2RJ4A

B-specific alpha-1,3-galactosyltransferase \ g176r +udp+ada
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
291
structure length
290
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycoprotein-fucosylgalactoside alpha-galactosyltransferase
publication title ABO(H) blood group A and B glycosyltransferases recognize substrate via specific conformational changes.
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 290
sequence length 291
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2007-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2rj4A00
4CJCA 4P00A 3E26A 4Y6UA 4Y6NA 3SX3A 3I0CA 2X65A 3KIAA 2OI7A 3SXDA 4EEMA 4L41C 5CQPA 1LL2A 2O1FA 4NANA 1TW1A 2X5ZA 2Z86A 3CKJA 1INIA 1OMZA 3V8YA 1R7TA 2XMHA 4KC4A 3I0JA 3T7NA 5DDTA 4D0TA 3PKQA 2V0IA 4D48A 4HOCA 3IOJA 1ZCTA 1ZCVA 2W0WA 4FROA 5CQLX 1HM8A 2AGDA 2AE7A 1ZJ2A 5C1HA 1O7QA 5L6SA 1V83A 2I5EA 5FTSA 3DUVA 3RMVA 1G95A 3T7MA 4FRLA 2XWMA 3SXEA 3V0QA 1E5KA 4XWIA 4ECMA 2APCA 5AJNA 3T7OA 4ZDQA 4KXOA 1ZJPA 2WAWA 1MP4A 3CKVA 1QG8A 2VS3A 4FRMA 3Q4SA 3D98A 4HO3A 1V82A 1GA8A 3RSBA 1HV9A 1VGZA 3U2TA 4Y7FA 3I0IX 4KC2A 4Y62A 1G2VA 1H7QA 2BO4A 3U2WA 3OAMA 5C4CA 5IDSA 4G87A 2FYDB 2GGOA 1SS9A 5FV9A 1WT2A 3U0YA 1FOAA 5C47A 2FFUA 2PX7A 4AAWA 2Y7AA 1QGQA 1EYRA 3Q80A 5BXCA 4EVWA 3CKOA 2D0JA 2OI5A 1VGUA 1HM9A 1WVCA 1H5TA 2FYCB 4B2WA 4AYLA 1GX0A 1I52A 4ASYA 1JVGA 2RITA 3SX7A 1V84A 2RJ4A 1S4OA 1MC3A 3I0EA 3D8VA 4B2XA 1QGSA 4G3QA 3OH0A 2V0HA 2AM5A 5C4FA 4EEOA 1H7LA 5FU0A 1G1LA 3I0FA 1GQ9A 1O23B 1NMMB 1R82A 1H5RA 1LZ7A 3OH1A 1NWGB 2I7BA 2Y6PA 4HO6A 1LZIA 2D7RA 1VGWA 3R2WA 4BMAA 1H3MA 5FUHA 4IRQA 4Y7UA 2O1HA 1S4PA 2PA4A 1INJA 5C4BA 2UX8A 2V0KA 2Y4MA 1H7HA 2D7IA 2RJ5A 3I0GA 1G0RA 3F1CA 2WVKA 1ZCUA 4HG6A 4KQLA 2PGYA 2YQCA 3FOQA 1ON8A 4KC1A 4Y64A 4FRQA 1H7GA 3LW6A 5CMGX 5C8RA 1NF5B 2WEEA 3U2VA 1H7FA 2FYAA 3F1YA 4K6RA 1H5RB 5CMFX 5CQNX 4CJ8A 4AYJA 1R7YA 4NAIA 2JCLA 4KRVA 5C1LA 3BRKX 1FG5N 2YQSA 3I0DA 4DE7A 3JUJA 5C1GA 4M2AA 3ZLKA 4CJBA 1MP3A 5C38A 4Y7TA 1ZI4A 1ZCYA 2OEGA 3FWWA 2I5KA 4G3SA 1R80A 4YS8A 2YESA 1G97A 4B42A 1PZYB 4C2SA 5CMJA 1GWWA 2VS5A 3JTJA 1H5SA 1PZTA 4B3UA 4JISA 2RJ1A 4NALA 3CGXA 2PGVA 1FXJA 2CU2A 2V0JA 1FO9A 2XWNA 4EEAA 3JUKA 2QH5A 4J18A 1G23A 3OH4A 4DDZA 4UEGA 5EJZA 1FRWA 3ZGFA 2P73A 1H5SD 3SXGA 3U2XA 2AECA 4EE5A 4GBPA 2A8WA 2RJ8A 1ZHJA 2VXMA 1JYLA 2ZU9A 3V8ZA 2VSIA 3CU0A 1G8OA 4B5BA 4HO4A 1GWVA 2XMEA 3ST8A 1HJJA 4KT7A 1VH3A 3PKPA 3U2UA 1VGTA 1FGXA 2FFVA 1HJLA 1H5SB 4AC3A 3U0XA 2DPWA 2QKXA 1JV3A 1TVYA 1LL0A 2RJ9A 4FRPA 2GGQA 2X5SA 4HO0A 3E25A 3IOIA 1ZI1A 1YP4A 4MNDA 3GUEA 5AJOA 1XZ6A 5DDVA 1WT1A 2YQJA 5C4EA 3IOHA 3O3PA 2FYBA 4EEGA 1ZI3A 4FCEA 5CQOA 1H4DA 2WE9A 4HO9A 1LZJA 1IINA 4KPXA 4D11A 5HS2A 1JVDA 3V0LA 4E1KA 3OKRA 1FO8A 2OEFA 2ZU7A 3OH2A 2WVLA 1LZ0A 2YCMA 2RJ0A 3RMWA 2VSHA 1NQIB 1W55A 3V0MA 4HO2A 1H7EA 5I1FA 1OMXA 2E8BA 1W57A 1H5TB 3OH3A 4LW3A 4P02A 3ZF8A 3I0KA 1FWYA 4M2BA 3V0PA 3CKNA 3SXBA 1O7OA 1H4EA 5CMIA 4HO8A 3D5NA 1XHBA 5C49A 3SX8A 3TZTA 1ZDFA 5C3DA 1VPAA 1ZJ3A 1NKHB 1ZJOA 1R7UA 2WVMA 4FREA 1EZIA 1HM0A 2Z87A 3SXAA 2WGZA 2Y4JA 2ZU8A 2VD4A 1VH1A 4EE4A 3N9WA 1KWSA 1GQCA 1G3LA 2AM3A 2MZBA 1OQMB 3V0OA 1FGGA 2YQHA 2JCOA 4KNRA 1VZTA 4DECA 1H5SC 1MP5A 2W0VA 2AH9A 4NAKA 5L6VA 1K4VA 2XWLA 4FQWA 2BO7A 3EE5A 1YP3A 1TW5A 1FR9A 1H4CA 2YC5A 4LW6A 3V0NA 5EIYA 1R7XA 4B4BA 3USRA 2AESA 3BCVA 2X60A 5J49A 5C3BA 2VXLA 1ZDGA 3OC9A 4CVHA 3TQDA 2AM4A 4G3PA 3I0HA 5EJ1A 2P6WA 2E3DA 2OI6A 2VS4A 2RJ7A 5IDTA 2V0LA 1G93A 4FRDA 5CQMX 2ICXA 2JCJA 5C48A 