JV3A 5CMFX 2YQSA 2XWLA 4C2SA 3IOIA 3PKPA 1H5SC 4FRQA 2E8BA 2J0AA 1OMXA 2WVLA 2W0WA 4KXOA 1ZCUA 4KC1A 5C3DA 3CKVA 1ZCTA 4B4GA 3JUJA 1LZJA 4G87A 4Y62A 3CKJA 1ZHJA 1WSZA 4ECMA 3ZGFA 3ZLLA 1W55A 2P6WA 2PGVA 1JYKA 4EEAA 1R7UA 1SS9A 2AM5A 1ZI4A 3V91A 4ZDQA 4CJ8A 5HS2A 1GX0A 1G97A 4CJCA 2VS4A 1ZCYA 2JCJA 2RJ0A 3Q80A 1H5RA 3I0FA 5C1LA 4YS8A 2FYCB 3EE5A 3RMVA 2RITA 1G2VA 3V0OA 1H5SA 1HV9A 5CMHA 1MP4A 2RIZA 2AE7A 3SX3A 1XZ6A 2AM4A 4KPZA 4CJBA 2E3DA 1LL2A 4FCUA 2GGOA 2JCLA 1VM8A 1R82A 1ZI5A 4UEGA 2APCA 5D92A 4HO4A 4P00A 1NWGB 1G0RA 1H7GA 3CKOA 4HO9A 1TW1A 1YP2A 1ZI1A 1GQCA 4HO2A 1LZ0A 2D7IA 3V0NA 1GX4A 3DUVA 1JV1A 4M28A 5EJZA 5C3AA 4D11C 1YP4A 2XWMA 4KC2A 1JVGA 5C49A 1VGWA 3IOJA 1WT3A 3LW6A 1G23A 4FQWA 1ZJ2A 5EIYA 1FXOA 1K4VA 2XMEA 5AJNA 2CU2A 2X5ZA 2FY7A 1PZTA 4M4KA 4EE5A 1S4NA 1H7TA 2Y4KA 4Y7VA 5CMJA 2XMHA 1R7XA 1FO9A 2VXMA 2Y4LA 4ASYA 4FREA 3USRA 4BMAA 4KNRA 4Q7CA 2VFZA 1H4CA 3RMWA 1ZJ3A 3R2WA 4G3SA 2Y4MA 3OH2A 3ZGGA 4Y7TA 4D11A 2RJ5A 1FO8A 4KPXA 4FRBA 5JQQA 3OAMA 2RIXA 4Y7UA 5L6VA 4B4BA 2RJ9A 2X65A 2W0VA 3ZLKA 4AYLA 2GGQA 4LW6A 2X60A 4Y64A 1LL0A 1VGZA 1ZDFA 5L6SA 4HO6A 1WT2A 1ZJ0A 5C47A 1FGGA 2RIYA 5BXCA 1H5TB 4EEOA 4FRHA 2ZU9A 4Y9XA 3T7NA 4KRVA 2BO8A 1H7LA 4HO0A 5C1GA 1FRWA 4FROA 1R7VA 4J18A 4B3UA 4GBPA 4EEGA 5C36A 1IINA 1FG5N 2MZBA 1NMMB 3TZTA 1HJLA 2FFUA 2D0JA 1R7YA 3PNNA 3SXCA 1ZCVA 1I52A 3OH4A 2WVMA 3OC9A 4K6RA 2QGIA 2QKXA 3U2XA 4NAIA 2FFVA 4DE7A 4KNXA 3KIAA 1W57A 1NQIB 2YC3A 2FYAA 3R3IA 2ICYA 4MNDA 1H4DA 1O7OA 4ASJA 4JISA 4M2AA 3V8ZA 1EYRA 3SX7A 2VS5A 2P72A 1VH3A 2VSIA 2WAWA 3E25A 1H7FA 2A8WA 2RJ1A 2YQJA 2P73A 2OI7A 1KWSA 4LW3A 3V0LA 5EJ1A 1MP5A 2ZU7A 1LZIA 2BO4A 1R81A 1MP3A 3PKQA 2AH9A 1S4OA 2AECA 1JVDA 2YC5A 2WVKA 3O3PA 2FYDB 3SXAA 3K8DA 3SXBA 1WT1A 2C0NA 5C4BA 3U0XA 3I0EA 4B5BA 3CGXA 3NGWA 1FR8A 5C4FA 4B4MA 1G8OA 1OQMB 4FRDA 1FOAA 1HM8A 3FWWA 1VZXA 3D8VA 1GA8A 2RJ4A 1G9RA 4Y63A 3BRKX 3OGZA 2PA4A 3DJ4A 1HJJA 4R7PA 1VGUA 1ZDGA 2VK9A 2YESA 1V82A 1ZJOA 3D98A 4M2BA 2YQHA 2OEFA 2V0KA 2BO6A 4FRPA 1YP3A 3U2WA 1ZJ1A 3SPTA 5CQPA 2OI6A 4AC3A 3Q7UA 4ARWA 5I1FA 3GUEA 2D7RA 3V90A 1LVWA 2VS3A 1WVCA 1IIMA 1HM9A 4DECA 1E5KA 2WE9A 5AJOA 1V84A 2O1HA 3K8EA 1QGSA 3HL3A 3OKRA
chains in the Genus database with same CATH topology
5FYEA 4JD0A 1GWWA 4KT7A 4MIXA 5CMIA 4HO3A 4Y7FA 2YQCA 2DPWA 4NANA 2I7BA 4G3PA 1HM0A 2A8UA 4O6MA 3I0CA 3DK5A 4DDZA 4HOCA 3TQDA 2V0JA 2AGDA 5IDTA 2XWNA 2I5KA 4EEMA 2NXVA 4FCEA 1FZWA 1INIA 1G3LA 1O0RA 2RJ7A 2V0LA 1G1LA 4NAKA 5IDSA 1VGTA 3FOQA 3BCVA 4HO8A 1VPAA 1H7QA 4MYBA 2Y4JA 3Q4SA 4KQLA 3ST8A 1VICA 2Z86A 1H5TA 5C1HA 1R80A 1XHBA 3SXDA 3RSBA 5FU0A 3I0JA 4D0ZA 1ON6A 3T7OA 1H5RB 2I5EA 4HO5A 1ZIZA 2RJ6A 2Z87A 1QG8A 2OEGA 4B2WA 1O7QA 4KC4A 4FRMA 1H5SB 4AAWA 4AYJA 5C48A 1PZYB 4NALA 5FTSA 5CMGX 5C4EA 3I0LA 5IFYA 1NHEB 2OI5A 4BQHA 3SX5A 3N9WA 4D0TA 