2RJ4A

B-specific alpha-1,3-galactosyltransferase \ g176r +udp+ada
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
291
structure length
290
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycoprotein-fucosylgalactoside alpha-galactosyltransferase
publication title ABO(H) blood group A and B glycosyltransferases recognize substrate via specific conformational changes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 290
sequence length 291
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2007-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2rj4A00
5CQPA 1H7LA 2D7RA 2FFUA 5DDVA 3RMWA 1NWGB 2X60A 5FU8A 2JCKA 4KXOA 3RMVA 2Z87A 3V91A 4C2SA 3ZGGA 1G2VA 1WT2A 3ST8A 5AJPA 1GQ9A 3U0XA 4LW6A 3E26A 1G95A 2FYCB 3V8YA 4G3SA 3IOIA 1LL2A 3JTJA 2AM5A 1NF5B 2WVLA 1R7YA 2Y4KA 2Y4JA 1G0RA 4FQWA 4FRAA 2RJ8A 5J49A 3EE5A 1MP4A 3R3IA 4Y7GA 4ARWA 4P02A 2OI6A 3D5NA 4Y7UA 2D0JA 3ZGFA 1G9RA 2P73A 5IDTA 3SXCA 1HM8A 2APCA 4IRPA 3U0YA 1R81A 3U2XA 4Y7FA 3I0DA 4ASYA 2RJ5A 4Y7TA 1FWYA 1JVGA 1YROB 1V82A 5CQLX 4Y6UA 3TZTA 1OQMB 1HV9A 1H4DA 1QG8A 2VSIA 1NMMB 5CQOA 4EEOA 1G23A 4FREA 3V0QA 2AESA 2X5ZA 2YQHA 1O7OA 1EZIA 3TQDA 5C4BA 5HS2A 1ZI4A 3POLA 5C3AA 4B42A 1HJJA 2A8WA 2BO4A 3CKVA 2PX7A 3T7NA 4KRVA 4LW3A 4FRHA 3CKNA 4M4KA 3V0LA 3FWWA 2AE7A 3Q7UA 2V0JA 1IIMA 5C4EA 5CMJA 4AYLA 4FROA 1G8OA 2VXMA 5C47A 5C48A 4FCEA 2ZU8A 1VM8A 3SXEA 2WE9A 1ZJ3A 3DJ4A 4HO6A 3OH3A 4FRPA 2GGQA 1H4CA 1INIA 3DK5A 3T7MA 4D0ZA 2I5EA 3V0MA 4DECA 2YC3A 3U2TA 4B3UA 1IINA 5AJNA 3SX5A 2AM3A 3V8ZA 4Y62A 3E25A 4KPZA 5C4DA 2WGZA 3RSBA 2VXLA 2QGIA 1GWWA 1LL0A 2RJ0A 3NGWA 4D11C 3USRA 2W0VA 2PGVA 2GGOA 5JQQA 5CMIA 2NXVA 2O1HA 1ZHJA 1TZFA 5EJZA 1QWJA 2OI7A 4NAKA 1VGUA 2V0KA 4ASJA 3QVBA 1PZYB 2QKXA 1FOAA 2W0WA 5AJOA 5L6SA 2YCMA 4G3PA 2P72A 3N9WA 1GX0A 3I0GA 3LW6A 4E1KA 1VH1A 4FRMA 1FO9A 1V83A 4CJCA 3Q80A 1OMXA 2JCLA 3KIAA 4D48A 2XMHA 2Y6PA 1FGXA 2ICXA 4IRQA 2WVMA 2VD4A 1QGQA 1MP3A 1JVDA 4AC3A 1FO8A 2FFVA 1VGTA 2BO8A 3PKQA 4AAWA 2VS3A 3OH2A 1FZWA 1GWVA 4HG6A 2Y7AA 1G93A 3U2UA 4EEGA 4KC4A 4KNXA 5CQNX 1E5KA 1O23B 4D11A 4EEMA 2YESA 3OH4A 1YP4A 3O3PA 1O0RA 2DPWA 1OMZA 2OEFA 4XWIA 1S4PA 2AECA 2XWMA 3SX7A 1VGZA 4EE4A 2FYDB 1ON8A 2RITA 2VFZA 4JD0A 2Y4LA 1SS9A 4YS8A 5FV9A 1R82A 1FXOA 2YQJA 4KQLA 4G87A 5C4CA 2VSHA 4UEGA 5C1LA 3CGXA 3CKJA 5I1FA 1YP2A 3DUVA 1K4VA 5IFYA 1KWSA 1NQIB 1ZCUA 4KT7A 3IOJA 3OH1A 1ZJOA 4FRDA 1VZUA 1R7UA 3ZLLA 2BO7A 2RIYA 3HL3A 1S4OA 2P6WA 3SXDA 5BXCA 2E3DA 3V0OA 2YQSA 1O7QA 4MYBA 4NAIA 1GQCA 5FTSA 1PZTA 2AH9A 1H7QA 1NHEB 2Q4JA 4K6RA 2X5SA 1ZDFA 5IDSA 3V0NA 4B4GA 1R80A 3CKQA 5FYEA 1ON6A 1R7VA 2ZU7A 3PKPA 1LVWA 1W57A 1VICA 1G1LA 1WT0A 1VGWA 2YC5A 3D98A 2ICYA 2XWNA 3I0FA 1FG5N 1ZJ0A 5C1GA 1JYKA 2OI5A 1V84A 1FXJA 1G97A 1ZI1A 1H5SC 1VH3A 3PNNA 4ECMA 3IOHA 4ZDQA 5C38A 2A8UA 1JV3A 5CQMX 4HCQA 2UX8A 3T7OA 1ZCTA 3CKOA 1ZIZA 1HJLA 1ZI3A 4Y64A 3OH0A 3OGZA 1S4NA 2WAWA 3OKRA 4CJ8A 4AYJA 3SXAA 1HM9A 4HO0A 4G3QA 3I0IX 5FU0A 5CMGX 4HO3A 3SX3A 2D7IA 5FTVA 4HOCA 4BQHA 4BMAA 2PA4A 1MC3A 2I7BA 2RIXA 1H4EA 1LL3A 3GUEA 4EEAA 1FRWA 5DDTA 1H5TA 3D8VA 3I0KA 1H7FA 1JYLA 2E8BA 1VZXA 1TW1A 3ZLKA 1TVYA 5CMFX 2X65A 1TW5A 1H3MA 1WT3A 1ZI5A 4P00A 1VZTA 1H5RA 5EIYA 4EE3A 2RJ7A 3K8EA 2V0IA 3USQA 2FYAA 4HO5A 4FRQA 1GA8A 2RIZA 2JCJA 2ZU9A 3BRKX 4D0TA 2VS4A 1LZIA 2WEEA 3I0CA 3Q4SA 3SX8A 5L6VA 2WVKA 4KC1A 3I0LA 4L41C 1VPAA 3OAMA 4DDZA 2RJ6A 3I0HA 5C49A 1ZJPA 1H5SA 4B4MA 2MZBA 1W55A 2QH5A 4FCUA 3SPTA 3U2WA 1NKHB 2VS5A 5C3BA 1ZCVA 2O1FA 2I5KA 3R2WA 1Z90A 3F1YA 1YP3A 3CU0A 1I52A 1WSZA 4NANA 4KC2A 