3K8EA 4FRAA 1VZUA 2VFZA 4Y9XA 4ASJA 3SPTA 1FZWA 1ZIZA 5C4DA 4B4MA 2FY7A 2BO6A 2RIZA 4FRBA 4R7PA 3V90A 4FRHA 2NXVA 3OGZA 3USQA 2RIXA 3QVBA 5C3AA 2A8UA 1S4NA 1W77A 3DJ4A 4Y7GA 4KNXA 4HO5A 4D11C 2Y4KA 2BO8A 1LVWA 2QGIA 3SX5A 2RJ6A 4Y7VA 1IIMA 1ZJ1A 1QWJA 4JD0A 1JV1A 2Y4LA 1R81A 4MYBA 1WT3A 3ZGGA 3ZLLA 1JYKA 2P72A 2RIYA 4ARWA 2Q4JA 1H7TA 5AJPA 3SXCA 5FYEA 3V91A 2YC3A 1FR8A 1YROB 3DK5A 4B4GA 2O1GA 4BQHA 1VICA 3HL3A 3CKQA 4Y63A 1VM8A 1GX4A 1WT0A 5FU8A 3R3IA 3NGWA 5JQQA 4EE3A 1ZI5A 4D0ZA 5FTVA 2JCKA 4M28A 1WSZA 5IFYA 3PNNA 4IRPA 4FCUA 2ICYA 4M4KA 3I0LA 1R7VA 3K8DA 5CMHA 1ZJ0A 1LL3A 1G9RA 3Q7UA 1O0RA 1NHEB 1FXOA 5C36A 4HCQA 3POLA 1YP2A 1TZFA 1ON6A 1Z90A 4KPZA 1VZXA
chains in the Genus database with same CATH superfamily
4CJCA 4P00A 3E26A 4Y6UA 4Y6NA 3SX3A 3I0CA 2X65A 3KIAA 2OI7A 3SXDA 4EEMA 4MIXA 4L41C 5CQPA 1LL2A 2O1FA 4NANA 1TW1A 2X5ZA 2Z86A 3CKJA 1INIA 1OMZA 3V8YA 1R7TA 2XMHA 4KC4A 3I0JA 3T7NA 5DDTA 4D0TA 3PKQA 2V0IA 4D48A 4HOCA 3IOJA 1ZCTA 1ZCVA 2W0WA 4FROA 5CQLX 1HM8A 2AGDA 2AE7A 1ZJ2A 5C1HA 1O7QA 5L6SA 1V83A 2I5EA 5FTSA 3DUVA 3RMVA 1G95A 3T7MA 4FRLA 2XWMA 3SXEA 3V0QA 1E5KA 4XWIA 4ECMA 2APCA 5AJNA 3T7OA 4ZDQA 4KXOA 1ZJPA 2WAWA 1MP4A 3CKVA 1QG8A 2VS3A 4FRMA 3Q4SA 3D98A 4HO3A 1V82A 1GA8A 3RSBA 1HV9A 1VGZA 3U2TA 4Y7FA 3I0IX 4KC2A 4Y62A 1G2VA 1H7QA 2BO4A 3U2WA 3OAMA 5C4CA 5IDSA 4G87A 2FYDB 2GGOA 1SS9A 5FV9A 1WT2A 3U0YA 1FOAA 5C47A 2FFUA 2PX7A 4AAWA 2Y7AA 1QGQA 1EYRA 3Q80A 5BXCA 4EVWA 3CKOA 2D0JA 2OI5A 1VGUA 1HM9A 1WVCA 1H5TA 2FYCB 4B2WA 4AYLA 1GX0A 1I52A 4ASYA 1JVGA 2RITA 3SX7A 1V84A 2RJ4A 1S4OA 1MC3A 3I0EA 3D8VA 4B2XA 1QGSA 4G3QA 3OH0A 2V0HA 2AM5A 5C4FA 5D92A 4EEOA 1H7LA 5FU0A 1G1LA 3I0FA 1GQ9A 1O23B 1NMMB 1R82A 1H5RA 1LZ7A 3OH1A 1NWGB 2I7BA 2Y6PA 4HO6A 1LZIA 2D7RA 1VGWA 3R2WA 4BMAA 1H3MA 5FUHA 4IRQA 4Y7UA 2O1HA 1S4PA 2PA4A 1INJA 5C4BA 2UX8A 2V0KA 2Y4MA 1H7HA 2D7IA 2RJ5A 3I0GA 1G0RA 3F1CA 2WVKA 1ZCUA 4HG6A 4KQLA 2PGYA 2YQCA 3FOQA 1ON8A 4KC1A 4Y64A 4FRQA 1H7GA 3LW6A 5CMGX 5C8RA 1NF5B 2WEEA 3U2VA 1H7FA 2FYAA 3F1YA 4K6RA 1H5RB 5CMFX 5CQNX 4CJ8A 4AYJA 1R7YA 4NAIA 2JCLA 4KRVA 5C1LA 3BRKX 1FG5N 2YQSA 3I0DA 4DE7A 3JUJA 5C1GA 4M2AA 3ZLKA 4CJBA 1MP3A 5C38A 4Y7TA 1ZI4A 1ZCYA 2OEGA 2VK9A 3FWWA 2I5KA 4G3SA 1R80A 4YS8A 2YESA 1G97A 4B42A 1PZYB 4C2SA 5CMJA 1GWWA 2VS5A 3JTJA 1H5SA 1PZTA 4B3UA 4JISA 2RJ1A 4NALA 3CGXA 2PGVA 1FXJA 2CU2A 2V0JA 1FO9A 2XWNA 4EEAA 3JUKA 2QH5A 4J18A 1G23A 3OH4A 4DDZA 4UEGA 5EJZA 1FRWA 3ZGFA 2P73A 1H5SD 3SXGA 3U2XA 2AECA 4EE5A 4GBPA 2A8WA 2RJ8A 1ZHJA 2VXMA 1JYLA 2ZU9A 3V8ZA 2VSIA 3CU0A 1G8OA 4B5BA 4HO4A 1GWVA 2XMEA 3ST8A 1HJJA 4KT7A 1VH3A 3PKPA 3U2UA 1VGTA 1FGXA 2FFVA 1HJLA 1H5SB 4AC3A 3U0XA 2DPWA 2QKXA 1JV3A 1TVYA 1LL0A 2RJ9A 4FRPA 2GGQA 2X5SA 4HO0A 3E25A 3IOIA 1ZI1A 1YP4A 4MNDA 3GUEA 5AJOA 1XZ6A 5DDVA 1WT1A 2YQJA 5C4EA 3IOHA 3O3PA 2FYBA 4EEGA 1ZI3A 4FCEA 5CQOA 1H4DA 2WE9A 4HO9A 1LZJA 1IINA 4KPXA 4D11A 5HS2A 1JVDA 3V0LA 4E1KA 3OKRA 1FO8A 2OEFA 2ZU7A 3OH2A 2WVLA 1LZ0A 2YCMA 2RJ0A 3RMWA 2VSHA 1NQIB 1W55A 3V0MA 4HO2A 1H7EA 5I1FA 1OMXA 2E8BA 1W57A 1H5TB 3OH3A 4LW3A 4P02A 3ZF8A 3I0KA 1FWYA 4M2BA 3V0PA 3CKNA 3SXBA 1O7OA 4O6MA 1H4EA 5CMIA 4HO8A 3D5NA 1XHBA 4O6NA 5C49A 3SX8A 3TZTA 1ZDFA 5C3DA 2J0AA 1VPAA 1ZJ3A 4FIXA 1NKHB 1ZJOA 1R7UA 2WVMA 4FREA 1EZIA 1HM0A 2Z87A 3SXAA 2WGZA 2Y4JA 2ZU8A 2VD4A 1VH1A 4EE4A 3N9WA 1KWSA 1GQCA 1G3LA 2AM3A 2MZBA 1OQMB 3V0OA 1FGGA 2YQHA 2JCOA 4KNRA 1VZTA 4DECA 1H5SC 1MP5A 2W0VA 2AH9A 4NAKA 5L6VA 1K4VA 2XWLA 4FQWA 2BO7A 3EE5A 1YP3A 1TW5A 1FR9A 1H4CA 2YC5A 4LW6A 3V0NA 