1QWJA 4FRLA 1FWYA 1VH1A 2JCKA 4P02A 1GQ9A 2AM3A 1NF5B 1H4EA 3D5NA 1FR9A 3U0YA 1FXJA 3I0HA 2UX8A 3OH1A 4EE3A 2VD4A 5CQLX 1TZFA 2O1GA 1JYLA 3OH3A 3POLA 3CKQA 3F1YA 4Y6NA 2RJ8A 3SXEA 3I0IX 5DDTA 4D48A 1H7EA 2AESA 3SX8A 1TW5A 2BO7A 2J0BA 1EZIA 3QVBA 3V0QA 1S4PA 2V0IA 1MC3A 1V83A 1GWVA 1ZI3A 2ZU8A 4HCQA 4O6NA 4EE4A 2Q4JA 2PX7A 3T7MA 3U2VA 4FIXA 5CQNX 4HG6A 3CKNA 4IRPA 1LL3A 4E1KA 1G93A 5D91A 2JCOA 5FUHA 2VXLA 3CU0A 4EVWA 5AJPA 4IRQA 5C3BA 3F1CA 3USQA 4Y6UA 3ZF8A 2Y7AA 1H7HA 1VZUA 1OMZA 5FTVA 3JTJA 1LZ7A 4B42A 1G95A 5C4CA 5FV9A 1H3MA 2QH5A 3V0PA 2WGZA 4FIYA 2WEEA 2PGYA 1WT0A 1Z90A 3I0KA 4L41C 2FYBA 4Y7GA 5C4DA 2Y6PA 1INJA 5J49A 1O23B 5CQOA 1ZJPA 1YROB 3I0DA 2V0HA 2X5SA 3IOHA 5CQMX 1ON8A 4FRAA 1W77A 3V8YA 1FGXA 3SXGA 1TVYA 5C8RA 2VSHA 3I0GA 5DDVA 1H5SD 4G3QA 4XWIA 5FU8A 2ICXA 3U2TA 2YCMA 4CVHA 1NKHB 1QGQA 4B2XA 3JUKA 3U2UA 1VZTA 3OH0A 2O1FA 5C38A 1R7TA 3V0MA 3E26A 1JV3A 5CMFX 2YQSA 2XWLA 4C2SA 3IOIA 3PKPA 1H5SC 4FRQA 2E8BA 2J0AA 1OMXA 2WVLA 2W0WA 4KXOA 1ZCUA 4KC1A 5C3DA 3CKVA 1ZCTA 4B4GA 3JUJA 1LZJA 4G87A 4Y62A 3CKJA 1ZHJA 1WSZA 4ECMA 3ZGFA 3ZLLA 1W55A 2P6WA 2PGVA 1JYKA 4EEAA 1R7UA 1SS9A 2AM5A 1ZI4A 3V91A 4ZDQA 4CJ8A 5HS2A 1GX0A 1G97A 4CJCA 2VS4A 1ZCYA 2JCJA 2RJ0A 3Q80A 1H5RA 3I0FA 5C1LA 4YS8A 2FYCB 3EE5A 3RMVA 2RITA 1G2VA 3V0OA 1H5SA 1HV9A 5CMHA 1MP4A 2RIZA 2AE7A 3SX3A 1XZ6A 2AM4A 4KPZA 4CJBA 2E3DA 1LL2A 4FCUA 2GGOA 2JCLA 1VM8A 1R82A 1ZI5A 4UEGA 2APCA 5D92A 4HO4A 4P00A 1NWGB 1G0RA 1H7GA 3CKOA 4HO9A 1TW1A 1YP2A 1ZI1A 1GQCA 4HO2A 1LZ0A 2D7IA 3V0NA 1GX4A 3DUVA 1JV1A 4M28A 5EJZA 5C3AA 4D11C 1YP4A 2XWMA 4KC2A 1JVGA 5C49A 1VGWA 3IOJA 1WT3A 3LW6A 1G23A 4FQWA 1ZJ2A 5EIYA 1FXOA 1K4VA 2XMEA 5AJNA 2CU2A 2X5ZA 2FY7A 1PZTA 4M4KA 4EE5A 1S4NA 1H7TA 2Y4KA 4Y7VA 5CMJA 2XMHA 1R7XA 1FO9A 2VXMA 2Y4LA 4ASYA 4FREA 3USRA 4BMAA 4KNRA 4Q7CA 2VFZA 1H4CA 3RMWA 1ZJ3A 3R2WA 4G3SA 2Y4MA 3OH2A 3ZGGA 4Y7TA 4D11A 2RJ5A 1FO8A 4KPXA 4FRBA 5JQQA 3OAMA 2RIXA 4Y7UA 5L6VA 4B4BA 2RJ9A 2X65A 2W0VA 3ZLKA 4AYLA 2GGQA 4LW6A 2X60A 4Y64A 1LL0A 1VGZA 1ZDFA 5L6SA 4HO6A 1WT2A 1ZJ0A 5C47A 1FGGA 2RIYA 5BXCA 1H5TB 4EEOA 4FRHA 2ZU9A 4Y9XA 3T7NA 4KRVA 2BO8A 1H7LA 4HO0A 5C1GA 1FRWA 4FROA 1R7VA 4J18A 4B3UA 4GBPA 4EEGA 5C36A 1IINA 1FG5N 2MZBA 1NMMB 3TZTA 1HJLA 2FFUA 2D0JA 1R7YA 3PNNA 3SXCA 1ZCVA 1I52A 3OH4A 2WVMA 3OC9A 4K6RA 2QGIA 2QKXA 3U2XA 4NAIA 2FFVA 4DE7A 4KNXA 3KIAA 1W57A 1NQIB 2YC3A 2FYAA 3R3IA 2ICYA 4MNDA 1H4DA 1O7OA 4ASJA 4JISA 4M2AA 3V8ZA 1EYRA 3SX7A 2VS5A 2P72A 1VH3A 2VSIA 2WAWA 3E25A 1H7FA 2A8WA 2RJ1A 2YQJA 2P73A 2OI7A 1KWSA 4LW3A 3V0LA 5EJ1A 1MP5A 2ZU7A 1LZIA 2BO4A 1R81A 1MP3A 3PKQA 2AH9A 1S4OA 2AECA 1JVDA 2YC5A 2WVKA 3O3PA 2FYDB 3SXAA 3K8DA 3SXBA 1WT1A 2C0NA 5C4BA 3U0XA 3I0EA 4B5BA 3CGXA 3NGWA 1FR8A 5C4FA 4B4MA 1G8OA 1OQMB 4FRDA 1FOAA 1HM8A 3FWWA 1VZXA 3D8VA 1GA8A 2RJ4A 1G9RA 4Y63A 3BRKX 3OGZA 