4JISA 3F1CA 1H5TB 2Z86A 4HO2A 1FR9A 2AGDA 4FRLA 2RJ9A 4KPXA 4MNDA 2AM4A 1W77A 1LZ0A 1WVCA 1H5RB 3SXGA 4CJBA 4B4BA 1G3LA 2XMEA 1R7XA 3I0EA 2FY7A 4B2WA 1JV1A 1R7TA 4HO4A 5C36A 3FOQA 4M2AA 1H7EA 1INJA 4B2XA 2YQCA 3U2VA 4B5BA 5C8RA 1MP5A 2XWLA 3ZF8A 2RJ4A 4Y63A 1FGGA 2V0HA 4Y6NA 4GBPA 2RJ1A 1H5SB 4CVHA 2Y4MA 1GX4A 4DE7A 3K8DA 4Y9XA 1FR8A 4Y7VA 1ZCYA 2V0LA 4KNRA 4M28A 4R7PA 1LZJA 1ZJ2A 5FUHA 5C4FA 1EYRA 3JUJA 2BO6A 2OEGA 2PGYA 3OC9A 3V0PA 3JUKA 3I0JA 4HO8A 1QGSA 2CU2A 4J18A 5CMHA 3V90A 4EE5A 5EJ1A 2FYBA 4HO9A 1ZDGA 1WT1A 1H7TA 3BCVA 4NALA 1HM0A 1XHBA 4EVWA 1H7HA 4M2BA 1XZ6A 1ZJ1A 5C1HA 1LZ7A 1H7GA 4FRBA 2JCOA 3SXBA 1H5SD 5C3DA 2O1GA
chains in the Genus database with same CATH superfamily
5CQPA 1H7LA 2D7RA 2FFUA 5DDVA 3RMWA 1NWGB 2X60A 5FU8A 2JCKA 4KXOA 3RMVA 2Z87A 3V91A 4C2SA 3ZGGA 1G2VA 1WT2A 3ST8A 5AJPA 1GQ9A 3U0XA 4LW6A 3E26A 1G95A 2FYCB 3V8YA 4G3SA 3IOIA 1LL2A 3JTJA 2AM5A 1NF5B 2WVLA 1R7YA 2Y4KA 2Y4JA 1G0RA 4FQWA 4FRAA 2RJ8A 5J49A 3EE5A 1MP4A 3R3IA 4Y7GA 4FIYA 4ARWA 4P02A 2OI6A 3D5NA 4Y7UA 2D0JA 3ZGFA 1G9RA 2P73A 5IDTA 3SXCA 1HM8A 2APCA 4IRPA 3U0YA 1R81A 3U2XA 4Y7FA 3I0DA 4ASYA 2RJ5A 4Y7TA 1FWYA 1JVGA 1YROB 1V82A 5CQLX 4Y6UA 3TZTA 1OQMB 1HV9A 1H4DA 1QG8A 2VSIA 1NMMB 5CQOA 4EEOA 1G23A 4FREA 3V0QA 2AESA 2X5ZA 2YQHA 1O7OA 1EZIA 3TQDA 5C4BA 5HS2A 1ZI4A 3POLA 5C3AA 4B42A 1HJJA 2A8WA 2BO4A 3CKVA 2PX7A 3T7NA 4KRVA 4LW3A 4FRHA 3CKNA 4M4KA 3V0LA 3FWWA 2AE7A 3Q7UA 2V0JA 1IIMA 5C4EA 5CMJA 4AYLA 4FROA 2VK9A 1G8OA 2VXMA 5C47A 5C48A 4FCEA 2ZU8A 1VM8A 3SXEA 2WE9A 1ZJ3A 3DJ4A 4HO6A 3OH3A 4FRPA 2GGQA 1H4CA 1INIA 3DK5A 3T7MA 4D0ZA 2I5EA 3V0MA 4DECA 2YC3A 3U2TA 4B3UA 1IINA 5AJNA 3SX5A 2AM3A 3V8ZA 4Y62A 3E25A 4KPZA 5C4DA 2WGZA 3RSBA 2VXLA 2QGIA 1GWWA 1LL0A 2RJ0A 3NGWA 4D11C 3USRA 2W0VA 2PGVA 2GGOA 5JQQA 5CMIA 2NXVA 4MIXA 2O1HA 1ZHJA 1TZFA 5EJZA 1QWJA 2OI7A 4NAKA 1VGUA 2V0KA 4ASJA 3QVBA 1PZYB 2QKXA 1FOAA 2W0WA 5AJOA 5L6SA 2YCMA 4G3PA 2P72A 3N9WA 1GX0A 3I0GA 3LW6A 4E1KA 1VH1A 4FRMA 1FO9A 1V83A 4CJCA 3Q80A 1OMXA 2JCLA 3KIAA 4D48A 2XMHA 2Y6PA 1FGXA 2ICXA 4IRQA 2WVMA 2VD4A 1QGQA 4O6MA 1MP3A 1JVDA 4AC3A 1FO8A 2FFVA 1VGTA 2BO8A 3PKQA 4AAWA 2VS3A 3OH2A 1FZWA 1GWVA 4HG6A 2Y7AA 1G93A 3U2UA 4EEGA 4KC4A 4KNXA 5CQNX 1E5KA 1O23B 4D11A 4EEMA 2YESA 3OH4A 1YP4A 3O3PA 1O0RA 2DPWA 1OMZA 2OEFA 4XWIA 1S4PA 2AECA 2XWMA 3SX7A 1VGZA 5D91A 4EE4A 2FYDB 1ON8A 2RITA 2VFZA 4JD0A 2Y4LA 1SS9A 4YS8A 5FV9A 1R82A 1FXOA 2YQJA 4KQLA 4G87A 5C4CA 2VSHA 4UEGA 5C1LA 3CGXA 3CKJA 5I1FA 1YP2A 3DUVA 1K4VA 5IFYA 1KWSA 1NQIB 1ZCUA 4KT7A 3IOJA 3OH1A 1ZJOA 4FRDA 1VZUA 1R7UA 3ZLLA 2BO7A 2RIYA 3HL3A 1S4OA 2P6WA 3SXDA 5BXCA 2E3DA 3V0OA 2YQSA 1O7QA 4MYBA 4NAIA 1GQCA 5FTSA 1PZTA 2AH9A 2J0BA 1H7QA 1NHEB 2Q4JA 4K6RA 2X5SA 1ZDFA 5IDSA 3V0NA 4B4GA 1R80A 3CKQA 4Q7CA 5FYEA 1ON6A 1R7VA 2ZU7A 3PKPA 1LVWA 1W57A 1VICA 1G1LA 1WT0A 1VGWA 2YC5A 3D98A 2ICYA 2XWNA 3I0FA 1FG5N 1ZJ0A 5C1GA 1JYKA 2OI5A 1V84A 1FXJA 1G97A 1ZI1A 1H5SC 1VH3A 3PNNA 4ECMA 3IOHA 4ZDQA 5C38A 2A8UA 1JV3A 5CQMX 4HCQA 2UX8A 3T7OA 1ZCTA 3CKOA 1ZIZA 1HJLA 1ZI3A 4Y64A 3OH0A 3OGZA 1S4NA 2WAWA 3OKRA 4CJ8A 4AYJA 3SXAA 1HM9A 4HO0A 4G3QA 3I0IX 5FU0A 5CMGX 4HO3A 3SX3A 2D7IA 5FTVA 4HOCA 4BQHA 4BMAA 2PA4A 1MC3A 2I7BA 2RIXA 1H4EA 1LL3A 5D92A 3GUEA 4EEAA 1FRWA 5DDTA 1H5TA 3D8VA 3I0KA 1H7FA 1JYLA 2E8BA 1VZXA 1TW1A 3ZLKA 1TVYA 5CMFX 2X65A 1TW5A 1H3MA 1WT3A 1ZI5A 4P00A 1VZTA 1H5RA 5EIYA 4EE3A 2RJ7A 3K8EA 2V0IA 3USQA 2FYAA 4HO5A 4FRQA 1GA8A 2RIZA 2JCJA 2ZU9A 3BRKX 4D0TA 2VS4A 1LZIA 2WEEA 3I0CA 3Q4SA 3SX8A 5L6VA 2WVKA 4KC1A 3I0LA 4L41C 1VPAA 3OAMA 4DDZA 