5EIYA 1R7XA 4B4BA 3USRA 2AESA 3BCVA 2X60A 5J49A 5C3BA 2VXLA 1ZDGA 3OC9A 4CVHA 3TQDA 2AM4A 4G3PA 3I0HA 5EJ1A 2P6WA 2E3DA 2OI6A 2VS4A 2RJ7A 5IDTA 2V0LA 1G93A 4FRDA 5CQMX 2ICXA 2JCJA 5C48A 3K8EA 4FRAA 1VZUA 2VFZA 4Y9XA 4ASJA 3SPTA 1FZWA 1ZIZA 5C4DA 4B4MA 2FY7A 2BO6A 2RIZA 4FRBA 4R7PA 3V90A 4FRHA 2NXVA 3OGZA 3USQA 2RIXA 3QVBA 5C3AA 2A8UA 1S4NA 1W77A 3DJ4A 4Y7GA 4KNXA 4HO5A 4D11C 2Y4KA 2BO8A 1LVWA 2QGIA 3SX5A 2RJ6A 4Y7VA 5D91A 1IIMA 1ZJ1A 1QWJA 4JD0A 1JV1A 2C0NA 2Y4LA 1R81A 4MYBA 1WT3A 3ZGGA 3ZLLA 1JYKA 2P72A 2RIYA 4ARWA 2Q4JA 1H7TA 5AJPA 3SXCA 5FYEA 3V91A 2YC3A 1FR8A 1YROB 3DK5A 4B4GA 2O1GA 4BQHA 1VICA 3HL3A 3CKQA 4Y63A 1VM8A 1GX4A 1WT0A 5FU8A 3R3IA 3NGWA 5JQQA 4EE3A 1ZI5A 4D0ZA 5FTVA 2JCKA 4M28A 1WSZA 5IFYA 3PNNA 4IRPA 4FCUA 2ICYA 4M4KA 4FIYA 3I0LA 1R7VA 3K8DA 5CMHA 4Q7CA 1ZJ0A 1LL3A 1G9RA 3Q7UA 1O0RA 1NHEB 1FXOA 5C36A 4HCQA 3POLA 1YP2A 1TZFA 1ON6A 1Z90A 4KPZA 2J0BA 1VZXA
chains in the Genus database with same CATH topology
4CJCA 4P00A 3E26A 4Y6UA 4Y6NA 3SX3A 3I0CA 2X65A 3KIAA 2OI7A 3SXDA 4EEMA 4MIXA 4L41C 5CQPA 1LL2A 2O1FA 4NANA 1TW1A 2X5ZA 2Z86A 3CKJA 1INIA 1OMZA 3V8YA 1R7TA 2XMHA 4KC4A 3I0JA 3T7NA 5DDTA 4D0TA 3PKQA 2V0IA 4D48A 4HOCA 3IOJA 1ZCTA 1ZCVA 2W0WA 4FROA 5CQLX 1HM8A 2AGDA 2AE7A 1ZJ2A 5C1HA 1O7QA 5L6SA 1V83A 2I5EA 5FTSA 3DUVA 3RMVA 1G95A 3T7MA 4FRLA 2XWMA 3SXEA 3V0QA 1E5KA 4XWIA 4ECMA 2APCA 5AJNA 3T7OA 4ZDQA 4KXOA 1ZJPA 2WAWA 1MP4A 3CKVA 1QG8A 2VS3A 4FRMA 3Q4SA 3D98A 4HO3A 1V82A 1GA8A 3RSBA 1HV9A 1VGZA 3U2TA 4Y7FA 3I0IX 4KC2A 4Y62A 1G2VA 1H7QA 2BO4A 3U2WA 3OAMA 5C4CA 5IDSA 4G87A 2FYDB 2GGOA 1SS9A 5FV9A 1WT2A 3U0YA 1FOAA 5C47A 2FFUA 2PX7A 4AAWA 2Y7AA 1QGQA 1EYRA 3Q80A 5BXCA 4EVWA 3CKOA 2D0JA 2OI5A 1VGUA 1HM9A 1WVCA 1H5TA 2FYCB 4B2WA 4AYLA 1GX0A 1I52A 4ASYA 1JVGA 2RITA 3SX7A 1V84A 2RJ4A 1S4OA 1MC3A 3I0EA 3D8VA 4B2XA 1QGSA 4G3QA 3OH0A 2V0HA 2AM5A 5C4FA 5D92A 4EEOA 1H7LA 5FU0A 1G1LA 3I0FA 1GQ9A 1O23B 1NMMB 1R82A 1H5RA 1LZ7A 3OH1A 1NWGB 2I7BA 2Y6PA 4HO6A 1LZIA 2D7RA 1VGWA 3R2WA 4BMAA 1H3MA 5FUHA 4IRQA 4Y7UA 2O1HA 1S4PA 2PA4A 1INJA 5C4BA 2UX8A 2V0KA 2Y4MA 1H7HA 2D7IA 2RJ5A 3I0GA 1G0RA 3F1CA 2WVKA 1ZCUA 4HG6A 4KQLA 2PGYA 2YQCA 3FOQA 1ON8A 4KC1A 4Y64A 4FRQA 1H7GA 3LW6A 5CMGX 5C8RA 1NF5B 2WEEA 3U2VA 1H7FA 2FYAA 3F1YA 4K6RA 1H5RB 5CMFX 5CQNX 4CJ8A 4AYJA 1R7YA 4NAIA 2JCLA 4KRVA 5C1LA 3BRKX 1FG5N 2YQSA 3I0DA 4DE7A 3JUJA 5C1GA 4M2AA 3ZLKA 4CJBA 1MP3A 5C38A 4Y7TA 1ZI4A 1ZCYA 2OEGA 2VK9A 3FWWA 2I5KA 4G3SA 1R80A 4YS8A 2YESA 1G97A 4B42A 1PZYB 4C2SA 5CMJA 1GWWA 2VS5A 3JTJA 1H5SA 1PZTA 4B3UA 4JISA 2RJ1A 4NALA 3CGXA 2PGVA 1FXJA 2CU2A 2V0JA 1FO9A 2XWNA 4EEAA 3JUKA 2QH5A 4J18A 1G23A 3OH4A 4DDZA 4UEGA 5EJZA 1FRWA 3ZGFA 2P73A 1H5SD 3SXGA 3U2XA 2AECA 4EE5A 4GBPA 2A8WA 2RJ8A 1ZHJA 2VXMA 1JYLA 2ZU9A 3V8ZA 2VSIA 3CU0A 1G8OA 4B5BA 4HO4A 1GWVA 2XMEA 3ST8A 1HJJA 4KT7A 1VH3A 3PKPA 3U2UA 1VGTA 1FGXA 2FFVA 1HJLA 1H5SB 4AC3A 3U0XA 2DPWA 2QKXA 1JV3A 1TVYA 1LL0A 2RJ9A 4FRPA 2GGQA 2X5SA 4HO0A 3E25A 3IOIA 1ZI1A 1YP4A 4MNDA 3GUEA 5AJOA 1XZ6A 5DDVA 1WT1A 2YQJA 5C4EA 3IOHA 3O3PA 2FYBA 4EEGA 1ZI3A 4FCEA 5CQOA 1H4DA 2WE9A 4HO9A 1LZJA 1IINA 4KPXA 4D11A 5HS2A 1JVDA 3V0LA 4E1KA 3OKRA 1FO8A 2OEFA 2ZU7A 3OH2A 2WVLA 1LZ0A 2YCMA 2RJ0A 3RMWA 2VSHA 1NQIB 1W55A 3V0MA 4HO2A 1H7EA 5I1FA 1OMXA 2E8BA 1W57A 1H5TB 3OH3A 4LW3A 4P02A 3ZF8A 3I0KA 1FWYA 4M2BA 3V0PA 3CKNA 3SXBA 1O7OA 4O6MA 1H4EA 5CMIA 4HO8A 3D5NA 1XHBA 4O6NA 5C49A 3SX8A 3TZTA 1ZDFA 5C3DA 2J0AA 1VPAA 1ZJ3A 4FIXA 1NKHB 1ZJOA 1R7UA 2WVMA 4FREA 1EZIA 1HM0A 2Z87A 3SXAA 2WGZA 2Y4JA 