2PA4A 3DJ4A 1HJJA 4R7PA 1VGUA 1ZDGA 2VK9A 2YESA 1V82A 1ZJOA 3D98A 4M2BA 2YQHA 2OEFA 2V0KA 2BO6A 4FRPA 1YP3A 3U2WA 1ZJ1A 3SPTA 5CQPA 2OI6A 4AC3A 3Q7UA 4ARWA 5I1FA 3GUEA 2D7RA 3V90A 1LVWA 2VS3A 1WVCA 1IIMA 1HM9A 4DECA 1E5KA 2WE9A 5AJOA 1V84A 2O1HA 3K8EA 1QGSA 3HL3A 3OKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FYE A;  4JD0 A;  1GWW A;  4KT7 A;  5CMI A;  4HO3 A;  4Y7F A;  2YQC A;  2DPW A;  4NAN A;  2I7B A;  4G3P A;  1HM0 A;  2A8U A;  3I0C A;  3DK5 A;  4DDZ A;  4HOC A;  3TQD A;  2V0J A;  2AGD A;  5IDT A;  2XWN A;  2I5K A;  4EEM A;  2NXV A;  4FCE A;  1FZW A;  1INI A;  1G3L A;  1O0R A;  2RJ7 A;  2V0L A;  1G1L A;  4NAK A;  5IDS A;  1VGT A;  3FOQ A;  3BCV A;  4HO8 A;  1VPA A;  1H7Q A;  4MYB A;  2Y4J A;  3Q4S A;  4KQL A;  3ST8 A;  1VIC A;  2Z86 A;  1H5T A;  5C1H A;  1R80 A;  1XHB A;  3SXD A;  3RSB A;  5FU0 A;  3I0J A;  4D0Z A;  1ON6 A;  3T7O A;  1H5R B;  2I5E A;  4HO5 A;  1ZIZ A;  2RJ6 A;  2Z87 A;  1QG8 A;  2OEG A;  4B2W A;  1O7Q A;  4KC4 A;  4FRM A;  1H5S B;  4AAW A;  4AYJ A;  5C48 A;  1PZY B;  4NAL A;  5FTS A;  5CMG X;  5C4E A;  3I0L A;  5IFY A;  1NHE B;  2OI5 A;  4BQH A;  3SX5 A;  3N9W A;  4D0T A;  1QWJ A;  4FRL A;  1FWY A;  1VH1 A;  2JCK A;  4P02 A;  1GQ9 A;  2AM3 A;  1NF5 B;  1H4E A;  3D5N A;  1FR9 A;  3U0Y A;  1FXJ A;  3I0H A;  2UX8 A;  3OH1 A;  4EE3 A;  2VD4 A;  5CQL X;  1TZF A;  2O1G A;  1JYL A;  3OH3 A;  3POL A;  3CKQ A;  3F1Y A;  4Y6N A;  2RJ8 A;  3SXE A;  3I0I X;  5DDT A;  4D48 A;  1H7E A;  2AES A;  3SX8 A;  1TW5 A;  2BO7 A;  1EZI A;  3QVB A;  3V0Q A;  1S4P A;  2V0I A;  1MC3 A;  1V83 A;  1GWV A;  1ZI3 A;  2ZU8 A;  4HCQ A;  4EE4 A;  2Q4J A;  2PX7 A;  3T7M A;  3U2V A;  5CQN X;  4HG6 A;  3CKN A;  4IRP A;  1LL3 A;  4E1K A;  1G93 A;  2JCO A;  5FUH A;  2VXL A;  3CU0 A;  4EVW A;  5AJP A;  4IRQ A;  5C3B A;  3F1C A;  3USQ A;  4Y6U A;  3ZF8 A;  2Y7A A;  1H7H A;  1VZU A;  1OMZ A;  5FTV A;  3JTJ A;  1LZ7 A;  4B42 A;  1G95 A;  5C4C A;  5FV9 A;  1H3M A;  2QH5 A;  3V0P A;  2WGZ A;  2WEE A;  2PGY A;  1WT0 A;  1Z90 A;  3I0K A;  4L41 C;  2FYB A;  4Y7G A;  5C4D A;  2Y6P A;  1INJ A;  5J49 A;  1O23 B;  5CQO A;  1ZJP A;  1YRO B;  3I0D A;  2V0H A;  2X5S A;  3IOH A;  5CQM X;  1ON8 A;  4FRA A;  1W77 A;  3V8Y A;  1FGX A;  3SXG A;  1TVY A;  5C8R A;  2VSH A;  3I0G A;  5DDV A;  1H5S D;  4G3Q A;  4XWI A;  5FU8 A;  2ICX A;  3U2T A;  2YCM A;  4CVH A;  1NKH B;  1QGQ A;  4B2X A;  3JUK A;  3U2U A;  1VZT A;  3OH0 A;  2O1F A;  5C38 A;  1R7T A;  3V0M A;  3E26 A;  1JV3 A;  5CMF X;  2YQS A;  2XWL A;  4C2S A;  3IOI A;  3PKP A;  1H5S C;  4FRQ A;  2E8B A;  1OMX A;  2WVL A;  2W0W A;  4KXO A;  1ZCU A;  4KC1 A;  5C3D A;  3CKV A;  1ZCT A;  4B4G A;  3JUJ A;  1LZJ A;  4G87 A;  4Y62 A;  3CKJ A;  1ZHJ A;  1WSZ A;  4ECM A;  3ZGF A;  3ZLL A;  1W55 A;  2P6W A;  2PGV A;  1JYK A;  4EEA A;  