2RJ6A 3I0HA 5C49A 1ZJPA 1H5SA 4B4MA 2MZBA 1W55A 2QH5A 4FCUA 3SPTA 3U2WA 1NKHB 2VS5A 5C3BA 1ZCVA 2O1FA 2I5KA 3R2WA 1Z90A 3F1YA 1YP3A 3CU0A 1I52A 2C0NA 1WSZA 4NANA 4KC2A 4JISA 3F1CA 1H5TB 2Z86A 4HO2A 1FR9A 2AGDA 4FRLA 2RJ9A 4KPXA 4MNDA 2AM4A 1W77A 1LZ0A 1WVCA 1H5RB 3SXGA 4CJBA 4B4BA 1G3LA 2XMEA 1R7XA 3I0EA 2FY7A 4B2WA 1JV1A 1R7TA 4HO4A 5C36A 3FOQA 4M2AA 1H7EA 1INJA 4B2XA 2YQCA 3U2VA 4B5BA 5C8RA 1MP5A 2XWLA 3ZF8A 2RJ4A 4Y63A 1FGGA 2V0HA 4Y6NA 4GBPA 2RJ1A 2J0AA 1H5SB 4CVHA 2Y4MA 1GX4A 4DE7A 3K8DA 4Y9XA 1FR8A 4Y7VA 1ZCYA 2V0LA 4KNRA 4M28A 4R7PA 1LZJA 1ZJ2A 5FUHA 5C4FA 1EYRA 3JUJA 2BO6A 2OEGA 2PGYA 3OC9A 4FIXA 4O6NA 3V0PA 3JUKA 3I0JA 4HO8A 1QGSA 2CU2A 4J18A 5CMHA 3V90A 4EE5A 5EJ1A 2FYBA 4HO9A 1ZDGA 1WT1A 1H7TA 3BCVA 4NALA 1HM0A 1XHBA 4EVWA 1H7HA 4M2BA 1XZ6A 1ZJ1A 5C1HA 1LZ7A 1H7GA 4FRBA 2JCOA 3SXBA 1H5SD 5C3DA 2O1GA
chains in the Genus database with same CATH topology
5CQPA 1H7LA 2D7RA 2FFUA 5DDVA 3RMWA 1NWGB 2X60A 5FU8A 2JCKA 4KXOA 3RMVA 2Z87A 3V91A 4C2SA 3ZGGA 1G2VA 1WT2A 3ST8A 5AJPA 1GQ9A 3U0XA 4LW6A 3E26A 1G95A 2FYCB 3V8YA 4G3SA 3IOIA 1LL2A 3JTJA 2AM5A 1NF5B 2WVLA 1R7YA 2Y4KA 2Y4JA 1G0RA 4FQWA 4FRAA 2RJ8A 5J49A 3EE5A 1MP4A 3R3IA 4Y7GA 4FIYA 4ARWA 4P02A 2OI6A 3D5NA 4Y7UA 2D0JA 3ZGFA 1G9RA 2P73A 5IDTA 3SXCA 1HM8A 2APCA 4IRPA 3U0YA 1R81A 3U2XA 4Y7FA 3I0DA 4ASYA 2RJ5A 4Y7TA 1FWYA 1JVGA 1YROB 1V82A 5CQLX 4Y6UA 3TZTA 1OQMB 1HV9A 1H4DA 1QG8A 2VSIA 1NMMB 5CQOA 4EEOA 1G23A 4FREA 3V0QA 2AESA 2X5ZA 2YQHA 1O7OA 1EZIA 3TQDA 5C4BA 5HS2A 1ZI4A 3POLA 5C3AA 4B42A 1HJJA 2A8WA 2BO4A 3CKVA 2PX7A 3T7NA 4KRVA 4LW3A 4FRHA 3CKNA 4M4KA 3V0LA 3FWWA 2AE7A 3Q7UA 2V0JA 1IIMA 5C4EA 5CMJA 4AYLA 4FROA 2VK9A 1G8OA 2VXMA 5C47A 5C48A 4FCEA 2ZU8A 1VM8A 3SXEA 2WE9A 1ZJ3A 3DJ4A 4HO6A 3OH3A 4FRPA 2GGQA 1H4CA 1INIA 3DK5A 3T7MA 4D0ZA 2I5EA 3V0MA 4DECA 2YC3A 3U2TA 4B3UA 1IINA 5AJNA 3SX5A 2AM3A 3V8ZA 4Y62A 3E25A 4KPZA 5C4DA 2WGZA 3RSBA 2VXLA 2QGIA 1GWWA 1LL0A 2RJ0A 3NGWA 4D11C 3USRA 2W0VA 2PGVA 2GGOA 5JQQA 5CMIA 2NXVA 4MIXA 2O1HA 1ZHJA 1TZFA 5EJZA 1QWJA 2OI7A 4NAKA 1VGUA 2V0KA 4ASJA 3QVBA 1PZYB 2QKXA 1FOAA 2W0WA 5AJOA 5L6SA 2YCMA 4G3PA 2P72A 3N9WA 1GX0A 3I0GA 3LW6A 4E1KA 1VH1A 4FRMA 1FO9A 1V83A 4CJCA 3Q80A 1OMXA 2JCLA 3KIAA 4D48A 2XMHA 2Y6PA 1FGXA 2ICXA 4IRQA 2WVMA 2VD4A 1QGQA 4O6MA 1MP3A 1JVDA 4AC3A 1FO8A 2FFVA 1VGTA 2BO8A 3PKQA 4AAWA 2VS3A 3OH2A 1FZWA 1GWVA 4HG6A 2Y7AA 1G93A 3U2UA 4EEGA 4KC4A 4KNXA 5CQNX 1E5KA 1O23B 4D11A 4EEMA 2YESA 3OH4A 1YP4A 3O3PA 1O0RA 2DPWA 1OMZA 2OEFA 4XWIA 1S4PA 2AECA 2XWMA 3SX7A 1VGZA 5D91A 4EE4A 2FYDB 1ON8A 2RITA 2VFZA 4JD0A 2Y4LA 1SS9A 4YS8A 5FV9A 1R82A 1FXOA 2YQJA 4KQLA 4G87A 5C4CA 2VSHA 4UEGA 5C1LA 3CGXA 3CKJA 5I1FA 1YP2A 3DUVA 1K4VA 5IFYA 1KWSA 1NQIB 1ZCUA 4KT7A 3IOJA 3OH1A 1ZJOA 4FRDA 1VZUA 1R7UA 3ZLLA 2BO7A 2RIYA 3HL3A 1S4OA 2P6WA 3SXDA 5BXCA 2E3DA 3V0OA 2YQSA 1O7QA 4MYBA 4NAIA 1GQCA 5FTSA 1PZTA 2AH9A 2J0BA 1H7QA 1NHEB 2Q4JA 4K6RA 2X5SA 1ZDFA 5IDSA 3V0NA 4B4GA 1R80A 3CKQA 4Q7CA 5FYEA 1ON6A 1R7VA 2ZU7A 3PKPA 1LVWA 1W57A 1VICA 1G1LA 1WT0A 1VGWA 2YC5A 3D98A 2ICYA 2XWNA 3I0FA 1FG5N 1ZJ0A 5C1GA 1JYKA 2OI5A 1V84A 1FXJA 1G97A 1ZI1A 1H5SC 1VH3A 3PNNA 4ECMA 3IOHA 4ZDQA 5C38A 2A8UA 1JV3A 5CQMX 4HCQA 2UX8A 3T7OA 1ZCTA 3CKOA 1ZIZA 1HJLA 1ZI3A 4Y64A 3OH0A 3OGZA 1S4NA 2WAWA 3OKRA 4CJ8A 4AYJA 3SXAA 1HM9A 4HO0A 4G3QA 3I0IX 5FU0A 5CMGX 4HO3A 3SX3A 2D7IA 5FTVA 4HOCA 4BQHA 4BMAA 2PA4A 1MC3A 2I7BA 2RIXA 1H4EA 1LL3A 5D92A 3GUEA 4EEAA 1FRWA 5DDTA 1H5TA 3D8VA 3I0KA 1H7FA 1JYLA 2E8BA 1VZXA 1TW1A 3ZLKA 1TVYA 5CMFX 2X65A 1TW5A 1H3MA 1WT3A 1ZI5A 4P00A 1VZTA 