2ZU8A 2VD4A 1VH1A 4EE4A 3N9WA 1KWSA 1GQCA 1G3LA 2AM3A 2MZBA 1OQMB 3V0OA 1FGGA 2YQHA 2JCOA 4KNRA 1VZTA 4DECA 1H5SC 1MP5A 2W0VA 2AH9A 4NAKA 5L6VA 1K4VA 2XWLA 4FQWA 2BO7A 3EE5A 1YP3A 1TW5A 1FR9A 1H4CA 2YC5A 4LW6A 3V0NA 5EIYA 1R7XA 4B4BA 3USRA 2AESA 3BCVA 2X60A 5J49A 5C3BA 2VXLA 1ZDGA 3OC9A 4CVHA 3TQDA 2AM4A 4G3PA 3I0HA 5EJ1A 2P6WA 2E3DA 2OI6A 2VS4A 2RJ7A 5IDTA 2V0LA 1G93A 4FRDA 5CQMX 2ICXA 2JCJA 5C48A 3K8EA 4FRAA 1VZUA 2VFZA 4Y9XA 4ASJA 3SPTA 1FZWA 1ZIZA 5C4DA 4B4MA 2FY7A 2BO6A 2RIZA 4FRBA 4R7PA 3V90A 4FRHA 2NXVA 3OGZA 3USQA 2RIXA 3QVBA 5C3AA 2A8UA 1S4NA 1W77A 3DJ4A 4Y7GA 4KNXA 4HO5A 4D11C 2Y4KA 2BO8A 1LVWA 2QGIA 3SX5A 2RJ6A 4Y7VA 5D91A 1IIMA 1ZJ1A 1QWJA 4JD0A 1JV1A 2C0NA 2Y4LA 1R81A 4MYBA 1WT3A 3ZGGA 3ZLLA 1JYKA 2P72A 2RIYA 4ARWA 2Q4JA 1H7TA 5AJPA 3SXCA 5FYEA 3V91A 2YC3A 1FR8A 1YROB 3DK5A 4B4GA 2O1GA 4BQHA 1VICA 3HL3A 3CKQA 4Y63A 1VM8A 1GX4A 1WT0A 5FU8A 3R3IA 3NGWA 5JQQA 4EE3A 1ZI5A 4D0ZA 5FTVA 2JCKA 4M28A 1WSZA 5IFYA 3PNNA 4IRPA 4FCUA 2ICYA 4M4KA 4FIYA 3I0LA 1R7VA 3K8DA 5CMHA 4Q7CA 1ZJ0A 1LL3A 1G9RA 3Q7UA 1O0RA 1NHEB 1FXOA 5C36A 4HCQA 3POLA 1YP2A 1TZFA 1ON6A 1Z90A 4KPZA 2J0BA 1VZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CJC A;  4P00 A;  3E26 A;  4Y6U A;  4Y6N A;  3SX3 A;  3I0C A;  2X65 A;  3KIA A;  2OI7 A;  3SXD A;  4EEM A;  4L41 C;  5CQP A;  1LL2 A;  2O1F A;  4NAN A;  1TW1 A;  2X5Z A;  2Z86 A;  3CKJ A;  1INI A;  1OMZ A;  3V8Y A;  1R7T A;  2XMH A;  4KC4 A;  3I0J A;  3T7N A;  5DDT A;  4D0T A;  3PKQ A;  2V0I A;  4D48 A;  4HOC A;  3IOJ A;  1ZCT A;  1ZCV A;  2W0W A;  4FRO A;  5CQL X;  1HM8 A;  2AGD A;  2AE7 A;  1ZJ2 A;  5C1H A;  1O7Q A;  5L6S A;  1V83 A;  2I5E A;  5FTS A;  3DUV A;  3RMV A;  1G95 A;  3T7M A;  4FRL A;  2XWM A;  3SXE A;  3V0Q A;  1E5K A;  4XWI A;  4ECM A;  2APC A;  5AJN A;  3T7O A;  4ZDQ A;  4KXO A;  1ZJP A;  2WAW A;  1MP4 A;  3CKV A;  1QG8 A;  2VS3 A;  4FRM A;  3Q4S A;  3D98 A;  4HO3 A;  1V82 A;  1GA8 A;  3RSB A;  1HV9 A;  1VGZ A;  3U2T A;  4Y7F A;  3I0I X;  4KC2 A;  4Y62 A;  1G2V A;  1H7Q A;  2BO4 A;  3U2W A;  3OAM A;  5C4C A;  5IDS A;  4G87 A;  2FYD B;  2GGO A;  1SS9 A;  5FV9 A;  1WT2 A;  3U0Y A;  1FOA A;  5C47 A;  2FFU A;  2PX7 A;  4AAW A;  2Y7A A;  1QGQ A;  1EYR A;  3Q80 A;  5BXC A;  4EVW A;  3CKO A;  2D0J A;  2OI5 A;  1VGU A;  1HM9 A;  1WVC A;  1H5T A;  2FYC B;  4B2W A;  4AYL A;  1GX0 A;  1I52 A;  4ASY A;  1JVG A;  2RIT A;  3SX7 A;  1V84 A;  2RJ4 A;  1S4O A;  1MC3 A;  3I0E A;  3D8V A;  4B2X A;  1QGS A;  4G3Q A;  3OH0 A;  2V0H A;  2AM5 A;  5C4F A;  4EEO A;  1H7L A;  5FU0 A;  1G1L A;  3I0F A;  1GQ9 A;  1O23 B;  1NMM B;  1R82 A;  1H5R A;  1LZ7 A;  3OH1 A;  1NWG B;  2I7B A;  2Y6P A;  4HO6 A;  1LZI A;  2D7R A;  1VGW A;  3R2W A;  4BMA A;  1H3M A;  5FUH A;  4IRQ A;  4Y7U A;  2O1H A;  1S4P A;  2PA4 A;  1INJ A;  5C4B A;  2UX8 A;  2V0K A;  2Y4M A;  1H7H A;  2D7I A;  2RJ5 A;  3I0G A;  1G0R A;  3F1C A;  2WVK A;  1ZCU A;  4HG6 A;  4KQL A;  2PGY A;  2YQC A;  3FOQ A;  1ON8 A;  4KC1 A;  4Y64 A;  4FRQ A;  1H7G A;  3LW6 A;  5CMG X;  5C8R A;  1NF5 B;  2WEE A;  3U2V A;  1H7F A;  2FYA A;  3F1Y A;  4K6R A;  1H5R B;  5CMF X;  5CQN X;  4CJ8 A;  4AYJ A;  1R7Y A;  4NAI A;  2JCL A;  4KRV A;  5C1L A;  3BRK X;  1FG5 N;  2YQS A;  3I0D A;  4DE7 A;  3JUJ A;  5C1G A;  4M2A A;  3ZLK A;  4CJB A;  1MP3 A;  5C38 A;  4Y7T A;  1ZI4 A;  1ZCY A;  2OEG A;  3FWW A;  2I5K A;  4G3S A;  1R80 A;  4YS8 A;  2YES A;  1G97 A;  4B42 A;  1PZY B;  4C2S A;  5CMJ A;  1GWW A;  2VS5 A;  3JTJ A;  1H5S A;  1PZT A;  4B3U