1R7U A;  1SS9 A;  2AM5 A;  1ZI4 A;  3V91 A;  4ZDQ A;  4CJ8 A;  5HS2 A;  1GX0 A;  1G97 A;  4CJC A;  2VS4 A;  1ZCY A;  2JCJ A;  2RJ0 A;  3Q80 A;  1H5R A;  3I0F A;  5C1L A;  4YS8 A;  2FYC B;  3EE5 A;  3RMV A;  2RIT A;  1G2V A;  3V0O A;  1H5S A;  1HV9 A;  5CMH A;  1MP4 A;  2RIZ A;  2AE7 A;  3SX3 A;  1XZ6 A;  2AM4 A;  4KPZ A;  4CJB A;  2E3D A;  1LL2 A;  4FCU A;  2GGO A;  2JCL A;  1VM8 A;  1R82 A;  1ZI5 A;  4UEG A;  2APC A;  4HO4 A;  4P00 A;  1NWG B;  1G0R A;  1H7G A;  3CKO A;  4HO9 A;  1TW1 A;  1YP2 A;  1ZI1 A;  1GQC A;  4HO2 A;  1LZ0 A;  2D7I A;  3V0N A;  1GX4 A;  3DUV A;  1JV1 A;  4M28 A;  5EJZ A;  5C3A A;  4D11 C;  1YP4 A;  2XWM A;  4KC2 A;  1JVG A;  5C49 A;  1VGW A;  3IOJ A;  1WT3 A;  3LW6 A;  1G23 A;  4FQW A;  1ZJ2 A;  5EIY A;  1FXO A;  1K4V A;  2XME A;  5AJN A;  2CU2 A;  2X5Z A;  2FY7 A;  1PZT A;  4M4K A;  4EE5 A;  1S4N A;  1H7T A;  2Y4K A;  4Y7V A;  5CMJ A;  2XMH A;  1R7X A;  1FO9 A;  2VXM A;  2Y4L A;  4ASY A;  4FRE A;  3USR A;  4BMA A;  4KNR A;  2VFZ A;  1H4C A;  3RMW A;  1ZJ3 A;  3R2W A;  4G3S A;  2Y4M A;  3OH2 A;  3ZGG A;  4Y7T A;  4D11 A;  2RJ5 A;  1FO8 A;  4KPX A;  4FRB A;  5JQQ A;  3OAM A;  2RIX A;  4Y7U A;  5L6V A;  4B4B A;  2RJ9 A;  2X65 A;  2W0V A;  3ZLK A;  4AYL A;  2GGQ A;  4LW6 A;  2X60 A;  4Y64 A;  1LL0 A;  1VGZ A;  1ZDF A;  5L6S A;  4HO6 A;  1WT2 A;  1ZJ0 A;  5C47 A;  1FGG A;  2RIY A;  5BXC A;  1H5T B;  4EEO A;  4FRH A;  2ZU9 A;  4Y9X A;  3T7N A;  4KRV A;  2BO8 A;  1H7L A;  4HO0 A;  5C1G A;  1FRW A;  4FRO A;  1R7V A;  4J18 A;  4B3U A;  4GBP A;  4EEG A;  5C36 A;  1IIN A;  1FG5 N;  2MZB A;  1NMM B;  3TZT A;  1HJL A;  2FFU A;  2D0J A;  1R7Y A;  3PNN A;  3SXC A;  1ZCV A;  1I52 A;  3OH4 A;  2WVM A;  3OC9 A;  4K6R A;  2QGI A;  2QKX A;  3U2X A;  4NAI A;  2FFV A;  4DE7 A;  4KNX A;  3KIA A;  1W57 A;  1NQI B;  2YC3 A;  2FYA A;  3R3I A;  2ICY A;  4MND A;  1H4D A;  1O7O A;  4ASJ A;  4JIS A;  4M2A A;  3V8Z A;  1EYR A;  3SX7 A;  2VS5 A;  2P72 A;  1VH3 A;  2VSI A;  2WAW A;  3E25 A;  1H7F A;  2A8W A;  2RJ1 A;  2YQJ A;  2P73 A;  2OI7 A;  1KWS A;  4LW3 A;  3V0L A;  5EJ1 A;  1MP5 A;  2ZU7 A;  1LZI A;  2BO4 A;  1R81 A;  1MP3 A;  3PKQ A;  2AH9 A;  1S4O A;  2AEC A;  1JVD A;  2YC5 A;  2WVK A;  3O3P A;  2FYD B;  3SXA A;  3K8D A;  3SXB A;  1WT1 A;  5C4B A;  3U0X A;  3I0E A;  4B5B A;  3CGX A;  3NGW A;  1FR8 A;  5C4F A;  4B4M A;  1G8O A;  1OQM B;  4FRD A;  1FOA A;  1HM8 A;  3FWW A;  1VZX A;  3D8V A;  1GA8 A;  2RJ4 A;  1G9R A;  4Y63 A;  3BRK X;  3OGZ A;  2PA4 A;  3DJ4 A;  1HJJ A;  4R7P A;  1VGU A;  1ZDG A;  2YES A;  1V82 A;  1ZJO A;  3D98 A;  4M2B A;  2YQH A;  2OEF A;  2V0K A;  2BO6 A;  4FRP A;  1YP3 A;  3U2W A;  1ZJ1 A;  3SPT A;  5CQP A;  2OI6 A;  4AC3 A;  3Q7U A;  4ARW A;  5I1F A;  3GUE A;  2D7R A;  3V90 A;  1LVW A;  2VS3 A;  1WVC A;  1IIM A;  1HM9 A;  4DEC A;  1E5K A;  2WE9 A;  5AJO A;  1V84 A;  2O1H A;  3K8E A;  1QGS A;  3HL3 A;  3OKR A; 