1H5RA 5EIYA 4EE3A 2RJ7A 3K8EA 2V0IA 3USQA 2FYAA 4HO5A 4FRQA 1GA8A 2RIZA 2JCJA 2ZU9A 3BRKX 4D0TA 2VS4A 1LZIA 2WEEA 3I0CA 3Q4SA 3SX8A 5L6VA 2WVKA 4KC1A 3I0LA 4L41C 1VPAA 3OAMA 4DDZA 2RJ6A 3I0HA 5C49A 1ZJPA 1H5SA 4B4MA 2MZBA 1W55A 2QH5A 4FCUA 3SPTA 3U2WA 1NKHB 2VS5A 5C3BA 1ZCVA 2O1FA 2I5KA 3R2WA 1Z90A 3F1YA 1YP3A 3CU0A 1I52A 2C0NA 1WSZA 4NANA 4KC2A 4JISA 3F1CA 1H5TB 2Z86A 4HO2A 1FR9A 2AGDA 4FRLA 2RJ9A 4KPXA 4MNDA 2AM4A 1W77A 1LZ0A 1WVCA 1H5RB 3SXGA 4CJBA 4B4BA 1G3LA 2XMEA 1R7XA 3I0EA 2FY7A 4B2WA 1JV1A 1R7TA 4HO4A 5C36A 3FOQA 4M2AA 1H7EA 1INJA 4B2XA 2YQCA 3U2VA 4B5BA 5C8RA 1MP5A 2XWLA 3ZF8A 2RJ4A 4Y63A 1FGGA 2V0HA 4Y6NA 4GBPA 2RJ1A 2J0AA 1H5SB 4CVHA 2Y4MA 1GX4A 4DE7A 3K8DA 4Y9XA 1FR8A 4Y7VA 1ZCYA 2V0LA 4KNRA 4M28A 4R7PA 1LZJA 1ZJ2A 5FUHA 5C4FA 1EYRA 3JUJA 2BO6A 2OEGA 2PGYA 3OC9A 4FIXA 4O6NA 3V0PA 3JUKA 3I0JA 4HO8A 1QGSA 2CU2A 4J18A 5CMHA 3V90A 4EE5A 5EJ1A 2FYBA 4HO9A 1ZDGA 1WT1A 1H7TA 3BCVA 4NALA 1HM0A 1XHBA 4EVWA 1H7HA 4M2BA 1XZ6A 1ZJ1A 5C1HA 1LZ7A 1H7GA 4FRBA 2JCOA 3SXBA 1H5SD 5C3DA 2O1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CQP A;  1H7L A;  2D7R A;  2FFU A;  5DDV A;  3RMW A;  1NWG B;  2X60 A;  5FU8 A;  2JCK A;  4KXO A;  3RMV A;  2Z87 A;  3V91 A;  4C2S A;  3ZGG A;  1G2V A;  1WT2 A;  3ST8 A;  5AJP A;  1GQ9 A;  3U0X A;  4LW6 A;  3E26 A;  1G95 A;  2FYC B;  3V8Y A;  4G3S A;  3IOI A;  1LL2 A;  3JTJ A;  2AM5 A;  1NF5 B;  2WVL A;  1R7Y A;  2Y4K A;  2Y4J A;  1G0R A;  4FQW A;  4FRA A;  2RJ8 A;  5J49 A;  3EE5 A;  1MP4 A;  3R3I A;  4Y7G A;  4ARW A;  4P02 A;  2OI6 A;  3D5N A;  4Y7U A;  2D0J A;  3ZGF A;  1G9R A;  2P73 A;  5IDT A;  3SXC A;  1HM8 A;  2APC A;  4IRP A;  3U0Y A;  1R81 A;  3U2X A;  4Y7F A;  3I0D A;  4ASY A;  2RJ5 A;  4Y7T A;  1FWY A;  1JVG A;  1YRO B;  1V82 A;  5CQL X;  4Y6U A;  3TZT A;  1OQM B;  1HV9 A;  1H4D A;  1QG8 A;  2VSI A;  1NMM B;  5CQO A;  4EEO A;  1G23 A;  4FRE A;  3V0Q A;  2AES A;  2X5Z A;  2YQH A;  1O7O A;  1EZI A;  3TQD A;  5C4B A;  5HS2 A;  1ZI4 A;  3POL A;  5C3A A;  4B42 A;  1HJJ A;  2A8W A;  2BO4 A;  3CKV A;  2PX7 A;  3T7N A;  4KRV A;  4LW3 A;  4FRH A;  3CKN A;  4M4K A;  3V0L A;  3FWW A;  2AE7 A;  3Q7U A;  2V0J A;  1IIM A;  5C4E A;  5CMJ A;  4AYL A;  4FRO A;  1G8O A;  2VXM A;  5C47 A;  5C48 A;  4FCE A;  2ZU8 A;  1VM8 A;  3SXE A;  2WE9 A;  1ZJ3 A;  3DJ4 A;  4HO6 A;  3OH3 A;  4FRP A;  2GGQ A;  1H4C A;  1INI A;  3DK5 A;  3T7M A;  4D0Z A;  2I5E A;  3V0M A;  4DEC A;  2YC3 A;  3U2T A;  4B3U A;  1IIN A;  5AJN A;  3SX5 A;  2AM3 A;  3V8Z A;  4Y62 A;  3E25 A;  4KPZ A;  5C4D A;  2WGZ A;  3RSB A;  2VXL A;  2QGI A;  1GWW A;  1LL0 A;  2RJ0 A;  3NGW A;  4D11 C;  3USR A;  2W0V A;  2PGV A;  2GGO A;  5JQQ A;  5CMI A;  2NXV A;  2O1H A;  1ZHJ A;  1TZF A;  5EJZ A;  1QWJ A;  2OI7 A;  4NAK A;  1VGU A;  2V0K A;  4ASJ A;  3QVB A;  1PZY B;  2QKX A;  1FOA A;  2W0W A;  5AJO A;  5L6S A;  2YCM A;  4G3P A;  2P72 A;  3N9W A;  1GX0 A;  3I0G A;  3LW6 A;  4E1K A;  1VH1 A;  4FRM A;  1FO9 A;  1V83 A;  4CJC A;  3Q80 A;  1OMX A;  2JCL A;  3KIA A;  4D48 A;  2XMH A;  2Y6P A;  1FGX A;  2ICX A;  4IRQ A;  2WVM A;  2VD4 A;  1QGQ A;  1MP3 A;  1JVD A;  4AC3 A;  1FO8 A;  2FFV A;  1VGT A;  2BO8 A;  3PKQ A;  4AAW A;  2VS3 A;  3OH2 A;  1FZW A;  1GWV A;  4HG6 A;  2Y7A A;  1G93 A;  3U2U A;  4EEG A;  4KC4 A;  4KNX A;  5CQN X;  1E5K A;  1O23 B;  4D11 A;  4EEM A;  2YES A;  3OH4 A;  1YP4 A;  3O3P A;  1O0R A;  2DPW A;  1OMZ A;  2OEF A;  4XWI A;  1S4P A;  2AEC A;  2XWM A;  3SX7 A;  1VGZ A;  4EE4 A;  2FYD B;  1ON8 A;  2RIT A;  2VFZ A;  4JD0 A;  2Y4L