A;  4JIS A;  2RJ1 A;  4NAL A;  3CGX A;  2PGV A;  1FXJ A;  2CU2 A;  2V0J A;  1FO9 A;  2XWN A;  4EEA A;  3JUK A;  2QH5 A;  4J18 A;  1G23 A;  3OH4 A;  4DDZ A;  4UEG A;  5EJZ A;  1FRW A;  3ZGF A;  2P73 A;  1H5S D;  3SXG A;  3U2X A;  2AEC A;  4EE5 A;  4GBP A;  2A8W A;  2RJ8 A;  1ZHJ A;  2VXM A;  1JYL A;  2ZU9 A;  3V8Z A;  2VSI A;  3CU0 A;  1G8O A;  4B5B A;  4HO4 A;  1GWV A;  2XME A;  3ST8 A;  1HJJ A;  4KT7 A;  1VH3 A;  3PKP A;  3U2U A;  1VGT A;  1FGX A;  2FFV A;  1HJL A;  1H5S B;  4AC3 A;  3U0X A;  2DPW A;  2QKX A;  1JV3 A;  1TVY A;  1LL0 A;  2RJ9 A;  4FRP A;  2GGQ A;  2X5S A;  4HO0 A;  3E25 A;  3IOI A;  1ZI1 A;  1YP4 A;  4MND A;  3GUE A;  5AJO A;  1XZ6 A;  5DDV A;  1WT1 A;  2YQJ A;  5C4E A;  3IOH A;  3O3P A;  2FYB A;  4EEG A;  1ZI3 A;  4FCE A;  5CQO A;  1H4D A;  2WE9 A;  4HO9 A;  1LZJ A;  1IIN A;  4KPX A;  4D11 A;  5HS2 A;  1JVD A;  3V0L A;  4E1K A;  3OKR A;  1FO8 A;  2OEF A;  2ZU7 A;  3OH2 A;  2WVL A;  1LZ0 A;  2YCM A;  2RJ0 A;  3RMW A;  2VSH A;  1NQI B;  1W55 A;  3V0M A;  4HO2 A;  1H7E A;  5I1F A;  1OMX A;  2E8B A;  1W57 A;  1H5T B;  3OH3 A;  4LW3 A;  4P02 A;  3ZF8 A;  3I0K A;  1FWY A;  4M2B A;  3V0P A;  3CKN A;  3SXB A;  1O7O A;  1H4E A;  5CMI A;  4HO8 A;  3D5N A;  1XHB A;  5C49 A;  3SX8 A;  3TZT A;  1ZDF A;  5C3D A;  1VPA A;  1ZJ3 A;  1NKH B;  1ZJO A;  1R7U A;  2WVM A;  4FRE A;  1EZI A;  1HM0 A;  2Z87 A;  3SXA A;  2WGZ A;  2Y4J A;  2ZU8 A;  2VD4 A;  1VH1 A;  4EE4 A;  3N9W A;  1KWS A;  1GQC A;  1G3L A;  2AM3 A;  2MZB A;  1OQM B;  3V0O A;  1FGG A;  2YQH A;  2JCO A;  4KNR A;  1VZT A;  4DEC A;  1H5S C;  1MP5 A;  2W0V A;  2AH9 A;  4NAK A;  5L6V A;  1K4V A;  2XWL A;  4FQW A;  2BO7 A;  3EE5 A;  1YP3 A;  1TW5 A;  1FR9 A;  1H4C A;  2YC5 A;  4LW6 A;  3V0N A;  5EIY A;  1R7X A;  4B4B A;  3USR A;  2AES A;  3BCV A;  2X60 A;  5J49 A;  5C3B A;  2VXL A;  1ZDG A;  3OC9 A;  4CVH A;  3TQD A;  2AM4 A;  4G3P A;  3I0H A;  5EJ1 A;  2P6W A;  2E3D A;  2OI6 A;  2VS4 A;  2RJ7 A;  5IDT A;  2V0L A;  1G93 A;  4FRD A;  5CQM X;  2ICX A;  2JCJ A;  5C48 A;  3K8E A;  4FRA A;  1VZU A;  2VFZ A;  4Y9X A;  4ASJ A;  3SPT A;  1FZW A;  1ZIZ A;  5C4D A;  4B4M A;  2FY7 A;  2BO6 A;  2RIZ A;  4FRB A;  4R7P A;  3V90 A;  4FRH A;  2NXV A;  3OGZ A;  3USQ A;  2RIX A;  3QVB A;  5C3A A;  2A8U A;  1S4N A;  1W77 A;  3DJ4 A;  4Y7G A;  4KNX A;  4HO5 A;  4D11 C;  2Y4K A;  2BO8 A;  1LVW A;  2QGI A;  3SX5 A;  2RJ6 A;  4Y7V A;  1IIM A;  1ZJ1 A;  1QWJ A;  4JD0 A;  1JV1 A;  2Y4L A;  1R81 A;  4MYB A;  1WT3 A;  3ZGG A;  3ZLL A;  1JYK A;  2P72 A;  2RIY A;  4ARW A;  2Q4J A;  1H7T A;  5AJP A;  3SXC A;  5FYE A;  3V91 A;  2YC3 A;  1FR8 A;  1YRO B;  3DK5 A;  4B4G A;  2O1G A;  4BQH A;  1VIC A;  3HL3 A;  3CKQ A;  4Y63 A;  1VM8 A;  1GX4 A;  1WT0 A;  5FU8 A;  3R3I A;  3NGW A;  5JQQ A;  4EE3 A;  1ZI5 A;  4D0Z A;  5FTV A;  2JCK A;  4M28 A;  1WSZ A;  5IFY A;  3PNN A;  4IRP A;  4FCU A;  2ICY A;  4M4K A;  3I0L A;  1R7V A;  3K8D A;  5CMH A;  1ZJ0 A;  1LL3 A;  1G9R A;  3Q7U A;  1O0R A;  1NHE B;  1FXO A;  5C36 A;  4HCQ A;  3POL A;  1YP2 A;  1TZF A;  1ON6 A;  1Z90 A;  4KPZ A;  1VZX A; 
#chains in the Genus database with same CATH topology