#chains in the Genus database with same CATH topology
 5FYE A;  4JD0 A;  1GWW A;  4KT7 A;  4MIX A;  5CMI A;  4HO3 A;  4Y7F A;  2YQC A;  2DPW A;  4NAN A;  2I7B A;  4G3P A;  1HM0 A;  2A8U A;  4O6M A;  3I0C A;  3DK5 A;  4DDZ A;  4HOC A;  3TQD A;  2V0J A;  2AGD A;  5IDT A;  2XWN A;  2I5K A;  4EEM A;  2NXV A;  4FCE A;  1FZW A;  1INI A;  1G3L A;  1O0R A;  2RJ7 A;  2V0L A;  1G1L A;  4NAK A;  5IDS A;  1VGT A;  3FOQ A;  3BCV A;  4HO8 A;  1VPA A;  1H7Q A;  4MYB A;  2Y4J A;  3Q4S A;  4KQL A;  3ST8 A;  1VIC A;  2Z86 A;  1H5T A;  5C1H A;  1R80 A;  1XHB A;  3SXD A;  3RSB A;  5FU0 A;  3I0J A;  4D0Z A;  1ON6 A;  3T7O A;  1H5R B;  2I5E A;  4HO5 A;  1ZIZ A;  2RJ6 A;  2Z87 A;  1QG8 A;  2OEG A;  4B2W A;  1O7Q A;  4KC4 A;  4FRM A;  1H5S B;  4AAW A;  4AYJ A;  5C48 A;  1PZY B;  4NAL A;  5FTS A;  5CMG X;  5C4E A;  3I0L A;  5IFY A;  1NHE B;  2OI5 A;  4BQH A;  3SX5 A;  3N9W A;  4D0T A;  1QWJ A;  4FRL A;  1FWY A;  1VH1 A;  2JCK A;  4P02 A;  1GQ9 A;  2AM3 A;  1NF5 B;  1H4E A;  3D5N A;  1FR9 A;  3U0Y A;  1FXJ A;  3I0H A;  2UX8 A;  3OH1 A;  4EE3 A;  2VD4 A;  5CQL X;  1TZF A;  2O1G A;  1JYL A;  3OH3 A;  3POL A;  3CKQ A;  3F1Y A;  4Y6N A;  2RJ8 A;  3SXE A;  3I0I X;  5DDT A;  4D48 A;  1H7E A;  2AES A;  3SX8 A;  1TW5 A;  2BO7 A;  2J0B A;  1EZI A;  3QVB A;  3V0Q A;  1S4P A;  2V0I A;  1MC3 A;  1V83 A;  1GWV A;  1ZI3 A;  2ZU8 A;  4HCQ A;  4O6N A;  4EE4 A;  2Q4J A;  2PX7 A;  3T7M A;  3U2V A;  4FIX A;  5CQN X;  4HG6 A;  3CKN A;  4IRP A;  1LL3 A;  4E1K A;  1G93 A;  5D91 A;  2JCO A;  5FUH A;  2VXL A;  3CU0 A;  4EVW A;  5AJP A;  4IRQ A;  5C3B A;  3F1C A;  3USQ A;  4Y6U A;  3ZF8 A;  2Y7A A;  1H7H A;  1VZU A;  1OMZ A;  5FTV A;  3JTJ A;  1LZ7 A;  4B42 A;  1G95 A;  5C4C A;  5FV9 A;  1H3M A;  2QH5 A;  3V0P A;  2WGZ A;  4FIY A;  2WEE A;  2PGY A;  1WT0 A;  1Z90 A;  3I0K A;  4L41 C;  2FYB A;  4Y7G A;  5C4D A;  2Y6P A;  1INJ A;  5J49 A;  1O23 B;  5CQO A;  1ZJP A;  1YRO B;  3I0D A;  2V0H A;  2X5S A;  3IOH A;  5CQM X;  1ON8 A;  4FRA A;  1W77 A;  3V8Y A;  1FGX A;  3SXG A;  1TVY A;  5C8R A;  2VSH A;  3I0G A;  5DDV A;  1H5S D;  4G3Q A;  4XWI A;  5FU8 A;  2ICX A;  3U2T A;  2YCM A;  4CVH A;  1NKH B;  1QGQ A;  4B2X A;  3JUK A;  3U2U A;  1VZT A;  3OH0 A;  2O1F A;  5C38 A;  1R7T A;  3V0M A;  3E26 A;  1JV3 A;  5CMF X;  2YQS A;  2XWL A;  4C2S A;  3IOI A;  3PKP A;  1H5S C;  4FRQ A;  2E8B A;  2J0A A;  1OMX A;  2WVL A;  2W0W A;  4KXO A;  1ZCU A;  4KC1 A;  5C3D A;  3CKV A;  1ZCT A;  4B4G A;  3JUJ A;  1LZJ A;  4G87 A;  4Y62 A;  3CKJ A;  1ZHJ A;  1WSZ A;  4ECM A;  3ZGF A;  3ZLL A;  1W55 A;  2P6W A;  2PGV A;  1JYK A;  4EEA A;  1R7U A;  1SS9 A;  2AM5 A;  1ZI4 A;  3V91 A;  4ZDQ A;  4CJ8 A;  5HS2 A;  1GX0 A;  1G97 A;  4CJC A;  2VS4 