A;  1SS9 A;  4YS8 A;  5FV9 A;  1R82 A;  1FXO A;  2YQJ A;  4KQL A;  4G87 A;  5C4C A;  2VSH A;  4UEG A;  5C1L A;  3CGX A;  3CKJ A;  5I1F A;  1YP2 A;  3DUV A;  1K4V A;  5IFY A;  1KWS A;  1NQI B;  1ZCU A;  4KT7 A;  3IOJ A;  3OH1 A;  1ZJO A;  4FRD A;  1VZU A;  1R7U A;  3ZLL A;  2BO7 A;  2RIY A;  3HL3 A;  1S4O A;  2P6W A;  3SXD A;  5BXC A;  2E3D A;  3V0O A;  2YQS A;  1O7Q A;  4MYB A;  4NAI A;  1GQC A;  5FTS A;  1PZT A;  2AH9 A;  1H7Q A;  1NHE B;  2Q4J A;  4K6R A;  2X5S A;  1ZDF A;  5IDS A;  3V0N A;  4B4G A;  1R80 A;  3CKQ A;  5FYE A;  1ON6 A;  1R7V A;  2ZU7 A;  3PKP A;  1LVW A;  1W57 A;  1VIC A;  1G1L A;  1WT0 A;  1VGW A;  2YC5 A;  3D98 A;  2ICY A;  2XWN A;  3I0F A;  1FG5 N;  1ZJ0 A;  5C1G A;  1JYK A;  2OI5 A;  1V84 A;  1FXJ A;  1G97 A;  1ZI1 A;  1H5S C;  1VH3 A;  3PNN A;  4ECM A;  3IOH A;  4ZDQ A;  5C38 A;  2A8U A;  1JV3 A;  5CQM X;  4HCQ A;  2UX8 A;  3T7O A;  1ZCT A;  3CKO A;  1ZIZ A;  1HJL A;  1ZI3 A;  4Y64 A;  3OH0 A;  3OGZ A;  1S4N A;  2WAW A;  3OKR A;  4CJ8 A;  4AYJ A;  3SXA A;  1HM9 A;  4HO0 A;  4G3Q A;  3I0I X;  5FU0 A;  5CMG X;  4HO3 A;  3SX3 A;  2D7I A;  5FTV A;  4HOC A;  4BQH A;  4BMA A;  2PA4 A;  1MC3 A;  2I7B A;  2RIX A;  1H4E A;  1LL3 A;  3GUE A;  4EEA A;  1FRW A;  5DDT A;  1H5T A;  3D8V A;  3I0K A;  1H7F A;  1JYL A;  2E8B A;  1VZX A;  1TW1 A;  3ZLK A;  1TVY A;  5CMF X;  2X65 A;  1TW5 A;  1H3M A;  1WT3 A;  1ZI5 A;  4P00 A;  1VZT A;  1H5R A;  5EIY A;  4EE3 A;  2RJ7 A;  3K8E A;  2V0I A;  3USQ A;  2FYA A;  4HO5 A;  4FRQ A;  1GA8 A;  2RIZ A;  2JCJ A;  2ZU9 A;  3BRK X;  4D0T A;  2VS4 A;  1LZI A;  2WEE A;  3I0C A;  3Q4S A;  3SX8 A;  5L6V A;  2WVK A;  4KC1 A;  3I0L A;  4L41 C;  1VPA A;  3OAM A;  4DDZ A;  2RJ6 A;  3I0H A;  5C49 A;  1ZJP A;  1H5S A;  4B4M A;  2MZB A;  1W55 A;  2QH5 A;  4FCU A;  3SPT A;  3U2W A;  1NKH B;  2VS5 A;  5C3B A;  1ZCV A;  2O1F A;  2I5K A;  3R2W A;  1Z90 A;  3F1Y A;  1YP3 A;  3CU0 A;  1I52 A;  1WSZ A;  4NAN A;  4KC2 A;  4JIS A;  3F1C A;  1H5T B;  2Z86 A;  4HO2 A;  1FR9 A;  2AGD A;  4FRL A;  2RJ9 A;  4KPX A;  4MND A;  2AM4 A;  1W77 A;  1LZ0 A;  1WVC A;  1H5R B;  3SXG A;  4CJB A;  4B4B A;  1G3L A;  2XME A;  1R7X A;  3I0E A;  2FY7 A;  4B2W A;  1JV1 A;  1R7T A;  4HO4 A;  5C36 A;  3FOQ A;  4M2A A;  1H7E A;  1INJ A;  4B2X A;  2YQC A;  3U2V A;  4B5B A;  5C8R A;  1MP5 A;  2XWL A;  3ZF8 A;  2RJ4 A;  4Y63 A;  1FGG A;  2V0H A;  4Y6N A;  4GBP A;  2RJ1 A;  1H5S B;  4CVH A;  2Y4M A;  1GX4 A;  4DE7 A;  3K8D A;  4Y9X A;  1FR8 A;  4Y7V A;  1ZCY A;  2V0L A;  4KNR A;  4M28 A;  4R7P A;  1LZJ A;  1ZJ2 A;  5FUH A;  5C4F A;  1EYR A;  3JUJ A;  2BO6 A;  2OEG A;  2PGY A;  3OC9 A;  3V0P A;  3JUK A;  3I0J A;  4HO8 A;  1QGS A;  2CU2 A;  4J18 A;  5CMH A;  3V90 A;  4EE5 A;  5EJ1 A;  2FYB A;  4HO9 A;  1ZDG A;  1WT1 A;  1H7T A;  3BCV A;  4NAL A;  1HM0 A;  1XHB A;  4EVW A;  1H7H A;  4M2B A;  1XZ6 A;  1ZJ1 A;  5C1H A;  1LZ7 A;  1H7G A;  4FRB A;  2JCO A;  3SXB A;  1H5S D;  5C3D A;  2O1G A; 
#chains in the Genus database with same CATH topology