 4CJC A;  4P00 A;  3E26 A;  4Y6U A;  4Y6N A;  3SX3 A;  3I0C A;  2X65 A;  3KIA A;  2OI7 A;  3SXD A;  4EEM A;  4MIX A;  4L41 C;  5CQP A;  1LL2 A;  2O1F A;  4NAN A;  1TW1 A;  2X5Z A;  2Z86 A;  3CKJ A;  1INI A;  1OMZ A;  3V8Y A;  1R7T A;  2XMH A;  4KC4 A;  3I0J A;  3T7N A;  5DDT A;  4D0T A;  3PKQ A;  2V0I A;  4D48 A;  4HOC A;  3IOJ A;  1ZCT A;  1ZCV A;  2W0W A;  4FRO A;  5CQL X;  1HM8 A;  2AGD A;  2AE7 A;  1ZJ2 A;  5C1H A;  1O7Q A;  5L6S A;  1V83 A;  2I5E A;  5FTS A;  3DUV A;  3RMV A;  1G95 A;  3T7M A;  4FRL A;  2XWM A;  3SXE A;  3V0Q A;  1E5K A;  4XWI A;  4ECM A;  2APC A;  5AJN A;  3T7O A;  4ZDQ A;  4KXO A;  1ZJP A;  2WAW A;  1MP4 A;  3CKV A;  1QG8 A;  2VS3 A;  4FRM A;  3Q4S A;  3D98 A;  4HO3 A;  1V82 A;  1GA8 A;  3RSB A;  1HV9 A;  1VGZ A;  3U2T A;  4Y7F A;  3I0I X;  4KC2 A;  4Y62 A;  1G2V A;  1H7Q A;  2BO4 A;  3U2W A;  3OAM A;  5C4C A;  5IDS A;  4G87 A;  2FYD B;  2GGO A;  1SS9 A;  5FV9 A;  1WT2 A;  3U0Y A;  1FOA A;  5C47 A;  2FFU A;  2PX7 A;  4AAW A;  2Y7A A;  1QGQ A;  1EYR A;  3Q80 A;  5BXC A;  4EVW A;  3CKO A;  2D0J A;  2OI5 A;  1VGU A;  1HM9 A;  1WVC A;  1H5T A;  2FYC B;  4B2W A;  4AYL A;  1GX0 A;  1I52 A;  4ASY A;  1JVG A;  2RIT A;  3SX7 A;  1V84 A;  2RJ4 A;  1S4O A;  1MC3 A;  3I0E A;  3D8V A;  4B2X A;  1QGS A;  4G3Q A;  3OH0 A;  2V0H A;  2AM5 A;  5C4F A;  5D92 A;  4EEO A;  1H7L A;  5FU0 A;  1G1L A;  3I0F A;  1GQ9 A;  1O23 B;  1NMM B;  1R82 A;  1H5R A;  1LZ7 A;  3OH1 A;  1NWG B;  2I7B A;  2Y6P A;  4HO6 A;  1LZI A;  2D7R A;  1VGW A;  3R2W A;  4BMA A;  1H3M A;  5FUH A;  4IRQ A;  4Y7U A;  2O1H A;  1S4P A;  2PA4 A;  1INJ A;  5C4B A;  2UX8 A;  2V0K A;  2Y4M A;  1H7H A;  2D7I A;  2RJ5 A;  3I0G A;  1G0R A;  3F1C A;  2WVK A;  1ZCU A;  4HG6 A;  4KQL A;  2PGY A;  2YQC A;  3FOQ A;  1ON8 A;  4KC1 A;  4Y64 A;  4FRQ A;  1H7G A;  3LW6 A;  5CMG X;  5C8R A;  1NF5 B;  2WEE A;  3U2V A;  1H7F A;  2FYA A;  3F1Y A;  4K6R A;  1H5R B;  5CMF X;  5CQN X;  4CJ8 A;  4AYJ A;  1R7Y A;  4NAI A;  2JCL A;  4KRV A;  5C1L A;  3BRK X;  1FG5 N;  2YQS A;  3I0D A;  4DE7 A;  3JUJ A;  5C1G A;  4M2A A;  3ZLK A;  4CJB A;  1MP3 A;  5C38 A;  4Y7T A;  1ZI4 A;  1ZCY A;  2OEG A;  2VK9 A;  3FWW A;  2I5K A;  4G3S A;  1R80 A;  4YS8 A;  2YES A;  1G97 A;  4B42 A;  1PZY B;  4C2S A;  5CMJ A;  1GWW A;  2VS5 A;  3JTJ A;  1H5S A;  1PZT A;  4B3U A;  4JIS A;  2RJ1 A;  4NAL A;  3CGX A;  2PGV A;  1FXJ A;  2CU2 A;  2V0J A;  1FO9 A;  2XWN A;  4EEA A;  3JUK A;  2QH5 A;  4J18 A;  1G23 A;  3OH4 A;  4DDZ A;  4UEG A;  5EJZ A;  1FRW A;  3ZGF A;  2P73 A;  1H5S D;  3SXG A;  3U2X A;  2AEC A;  4EE5 A;  4GBP A;  2A8W A;  2RJ8 A;  1ZHJ A;  2VXM A;  1JYL A;  2ZU9 A;  3V8Z A;  2VSI A;  3CU0 A;  1G8O A;  4B5B A;  4HO4 A;  1GWV A;  2XME A;  3ST8 A;  1HJJ A;  4KT7 A;  1VH3 A;  3PKP A;  3U2U A;  1VGT A;  1FGX A;  2FFV A;  1HJL A;  1H5S B;  4AC3 A;  3U0X A;  2DPW A;  2QKX A;  1JV3 A;  1TVY A;  1LL0 A;  2RJ9 A;  4FRP A;  2GGQ A;  2X5S A;  4HO0 A;  3E25 A;  3IOI A;  1ZI1 A;  1YP4 A;  4MND A;  3GUE A;  5AJO A;  1XZ6 A;  5DDV A;  1WT1 A;  2YQJ A;  5C4E A;  3IOH A;  3O3P A;  2FYB A;  4EEG A;  1ZI3 A;  4FCE A;  5CQO A;  1H4D A;  2WE9 A;  4HO9 A;  1LZJ A;  1IIN A;  4KPX A;  4D11 A;  5HS2 A;  1JVD A;  3V0L A;  4E1K A;  3OKR A;  1FO8 A;  2OEF A;  2ZU7 A;  3OH2 A;  2WVL A;  1LZ0 A;  2YCM A;  2RJ0 A;  3RMW A;  2VSH A;  1NQI B;  1W55 A;  3V0M A;  4HO2 A;  1H7E A;  5I1F A;  1OMX A;  2E8B A;  1W57 A;  1H5T B;  3OH3 A;  4LW3 A;  4P02 A;  3ZF8 A;  3I0K A;  1FWY A;  4M2B A;  3V0P A;  3CKN A;  3SXB A;  1O7O A;  4O6M A;  1H4E A;  5CMI A;  4HO8 A;  3D5N A;  1XHB A;  4O6N A;  5C49 A;  3SX8 A;  3TZT A;  1ZDF A;  5C3D A;  2J0A A;  1VPA A;  1ZJ3 A;  4FIX A;  1NKH B;  1ZJO A;  1R7U A;  2WVM A;  4FRE A;  1EZI A;  1HM0 A;  2Z87 A;  3SXA A;  2WGZ A;  2Y4J A;  2ZU8 A;  2VD4 A;  1VH1 A;  4EE4 A;  3N9W A;  1KWS A;  1GQC A;  1G3L A;  2AM3 A;  2MZB A;  1OQM B;  3V0O A;  1FGG A;  2YQH A;  2JCO A;  4KNR A;  1VZT A;  4DEC A;  1H5S C;  1MP5 A;  2W0V A;  2AH9 A;  4NAK A;  5L6V A;  1K4V A;  2XWL A;  4FQW A;  2BO7 A;  3EE5 A;  1YP3 A;  1TW5 A;  1FR9 A;  1H4C A;  2YC5 A;  4LW6 A;  3V0N A;  5EIY A;  1R7X A;  4B4B A;  3USR A;  2AES A;  3BCV A;  2X60 A;  5J49 A;  5C3B A;  2VXL A;  1ZDG A;  3OC9 A;  4CVH A;  3TQD A;  2AM4 A;  4G3P A;  3I0H A;  5EJ1 A;  2P6W A;  2E3D A;  2OI6 A;  2VS4 A;  2RJ7 A;  5IDT A;  2V0L A;  1G93 A;  4FRD A;  5CQM X;  2ICX A;  2JCJ A;  5C48 A;  3K8E A;  4FRA A;  1VZU A;  2VFZ A;  4Y9X A;  4ASJ A;  3SPT A;  1FZW A;  1ZIZ A;  5C4D A;  4B4M A;  2FY7 A;  2BO6 A;  2RIZ A;  4FRB A;  4R7P A;  3V90 A;  4FRH A;  2NXV A;  3OGZ A;  3USQ A;  2RIX A;  3QVB A;  5C3A A;  2A8U A;  1S4N A;  1W77 A;  3DJ4 A;  4Y7G A;  4KNX A;  4HO5 A;  4D11 C;  2Y4K A;  2BO8 A;  1LVW A;  2QGI A;  3SX5 A;  2RJ6 A;  4Y7V A;  5D91 A;  1IIM A;  1ZJ1 A;  1QWJ A;  4JD0 A;  1JV1 A;  2C0N A;  2Y4L A;  1R81 A;  4MYB A;  1WT3 A;  3ZGG A;  3ZLL A;  1JYK A;  2P72 A;  2RIY A;  4ARW A;  2Q4J A;  1H7T A;  5AJP A;  3SXC A;  5FYE A;  3V91 A;  2YC3 A;  1FR8 A;  1YRO B;  3DK5 A;  4B4G A;  2O1G A;  4BQH A;  1VIC A;  3HL3 A;  3CKQ A;  4Y63 A;  1VM8 A;  1GX4 A;  1WT0 A;  5FU8 A;  3R3I A;  3NGW A;  5JQQ A;  4EE3 A;  1ZI5 A;  4D0Z A;  5FTV A;  2JCK A;  4M28 A;  1WSZ A;  5IFY A;  3PNN A;  4IRP A;  4FCU A;  2ICY A;  4M4K A;  4FIY A;  3I0L A;  1R7V A;  3K8D A;  5CMH A;  4Q7C A;  1ZJ0 A;  1LL3 A;  1G9R A;  3Q7U A;  1O0R A;  1NHE B;  1FXO A;  5C36 A;  4HCQ A;  3POL A;  1YP2 A;  1TZF A;  1ON6 A;  1Z90 A;  4KPZ A;  2J0B A;  1VZX A; 
#chains in the Genus database with same CATH homology
 4CJC A;  4P00 A;  3E26 A;  4Y6U A;  4Y6N A;  3SX3 A;  3I0C A;  2X65 A;  3KIA A;  2OI7 A;  3SXD A;  4EEM A;  4MIX A;  4L41 C;  5CQP A;  1LL2 A;  2O1F A;  4NAN A;  1TW1 A;  2X5Z A;  2Z86 A;  3CKJ A;  1INI A;  1OMZ A;  3V8Y A;  1R7T A;  2XMH A;  4KC4 A;  3I0J A;  3T7N A;  5DDT A;  4D0T A;  3PKQ A;  2V0I A;  4D48 A;  4HOC A;  3IOJ A;  1ZCT A;  1ZCV A;  2W0W A;  4FRO A;  5CQL X;  1HM8 A;  2AGD A;  2AE7 A;  1ZJ2 A;  5C1H A;  1O7Q A;  5L6S A;  1V83 A;  2I5E A;  5FTS A;  3DUV A;  3RMV A;  1G95 A;  3T7M A;  4FRL A;  2XWM A;  3SXE A;  3V0Q A;  1E5K A;  4XWI A;  4ECM A;  2APC A;  5AJN A;  3T7O A;  4ZDQ A;  4KXO A;  1ZJP A;  2WAW A;  1MP4 A;  3CKV A;  1QG8 A;  2VS3 A;  4FRM A;  3Q4S A;  3D98 A;  4HO3 A;  1V82 A;  1GA8 A;  3RSB A;  1HV9 A;  1VGZ A;  3U2T A;  4Y7F A;  3I0I X;  4KC2 A;  4Y62 A;  1G2V A;  1H7Q A;  2BO4 A;  3U2W A;  3OAM A;  5C4C A;  5IDS A;  4G87 A;  2FYD B;  2GGO A;  1SS9 A;  5FV9 A;  1WT2 A;  3U0Y A;  1FOA A;  5C47 A;  2FFU A;  2PX7 A;  4AAW A;  2Y7A A;  1QGQ A;  1EYR A;  3Q80 A;  5BXC A;  4EVW A;  3CKO A;  2D0J A;  2OI5 A;  1VGU A;  1HM9 A;  1WVC A;  1H5T A;  2FYC B;  4B2W A;  4AYL A;  1GX0 A;  1I52 A;  4ASY A;  1JVG A;  2RIT A;  3SX7 A;  1V84 A;  2RJ4 A;  1S4O A;  1MC3 A;  3I0E A;  3D8V A;  4B2X A;  1QGS A;  4G3Q A;  3OH0 A;  2V0H A;  2AM5 A;  5C4F A;  5D92 A;  4EEO A;  1H7L A;  5FU0 A;  1G1L A;  3I0F A;  1GQ9 A;  1O23 B;  1NMM B;  1R82 A;  1H5R A;  1LZ7 A;  3OH1 A;  1NWG B;  2I7B A;  2Y6P A;  4HO6 A;  1LZI A;  2D7R A;  1VGW A;  3R2W A;  4BMA A;  1H3M A;  5FUH A;  4IRQ A;  4Y7U A;  2O1H A;  1S4P A;  2PA4 A;  1INJ A;  5C4B A;  2UX8 A;  2V0K A;  2Y4M A;  1H7H A;  2D7I A;  2RJ5 A;  3I0G A;  1G0R A;  3F1C A;  2WVK A;  1ZCU A;  4HG6 A;  4KQL A;  2PGY A;  2YQC A;  3FOQ A;  1ON8 A;  4KC1 