A;  1ZCY A;  2JCJ A;  2RJ0 A;  3Q80 A;  1H5R A;  3I0F A;  5C1L A;  4YS8 A;  2FYC B;  3EE5 A;  3RMV A;  2RIT A;  1G2V A;  3V0O A;  1H5S A;  1HV9 A;  5CMH A;  1MP4 A;  2RIZ A;  2AE7 A;  3SX3 A;  1XZ6 A;  2AM4 A;  4KPZ A;  4CJB A;  2E3D A;  1LL2 A;  4FCU A;  2GGO A;  2JCL A;  1VM8 A;  1R82 A;  1ZI5 A;  4UEG A;  2APC A;  5D92 A;  4HO4 A;  4P00 A;  1NWG B;  1G0R A;  1H7G A;  3CKO A;  4HO9 A;  1TW1 A;  1YP2 A;  1ZI1 A;  1GQC A;  4HO2 A;  1LZ0 A;  2D7I A;  3V0N A;  1GX4 A;  3DUV A;  1JV1 A;  4M28 A;  5EJZ A;  5C3A A;  4D11 C;  1YP4 A;  2XWM A;  4KC2 A;  1JVG A;  5C49 A;  1VGW A;  3IOJ A;  1WT3 A;  3LW6 A;  1G23 A;  4FQW A;  1ZJ2 A;  5EIY A;  1FXO A;  1K4V A;  2XME A;  5AJN A;  2CU2 A;  2X5Z A;  2FY7 A;  1PZT A;  4M4K A;  4EE5 A;  1S4N A;  1H7T A;  2Y4K A;  4Y7V A;  5CMJ A;  2XMH A;  1R7X A;  1FO9 A;  2VXM A;  2Y4L A;  4ASY A;  4FRE A;  3USR A;  4BMA A;  4KNR A;  4Q7C A;  2VFZ A;  1H4C A;  3RMW A;  1ZJ3 A;  3R2W A;  4G3S A;  2Y4M A;  3OH2 A;  3ZGG A;  4Y7T A;  4D11 A;  2RJ5 A;  1FO8 A;  4KPX A;  4FRB A;  5JQQ A;  3OAM A;  2RIX A;  4Y7U A;  5L6V A;  4B4B A;  2RJ9 A;  2X65 A;  2W0V A;  3ZLK A;  4AYL A;  2GGQ A;  4LW6 A;  2X60 A;  4Y64 A;  1LL0 A;  1VGZ A;  1ZDF A;  5L6S A;  4HO6 A;  1WT2 A;  1ZJ0 A;  5C47 A;  1FGG A;  2RIY A;  5BXC A;  1H5T B;  4EEO A;  4FRH A;  2ZU9 A;  4Y9X A;  3T7N A;  4KRV A;  2BO8 A;  1H7L A;  4HO0 A;  5C1G A;  1FRW A;  4FRO A;  1R7V A;  4J18 A;  4B3U A;  4GBP A;  4EEG A;  5C36 A;  1IIN A;  1FG5 N;  2MZB A;  1NMM B;  3TZT A;  1HJL A;  2FFU A;  2D0J A;  1R7Y A;  3PNN A;  3SXC A;  1ZCV A;  1I52 A;  3OH4 A;  2WVM A;  3OC9 A;  4K6R A;  2QGI A;  2QKX A;  3U2X A;  4NAI A;  2FFV A;  4DE7 A;  4KNX A;  3KIA A;  1W57 A;  1NQI B;  2YC3 A;  2FYA A;  3R3I A;  2ICY A;  4MND A;  1H4D A;  1O7O A;  4ASJ A;  4JIS A;  4M2A A;  3V8Z A;  1EYR A;  3SX7 A;  2VS5 A;  2P72 A;  1VH3 A;  2VSI A;  2WAW A;  3E25 A;  1H7F A;  2A8W A;  2RJ1 A;  2YQJ A;  2P73 A;  2OI7 A;  1KWS A;  4LW3 A;  3V0L A;  5EJ1 A;  1MP5 A;  2ZU7 A;  1LZI A;  2BO4 A;  1R81 A;  1MP3 A;  3PKQ A;  2AH9 A;  1S4O A;  2AEC A;  1JVD A;  2YC5 A;  2WVK A;  3O3P A;  2FYD B;  3SXA A;  3K8D A;  3SXB A;  1WT1 A;  2C0N A;  5C4B A;  3U0X A;  3I0E A;  4B5B A;  3CGX A;  3NGW A;  1FR8 A;  5C4F A;  4B4M A;  1G8O A;  1OQM B;  4FRD A;  1FOA A;  1HM8 A;  3FWW A;  1VZX A;  3D8V A;  1GA8 A;  2RJ4 A;  1G9R A;  4Y63 A;  3BRK X;  3OGZ A;  2PA4 A;  3DJ4 A;  1HJJ A;  4R7P A;  1VGU A;  1ZDG A;  2VK9 A;  2YES A;  1V82 A;  1ZJO A;  3D98 A;  4M2B A;  2YQH A;  2OEF A;  2V0K A;  2BO6 A;  4FRP A;  1YP3 A;  3U2W A;  1ZJ1 A;  3SPT A;  5CQP A;  2OI6 A;  4AC3 A;  3Q7U A;  4ARW A;  5I1F A;  3GUE A;  2D7R A;  3V90 A;  1LVW A;  2VS3 A;  1WVC A;  1IIM A;  1HM9 A;  4DEC A;  1E5K A;  2WE9 A;  5AJO A;  1V84 A;  2O1H A;  3K8E A;  1QGS A;  3HL3 A;  3OKR A; 