 5CQP A;  1H7L A;  2D7R A;  2FFU A;  5DDV A;  3RMW A;  1NWG B;  2X60 A;  5FU8 A;  2JCK A;  4KXO A;  3RMV A;  2Z87 A;  3V91 A;  4C2S A;  3ZGG A;  1G2V A;  1WT2 A;  3ST8 A;  5AJP A;  1GQ9 A;  3U0X A;  4LW6 A;  3E26 A;  1G95 A;  2FYC B;  3V8Y A;  4G3S A;  3IOI A;  1LL2 A;  3JTJ A;  2AM5 A;  1NF5 B;  2WVL A;  1R7Y A;  2Y4K A;  2Y4J A;  1G0R A;  4FQW A;  4FRA A;  2RJ8 A;  5J49 A;  3EE5 A;  1MP4 A;  3R3I A;  4Y7G A;  4FIY A;  4ARW A;  4P02 A;  2OI6 A;  3D5N A;  4Y7U A;  2D0J A;  3ZGF A;  1G9R A;  2P73 A;  5IDT A;  3SXC A;  1HM8 A;  2APC A;  4IRP A;  3U0Y A;  1R81 A;  3U2X A;  4Y7F A;  3I0D A;  4ASY A;  2RJ5 A;  4Y7T A;  1FWY A;  1JVG A;  1YRO B;  1V82 A;  5CQL X;  4Y6U A;  3TZT A;  1OQM B;  1HV9 A;  1H4D A;  1QG8 A;  2VSI A;  1NMM B;  5CQO A;  4EEO A;  1G23 A;  4FRE A;  3V0Q A;  2AES A;  2X5Z A;  2YQH A;  1O7O A;  1EZI A;  3TQD A;  5C4B A;  5HS2 A;  1ZI4 A;  3POL A;  5C3A A;  4B42 A;  1HJJ A;  2A8W A;  2BO4 A;  3CKV A;  2PX7 A;  3T7N A;  4KRV A;  4LW3 A;  4FRH A;  3CKN A;  4M4K A;  3V0L A;  3FWW A;  2AE7 A;  3Q7U A;  2V0J A;  1IIM A;  5C4E A;  5CMJ A;  4AYL A;  4FRO A;  2VK9 A;  1G8O A;  2VXM A;  5C47 A;  5C48 A;  4FCE A;  2ZU8 A;  1VM8 A;  3SXE A;  2WE9 A;  1ZJ3 A;  3DJ4 A;  4HO6 A;  3OH3 A;  4FRP A;  2GGQ A;  1H4C A;  1INI A;  3DK5 A;  3T7M A;  4D0Z A;  2I5E A;  3V0M A;  4DEC A;  2YC3 A;  3U2T A;  4B3U A;  1IIN A;  5AJN A;  3SX5 A;  2AM3 A;  3V8Z A;  4Y62 A;  3E25 A;  4KPZ A;  5C4D A;  2WGZ A;  3RSB A;  2VXL A;  2QGI A;  1GWW A;  1LL0 A;  2RJ0 A;  3NGW A;  4D11 C;  3USR A;  2W0V A;  2PGV A;  2GGO A;  5JQQ A;  5CMI A;  2NXV A;  4MIX A;  2O1H A;  1ZHJ A;  1TZF A;  5EJZ A;  1QWJ A;  2OI7 A;  4NAK A;  1VGU A;  2V0K A;  4ASJ A;  3QVB A;  1PZY B;  2QKX A;  1FOA A;  2W0W A;  5AJO A;  5L6S A;  2YCM A;  4G3P A;  2P72 A;  3N9W A;  1GX0 A;  3I0G A;  3LW6 A;  4E1K A;  1VH1 A;  4FRM A;  1FO9 A;  1V83 A;  4CJC A;  3Q80 A;  1OMX A;  2JCL A;  3KIA A;  4D48 A;  2XMH A;  2Y6P A;  1FGX A;  2ICX A;  4IRQ A;  2WVM A;  2VD4 A;  1QGQ A;  4O6M A;  1MP3 A;  1JVD A;  4AC3 A;  1FO8 A;  2FFV A;  1VGT A;  2BO8 A;  3PKQ A;  4AAW A;  2VS3 A;  3OH2 A;  1FZW A;  1GWV A;  4HG6 A;  2Y7A A;  1G93 A;  3U2U A;  4EEG A;  4KC4 A;  4KNX A;  5CQN X;  1E5K A;  1O23 B;  4D11 A;  4EEM A;  2YES A;  3OH4 A;  1YP4 A;  3O3P A;  1O0R A;  2DPW A;  1OMZ A;  2OEF A;  4XWI A;  1S4P A;  2AEC A;  2XWM A;  3SX7 A;  1VGZ A;  5D91 A;  4EE4 A;  2FYD B;  1ON8 A;  2RIT A;  2VFZ A;  4JD0 A;  2Y4L A;  1SS9 A;  4YS8 A;  5FV9 A;  1R82 A;  1FXO A;  2YQJ A;  4KQL A;  4G87 A;  5C4C A;  2VSH A;  4UEG A;  5C1L A;  3CGX A;  3CKJ A;  5I1F A;  1YP2 A;  3DUV A;  1K4V A;  5IFY A;  1KWS A;  1NQI B;  1ZCU A;  4KT7 A;  3IOJ A;  3OH1 A;  1ZJO A;  4FRD A;  1VZU A;  1R7U A;  3ZLL A;  2BO7 A;  2RIY A;  3HL3 A;  1S4O A;  2P6W A;  3SXD A;  5BXC A;  2E3D A;  3V0O A;  2YQS A;  1O7Q A;  4MYB A;  4NAI A;  1GQC A;  5FTS A;  1PZT A;  2AH9 A;  2J0B A;  1H7Q A;  1NHE B;  2Q4J A;  4K6R A;  2X5S A;  1ZDF A;  5IDS A;  3V0N A;  4B4G A;  1R80 A;  3CKQ A;  4Q7C A;  5FYE A;  1ON6 A;  1R7V A;  2ZU7 A;  3PKP A;  1LVW A;  1W57 A;  1VIC A;  1G1L A;  1WT0 A;  1VGW A;  2YC5 A;  3D98 A;  2ICY A;  2XWN A;  3I0F A;  1FG5 N;  1ZJ0 A;  5C1G A;  1JYK A;  2OI5 A;  1V84 A;  1FXJ A;  1G97 A;  1ZI1 A;  1H5S C;  1VH3 A;  3PNN A;  4ECM A;  3IOH A;  4ZDQ A;  5C38 A;  2A8U A;  1JV3 A;  5CQM X;  4HCQ A;  2UX8 A;  3T7O A;  1ZCT A;  3CKO A;  1ZIZ A;  1HJL A;  1ZI3 A;  4Y64 A;  3OH0 A;  3OGZ A;  1S4N A;  2WAW A;  3OKR A;  4CJ8 A;  4AYJ A;  3SXA A;  1HM9 A;  4HO0 A;  4G3Q A;  3I0I X;  5FU0 A;  5CMG X;  4HO3 A;  3SX3 A;  2D7I A;  5FTV A;  4HOC A;  4BQH A;  4BMA A;  2PA4 A;  1MC3 A;  2I7B A;  2RIX A;  1H4E A;  1LL3 A;  5D92 A;  3GUE A;  4EEA A;  1FRW A;  5DDT A;  1H5T A;  3D8V A;  3I0K A;  1H7F A;  1JYL A;  2E8B A;  1VZX A;  1TW1 A;  3ZLK A;  1TVY A;  5CMF X;  2X65 A;  1TW5 A;  1H3M A;  1WT3 A;  1ZI5 A;  4P00 A;  1VZT A;  1H5R A;  5EIY A;  4EE3 A;  2RJ7 A;  3K8E A;  2V0I A;  3USQ A;  2FYA A;  4HO5 A;  4FRQ A;  1GA8 A;  2RIZ A;  2JCJ A;  2ZU9 A;  3BRK X;  4D0T A;  2VS4 A;  1LZI A;  2WEE A;  3I0C A;  3Q4S A;  3SX8 A;  5L6V A;  2WVK A;  4KC1 A;  3I0L A;  4L41 C;  1VPA A;  3OAM A;  4DDZ A;  2RJ6 A;  3I0H A;  5C49 A;  1ZJP A;  1H5S A;  4B4M A;  2MZB A;  1W55 A;  2QH5 A;  4FCU A;  3SPT A;  3U2W A;  1NKH B;  2VS5 A;  5C3B A;  1ZCV A;  2O1F A;  2I5K A;  3R2W A;  1Z90 A;  3F1Y A;  1YP3 A;  3CU0 A;  1I52 A;  2C0N A;  1WSZ A;  4NAN A;  4KC2 A;  4JIS A;  3F1C A;  1H5T B;  2Z86 A;  4HO2 A;  1FR9 A;  2AGD A;  4FRL A;  2RJ9 A;  4KPX A;  4MND A;  2AM4 A;  1W77 A;  1LZ0 A;  1WVC A;  1H5R B;  3SXG A;  4CJB A;  4B4B A;  1G3L A;  2XME A;  1R7X A;  3I0E A;  2FY7 A;  4B2W A;  1JV1 A;  1R7T A;  4HO4 A;  5C36 A;  3FOQ A;  4M2A A;  1H7E A;  1INJ A;  4B2X A;  2YQC A;  3U2V A;  4B5B A;  5C8R A;  1MP5 A;  2XWL A;  3ZF8 A;  2RJ4 A;  4Y63 A;  1FGG A;  2V0H A;  4Y6N A;  4GBP A;  2RJ1 A;  2J0A A;  1H5S B;  4CVH A;  2Y4M A;  1GX4 A;  4DE7 A;  3K8D A;  4Y9X A;  1FR8 A;  4Y7V A;  1ZCY A;  2V0L A;  4KNR A;  4M28 A;  4R7P A;  1LZJ A;  1ZJ2 A;  5FUH A;  5C4F A;  1EYR A;  3JUJ A;  2BO6 A;  2OEG A;  2PGY A;  3OC9 A;  4FIX A;  4O6N A;  3V0P A;  3JUK A;  3I0J A;  4HO8 A;  1QGS A;  2CU2 A;  4J18 A;  5CMH A;  3V90 A;  4EE5 A;  5EJ1 A;  2FYB A;  4HO9 A;  1ZDG A;  1WT1 A;  1H7T A;  3BCV A;  4NAL A;  1HM0 A;  1XHB A;  4EVW A;  1H7H A;  4M2B A;  1XZ6 A;  1ZJ1 A;  5C1H A;  1LZ7 A;  1H7G A;  4FRB A;  2JCO A;  3SXB A;  1H5S D;  5C3D A;  2O1G A; 
#chains in the Genus database with same CATH homology
 5CQP A;  1H7L A;  2D7R A;  2FFU A;  5DDV A;  3RMW A;  1NWG B;  2X60 A;  5FU8 A;  2JCK A;  4KXO A;  3RMV A;  2Z87 A;  3V91 A;  4C2S A;  3ZGG A;  1G2V A;  1WT2 A;  3ST8 A;  5AJP A;  1GQ9 A;  3U0X A;  4LW6 A;  3E26 A;  1G95 A;  2FYC B;  3V8Y A;  4G3S A;  3IOI A;  1LL2 A;  3JTJ A;  2AM5 A;  1NF5 B;  2WVL A;  1R7Y A;  2Y4K A;  2Y4J A;  1G0R A;  4FQW A;  4FRA A;  2RJ8 A;  5J49 A;  3EE5 A;  1MP4 A;  3R3I A;  4Y7G A;  4FIY A;  4ARW A;  4P02 A;  2OI6 A;  3D5N A;  4Y7U A;  2D0J A;  3ZGF A;  1G9R A;  2P73 A;  5IDT A;  3SXC A;  1HM8 A;  2APC A;  4IRP A;  3U0Y A;  1R81 A;  3U2X A;  4Y7F A;  3I0D A;  4ASY A;  2RJ5 A;  4Y7T A;  1FWY A;  1JVG A;  1YRO B;  1V82 A;  5CQL X;  4Y6U A;  3TZT A;  1OQM B;  1HV9 A;  1H4D A;  1QG8 A;  2VSI A;  1NMM B;  5CQO A;  4EEO A;  1G23 A;  4FRE A;  3V0Q A;  2AES A;  2X5Z A;  2YQH A;  1O7O A;  1EZI A;  3TQD A;  5C4B A;  5HS2 A;  1ZI4 A;  3POL A;  5C3A A;  4B42 A;  1HJJ A;  2A8W A;  2BO4 A;  3CKV A;  2PX7 A;  3T7N A;  4KRV A;  4LW3 A;  4FRH A;  3CKN A;  4M4K A;  3V0L A;  3FWW A;  2AE7 A;  3Q7U A;  2V0J A;  1IIM A;  5C4E A;  5CMJ A;  4AYL A;  4FRO A;  2VK9 A;  1G8O A;  2VXM A;  5C47 A;  5C48 A;  4FCE A;  2ZU8 A;  1VM8 A;  3SXE A;  2WE9 A;  1ZJ3 A;  3DJ4 A;  4HO6 A;  3OH3 A;  4FRP A;  2GGQ A;  1H4C A;  1INI A;  3DK5 A;  3T7M A;  4D0Z A;  2I5E A;  3V0M A;  4DEC A;  2YC3 A;  3U2T A;  4B3U A;  1IIN A;  5AJN A;  3SX5 A;  2AM3 A;  3V8Z A;  4Y62 A;  3E25 A;  4KPZ A;  5C4D A;  2WGZ A;  3RSB A;  2VXL A;  2QGI A;  1GWW A;  1LL0 A;  2RJ0 A;  3NGW A;  4D11 C;  3USR A;  2W0V A;  2PGV A;  2GGO A;  5JQQ A;  5CMI A;  2NXV A;  4MIX A;  2O1H A;  1ZHJ A;  1TZF A;  5EJZ A;  1QWJ A;  2OI7 A;  4NAK A;  1VGU A;  2V0K A;  4ASJ A;  3QVB A;  1PZY B;  2QKX A;  1FOA A;  2W0W A;  5AJO A;  5L6S A;  2YCM A;  4G3P A;  2P72 A;  3N9W A;  1GX0 A;  3I0G A;  3LW6 A;  4E1K A;  1VH1 A;  4FRM A;  1FO9 A;  1V83 A;  4CJC A;  3Q80 A;  1OMX A;  2JCL A;  3KIA A;  4D48 A;  2XMH A;  2Y6P A;  1FGX A;  2ICX A;  4IRQ A;  2WVM A;  2VD4 A;  