#chains in the Genus database with same CATH homology
 5FYE A;  4JD0 A;  1GWW A;  4KT7 A;  4MIX A;  5CMI A;  4HO3 A;  4Y7F A;  2YQC A;  2DPW A;  4NAN A;  2I7B A;  4G3P A;  1HM0 A;  2A8U A;  4O6M A;  3I0C A;  3DK5 A;  4DDZ A;  4HOC A;  3TQD A;  2V0J A;  2AGD A;  5IDT A;  2XWN A;  2I5K A;  4EEM A;  2NXV A;  4FCE A;  1FZW A;  1INI A;  1G3L A;  1O0R A;  2RJ7 A;  2V0L A;  1G1L A;  4NAK A;  5IDS A;  1VGT A;  3FOQ A;  3BCV A;  4HO8 A;  1VPA A;  1H7Q A;  4MYB A;  2Y4J A;  3Q4S A;  4KQL A;  3ST8 A;  1VIC A;  2Z86 A;  1H5T A;  5C1H A;  1R80 A;  1XHB A;  3SXD A;  3RSB A;  5FU0 A;  3I0J A;  4D0Z A;  1ON6 A;  3T7O A;  1H5R B;  2I5E A;  4HO5 A;  1ZIZ A;  2RJ6 A;  2Z87 A;  1QG8 A;  2OEG A;  4B2W A;  1O7Q A;  4KC4 A;  4FRM A;  1H5S B;  4AAW A;  4AYJ A;  5C48 A;  1PZY B;  4NAL A;  5FTS A;  5CMG X;  5C4E A;  3I0L A;  5IFY A;  1NHE B;  2OI5 A;  4BQH A;  3SX5 A;  3N9W A;  4D0T A;  1QWJ A;  4FRL A;  1FWY A;  1VH1 A;  2JCK A;  4P02 A;  1GQ9 A;  2AM3 A;  1NF5 B;  1H4E A;  3D5N A;  1FR9 A;  3U0Y A;  1FXJ A;  3I0H A;  2UX8 A;  3OH1 A;  4EE3 A;  2VD4 A;  5CQL X;  1TZF A;  2O1G A;  1JYL A;  3OH3 A;  3POL A;  3CKQ A;  3F1Y A;  4Y6N A;  2RJ8 A;  3SXE A;  3I0I X;  5DDT A;  4D48 A;  1H7E A;  2AES A;  3SX8 A;  1TW5 A;  2BO7 A;  2J0B A;  1EZI A;  3QVB A;  3V0Q A;  1S4P A;  2V0I A;  1MC3 A;  1V83 A;  1GWV A;  1ZI3 A;  2ZU8 A;  4HCQ A;  4O6N A;  4EE4 A;  2Q4J A;  2PX7 A;  3T7M A;  3U2V A;  4FIX A;  5CQN X;  4HG6 A;  3CKN A;  4IRP A;  1LL3 A;  4E1K A;  1G93 A;  5D91 A;  2JCO A;  5FUH A;  2VXL A;  3CU0 A;  4EVW A;  5AJP A;  4IRQ A;  5C3B A;  3F1C A;  3USQ A;  4Y6U A;  3ZF8 A;  2Y7A A;  1H7H A;  1VZU A;  1OMZ A;  5FTV A;  3JTJ A;  1LZ7 A;  4B42 A;  1G95 A;  5C4C A;  5FV9 A;  1H3M A;  2QH5 A;  3V0P A;  2WGZ A;  4FIY A;  2WEE A;  2PGY A;  1WT0 A;  1Z90 A;  3I0K A;  4L41 C;  2FYB A;  4Y7G A;  5C4D A;  2Y6P A;  1INJ A;  5J49 A;  1O23 B;  5CQO A;  1ZJP A;  1YRO B;  3I0D A;  2V0H A;  2X5S A;  3IOH A;  5CQM X;  1ON8 A;  4FRA A;  1W77 A;  3V8Y A;  1FGX A;  3SXG A;  1TVY A;  5C8R A;  2VSH A;  3I0G A;  5DDV A;  1H5S D;  4G3Q A;  4XWI A;  5FU8 A;  2ICX A;  3U2T A;  2YCM A;  4CVH A;  1NKH B;  1QGQ A;  4B2X A;  3JUK A;  3U2U A;  1VZT A;  3OH0 A;  2O1F A;  5C38 A;  1R7T A;  3V0M A;  3E26 A;  1JV3 A;  5CMF X;  2YQS A;  2XWL A;  4C2S A;  3IOI A;  3PKP A;  1H5S C;  4FRQ A;  2E8B A;  2J0A A;  1OMX A;  2WVL A;  2W0W A;  4KXO A;  1ZCU A;  4KC1 A;  5C3D A;  3CKV A;  1ZCT A;  4B4G A;  3JUJ A;  1LZJ A;  4G87 A;  4Y62 A;  3CKJ A;  1ZHJ A;  1WSZ A;  4ECM A;  3ZGF A;  3ZLL A;  1W55 A;  2P6W A;  2PGV A;  1JYK A;  4EEA A;  1R7U A;  1SS9 A;  2AM5 A;  1ZI4 A;  3V91 A;  4ZDQ A;  4CJ8 A;  5HS2 A;  1GX0 A;  1G97 A;  4CJC A;  2VS4 A;  1ZCY A;  2JCJ A;  2RJ0 A;  3Q80 A;  1H5R A;  3I0F A;  5C1L A;  4YS8 A;  2FYC B;  3EE5 A;  3RMV A;  2RIT A;  1G2V A;  3V0O A;  1H5S A;  1HV9 A;  5CMH A;  1MP4 A;  2RIZ A;  2AE7 A;  3SX3 A;  1XZ6 A;  2AM4 A;  4KPZ A;  4CJB A;  2E3D A;  1LL2 A;  4FCU A;  2GGO A;  2JCL A;  1VM8 A;  1R82 A;  1ZI5 A;  4UEG A;  2APC A;  5D92 A;  4HO4 A;  4P00 A;  1NWG B;  1G0R A;  1H7G A;  3CKO A;  4HO9 A;  1TW1 A;  1YP2 A;  1ZI1 A;  1GQC A;  4HO2 A;  1LZ0 A;  2D7I A;  3V0N A;  1GX4 A;  3DUV A;  1JV1 A;  4M28 A;  5EJZ A;  5C3A A;  4D11 C;  1YP4 A;  2XWM A;  4KC2 A;  1JVG A;  5C49 A;  1VGW A;  3IOJ A;  1WT3 A;  3LW6 A;  1G23 A;  4FQW A;  1ZJ2 A;  5EIY A;  1FXO A;  1K4V A;  2XME A;  5AJN A;  2CU2 A;  2X5Z A;  2FY7 A;  1PZT A;  4M4K A;  4EE5 A;  1S4N A;  1H7T A;  2Y4K A;  4Y7V A;  5CMJ A;  2XMH A;  1R7X A;  1FO9 A;  2VXM A;  2Y4L A;  4ASY A;  4FRE A;  3USR A;  4BMA A;  4KNR A;  4Q7C A;  2VFZ A;  1H4C A;  3RMW A;  1ZJ3 A;  3R2W A;  4G3S A;  2Y4M A;  3OH2 A;  3ZGG A;  4Y7T A;  4D11 A;  2RJ5 A;  1FO8 A;  4KPX A;  4FRB A;  5JQQ A;  3OAM A;  2RIX A;  4Y7U A;  5L6V A;  4B4B A;  2RJ9 A;  2X65 A;  2W0V A;  3ZLK A;  4AYL A;  2GGQ A;  4LW6 A;  2X60 A;  4Y64 A;  1LL0 A;  1VGZ A;  1ZDF A;  5L6S A;  4HO6 A;  1WT2 A;  1ZJ0 A;  5C47 A;  1FGG A;  2RIY A;  5BXC A;  1H5T B;  4EEO A;  4FRH A;  2ZU9 A;  4Y9X A;  3T7N A;  4KRV A;  2BO8 A;  1H7L A;  4HO0 A;  5C1G A;  1FRW A;  4FRO A;  1R7V A;  4J18 A;  4B3U A;  4GBP A;  4EEG A;  5C36 A;  1IIN A;  1FG5 N;  2MZB A;  1NMM B;  3TZT A;  1HJL A;  2FFU A;  2D0J A;  1R7Y A;  3PNN A;  3SXC A;  1ZCV A;  1I52 A;  3OH4 A;  2WVM A;  3OC9 A;  4K6R A;  2QGI A;  2QKX A;  3U2X A;  4NAI A;  2FFV A;  4DE7 A;  4KNX A;  3KIA A;  1W57 A;  1NQI B;  2YC3 A;  2FYA A;  3R3I A;  2ICY A;  4MND A;  1H4D A;  1O7O A;  4ASJ A;  4JIS A;  4M2A A;  3V8Z A;  1EYR A;  3SX7 A;  2VS5 A;  2P72 A;  1VH3 A;  2VSI A;  2WAW A;  3E25 A;  1H7F A;  2A8W A;  2RJ1 A;  2YQJ A;  2P73 A;  2OI7 A;  1KWS A;  4LW3 A;  3V0L A;  5EJ1 A;  1MP5 A;  2ZU7 A;  1LZI A;  2BO4 A;  1R81 A;  1MP3 A;  3PKQ A;  2AH9 A;  1S4O A;  2AEC A;  1JVD A;  2YC5 A;  2WVK A;  3O3P A;  2FYD B;  3SXA A;  3K8D A;  3SXB A;  1WT1 A;  2C0N A;  5C4B A;  3U0X A;  3I0E A;  4B5B A;  3CGX A;  3NGW A;  1FR8 A;  5C4F A;  4B4M A;  1G8O A;  1OQM B;  4FRD A;  1FOA A;  1HM8 A;  3FWW A;  1VZX A;  3D8V A;  1GA8 A;  2RJ4 A;  1G9R A;  4Y63 A;  3BRK X;  3OGZ A;  2PA4 A;  3DJ4 A;  1HJJ A;  4R7P A;  1VGU A;  1ZDG A;  2VK9 A;  2YES A;  1V82 A;  1ZJO A;  3D98 A;  4M2B A;  2YQH A;  2OEF A;  2V0K A;  2BO6 A;  4FRP A;  1YP3 A;  3U2W A;  1ZJ1 A;  3SPT A;  5CQP A;  2OI6 A;  4AC3 A;  3Q7U A;  4ARW A;  5I1F A;  3GUE A;  2D7R A;  3V90 A;  1LVW A;  2VS3 A;  1WVC A;  1IIM A;  1HM9 A;  4DEC A;  1E5K A;  2WE9 A;  5AJO A;  1V84 A;  2O1H A;  3K8E A;  1QGS A;  3HL3 A;  3OKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...