1QGQ A;  4O6M A;  1MP3 A;  1JVD A;  4AC3 A;  1FO8 A;  2FFV A;  1VGT A;  2BO8 A;  3PKQ A;  4AAW A;  2VS3 A;  3OH2 A;  1FZW A;  1GWV A;  4HG6 A;  2Y7A A;  1G93 A;  3U2U A;  4EEG A;  4KC4 A;  4KNX A;  5CQN X;  1E5K A;  1O23 B;  4D11 A;  4EEM A;  2YES A;  3OH4 A;  1YP4 A;  3O3P A;  1O0R A;  2DPW A;  1OMZ A;  2OEF A;  4XWI A;  1S4P A;  2AEC A;  2XWM A;  3SX7 A;  1VGZ A;  5D91 A;  4EE4 A;  2FYD B;  1ON8 A;  2RIT A;  2VFZ A;  4JD0 A;  2Y4L A;  1SS9 A;  4YS8 A;  5FV9 A;  1R82 A;  1FXO A;  2YQJ A;  4KQL A;  4G87 A;  5C4C A;  2VSH A;  4UEG A;  5C1L A;  3CGX A;  3CKJ A;  5I1F A;  1YP2 A;  3DUV A;  1K4V A;  5IFY A;  1KWS A;  1NQI B;  1ZCU A;  4KT7 A;  3IOJ A;  3OH1 A;  1ZJO A;  4FRD A;  1VZU A;  1R7U A;  3ZLL A;  2BO7 A;  2RIY A;  3HL3 A;  1S4O A;  2P6W A;  3SXD A;  5BXC A;  2E3D A;  3V0O A;  2YQS A;  1O7Q A;  4MYB A;  4NAI A;  1GQC A;  5FTS A;  1PZT A;  2AH9 A;  2J0B A;  1H7Q A;  1NHE B;  2Q4J A;  4K6R A;  2X5S A;  1ZDF A;  5IDS A;  3V0N A;  4B4G A;  1R80 A;  3CKQ A;  4Q7C A;  5FYE A;  1ON6 A;  1R7V A;  2ZU7 A;  3PKP A;  1LVW A;  1W57 A;  1VIC A;  1G1L A;  1WT0 A;  1VGW A;  2YC5 A;  3D98 A;  2ICY A;  2XWN A;  3I0F A;  1FG5 N;  1ZJ0 A;  5C1G A;  1JYK A;  2OI5 A;  1V84 A;  1FXJ A;  1G97 A;  1ZI1 A;  1H5S C;  1VH3 A;  3PNN A;  4ECM A;  3IOH A;  4ZDQ A;  5C38 A;  2A8U A;  1JV3 A;  5CQM X;  4HCQ A;  2UX8 A;  3T7O A;  1ZCT A;  3CKO A;  1ZIZ A;  1HJL A;  1ZI3 A;  4Y64 A;  3OH0 A;  3OGZ A;  1S4N A;  2WAW A;  3OKR A;  4CJ8 A;  4AYJ A;  3SXA A;  1HM9 A;  4HO0 A;  4G3Q A;  3I0I X;  5FU0 A;  5CMG X;  4HO3 A;  3SX3 A;  2D7I A;  5FTV A;  4HOC A;  4BQH A;  4BMA A;  2PA4 A;  1MC3 A;  2I7B A;  2RIX A;  1H4E A;  1LL3 A;  5D92 A;  3GUE A;  4EEA A;  1FRW A;  5DDT A;  1H5T A;  3D8V A;  3I0K A;  1H7F A;  1JYL A;  2E8B A;  1VZX A;  1TW1 A;  3ZLK A;  1TVY A;  5CMF X;  2X65 A;  1TW5 A;  1H3M A;  1WT3 A;  1ZI5 A;  4P00 A;  1VZT A;  1H5R A;  5EIY A;  4EE3 A;  2RJ7 A;  3K8E A;  2V0I A;  3USQ A;  2FYA A;  4HO5 A;  4FRQ A;  1GA8 A;  2RIZ A;  2JCJ A;  2ZU9 A;  3BRK X;  4D0T A;  2VS4 A;  1LZI A;  2WEE A;  3I0C A;  3Q4S A;  3SX8 A;  5L6V A;  2WVK A;  4KC1 A;  3I0L A;  4L41 C;  1VPA A;  3OAM A;  4DDZ A;  2RJ6 A;  3I0H A;  5C49 A;  1ZJP A;  1H5S A;  4B4M A;  2MZB A;  1W55 A;  2QH5 A;  4FCU A;  3SPT A;  3U2W A;  1NKH B;  2VS5 A;  5C3B A;  1ZCV A;  2O1F A;  2I5K A;  3R2W A;  1Z90 A;  3F1Y A;  1YP3 A;  3CU0 A;  1I52 A;  2C0N A;  1WSZ A;  4NAN A;  4KC2 A;  4JIS A;  3F1C A;  1H5T B;  2Z86 A;  4HO2 A;  1FR9 A;  2AGD A;  4FRL A;  2RJ9 A;  4KPX A;  4MND A;  2AM4 A;  1W77 A;  1LZ0 A;  1WVC A;  1H5R B;  3SXG A;  4CJB A;  4B4B A;  1G3L A;  2XME A;  1R7X A;  3I0E A;  2FY7 A;  4B2W A;  1JV1 A;  1R7T A;  4HO4 A;  5C36 A;  3FOQ A;  4M2A A;  1H7E A;  1INJ A;  4B2X A;  2YQC A;  3U2V A;  4B5B A;  5C8R A;  1MP5 A;  2XWL A;  3ZF8 A;  2RJ4 A;  4Y63 A;  1FGG A;  2V0H A;  4Y6N A;  4GBP A;  2RJ1 A;  2J0A A;  1H5S B;  4CVH A;  2Y4M A;  1GX4 A;  4DE7 A;  3K8D A;  4Y9X A;  1FR8 A;  4Y7V A;  1ZCY A;  2V0L A;  4KNR A;  4M28 A;  4R7P A;  1LZJ A;  1ZJ2 A;  5FUH A;  5C4F A;  1EYR A;  3JUJ A;  2BO6 A;  2OEG A;  2PGY A;  3OC9 A;  4FIX A;  4O6N A;  3V0P A;  3JUK A;  3I0J A;  4HO8 A;  1QGS A;  2CU2 A;  4J18 A;  5CMH A;  3V90 A;  4EE5 A;  5EJ1 A;  2FYB A;  4HO9 A;  1ZDG A;  1WT1 A;  1H7T A;  3BCV A;  4NAL A;  1HM0 A;  1XHB A;  4EVW A;  1H7H A;  4M2B A;  1XZ6 A;  1ZJ1 A;  5C1H A;  1LZ7 A;  1H7G A;  4FRB A;  2JCO A;  3SXB A;  1H5S D;  5C3D A;  2O1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...