A;  4Y64 A;  4FRQ A;  1H7G A;  3LW6 A;  5CMG X;  5C8R A;  1NF5 B;  2WEE A;  3U2V A;  1H7F A;  2FYA A;  3F1Y A;  4K6R A;  1H5R B;  5CMF X;  5CQN X;  4CJ8 A;  4AYJ A;  1R7Y A;  4NAI A;  2JCL A;  4KRV A;  5C1L A;  3BRK X;  1FG5 N;  2YQS A;  3I0D A;  4DE7 A;  3JUJ A;  5C1G A;  4M2A A;  3ZLK A;  4CJB A;  1MP3 A;  5C38 A;  4Y7T A;  1ZI4 A;  1ZCY A;  2OEG A;  2VK9 A;  3FWW A;  2I5K A;  4G3S A;  1R80 A;  4YS8 A;  2YES A;  1G97 A;  4B42 A;  1PZY B;  4C2S A;  5CMJ A;  1GWW A;  2VS5 A;  3JTJ A;  1H5S A;  1PZT A;  4B3U A;  4JIS A;  2RJ1 A;  4NAL A;  3CGX A;  2PGV A;  1FXJ A;  2CU2 A;  2V0J A;  1FO9 A;  2XWN A;  4EEA A;  3JUK A;  2QH5 A;  4J18 A;  1G23 A;  3OH4 A;  4DDZ A;  4UEG A;  5EJZ A;  1FRW A;  3ZGF A;  2P73 A;  1H5S D;  3SXG A;  3U2X A;  2AEC A;  4EE5 A;  4GBP A;  2A8W A;  2RJ8 A;  1ZHJ A;  2VXM A;  1JYL A;  2ZU9 A;  3V8Z A;  2VSI A;  3CU0 A;  1G8O A;  4B5B A;  4HO4 A;  1GWV A;  2XME A;  3ST8 A;  1HJJ A;  4KT7 A;  1VH3 A;  3PKP A;  3U2U A;  1VGT A;  1FGX A;  2FFV A;  1HJL A;  1H5S B;  4AC3 A;  3U0X A;  2DPW A;  2QKX A;  1JV3 A;  1TVY A;  1LL0 A;  2RJ9 A;  4FRP A;  2GGQ A;  2X5S A;  4HO0 A;  3E25 A;  3IOI A;  1ZI1 A;  1YP4 A;  4MND A;  3GUE A;  5AJO A;  1XZ6 A;  5DDV A;  1WT1 A;  2YQJ A;  5C4E A;  3IOH A;  3O3P A;  2FYB A;  4EEG A;  1ZI3 A;  4FCE A;  5CQO A;  1H4D A;  2WE9 A;  4HO9 A;  1LZJ A;  1IIN A;  4KPX A;  4D11 A;  5HS2 A;  1JVD A;  3V0L A;  4E1K A;  3OKR A;  1FO8 A;  2OEF A;  2ZU7 A;  3OH2 A;  2WVL A;  1LZ0 A;  2YCM A;  2RJ0 A;  3RMW A;  2VSH A;  1NQI B;  1W55 A;  3V0M A;  4HO2 A;  1H7E A;  5I1F A;  1OMX A;  2E8B A;  1W57 A;  1H5T B;  3OH3 A;  4LW3 A;  4P02 A;  3ZF8 A;  3I0K A;  1FWY A;  4M2B A;  3V0P A;  3CKN A;  3SXB A;  1O7O A;  4O6M A;  1H4E A;  5CMI A;  4HO8 A;  3D5N A;  1XHB A;  4O6N A;  5C49 A;  3SX8 A;  3TZT A;  1ZDF A;  5C3D A;  2J0A A;  1VPA A;  1ZJ3 A;  4FIX A;  1NKH B;  1ZJO A;  1R7U A;  2WVM A;  4FRE A;  1EZI A;  1HM0 A;  2Z87 A;  3SXA A;  2WGZ A;  2Y4J A;  2ZU8 A;  2VD4 A;  1VH1 A;  4EE4 A;  3N9W A;  1KWS A;  1GQC A;  1G3L A;  2AM3 A;  2MZB A;  1OQM B;  3V0O A;  1FGG A;  2YQH A;  2JCO A;  4KNR A;  1VZT A;  4DEC A;  1H5S C;  1MP5 A;  2W0V A;  2AH9 A;  4NAK A;  5L6V A;  1K4V A;  2XWL A;  4FQW A;  2BO7 A;  3EE5 A;  1YP3 A;  1TW5 A;  1FR9 A;  1H4C A;  2YC5 A;  4LW6 A;  3V0N A;  5EIY A;  1R7X A;  4B4B A;  3USR A;  2AES A;  3BCV A;  2X60 A;  5J49 A;  5C3B A;  2VXL A;  1ZDG A;  3OC9 A;  4CVH A;  3TQD A;  2AM4 A;  4G3P A;  3I0H A;  5EJ1 A;  2P6W A;  2E3D A;  2OI6 A;  2VS4 A;  2RJ7 A;  5IDT A;  2V0L A;  1G93 A;  4FRD A;  5CQM X;  2ICX A;  2JCJ A;  5C48 A;  3K8E A;  4FRA A;  1VZU A;  2VFZ A;  4Y9X A;  4ASJ A;  3SPT A;  1FZW A;  1ZIZ A;  5C4D A;  4B4M A;  2FY7 A;  2BO6 A;  2RIZ A;  4FRB A;  4R7P A;  3V90 A;  4FRH A;  2NXV A;  3OGZ A;  3USQ A;  2RIX A;  3QVB A;  5C3A A;  2A8U A;  1S4N A;  1W77 A;  3DJ4 A;  4Y7G A;  4KNX A;  4HO5 A;  4D11 C;  2Y4K A;  2BO8 A;  1LVW A;  2QGI A;  3SX5 A;  2RJ6 A;  4Y7V A;  5D91 A;  1IIM A;  1ZJ1 A;  1QWJ A;  4JD0 A;  1JV1 A;  2C0N A;  2Y4L A;  1R81 A;  4MYB A;  1WT3 A;  3ZGG A;  3ZLL A;  1JYK A;  2P72 A;  2RIY A;  4ARW A;  2Q4J A;  1H7T A;  5AJP A;  3SXC A;  5FYE A;  3V91 A;  2YC3 A;  1FR8 A;  1YRO B;  3DK5 A;  4B4G A;  2O1G A;  4BQH A;  1VIC A;  3HL3 A;  3CKQ A;  4Y63 A;  1VM8 A;  1GX4 A;  1WT0 A;  5FU8 A;  3R3I A;  3NGW A;  5JQQ A;  4EE3 A;  1ZI5 A;  4D0Z A;  5FTV A;  2JCK A;  4M28 A;  1WSZ A;  5IFY A;  3PNN A;  4IRP A;  4FCU A;  2ICY A;  4M4K A;  4FIY A;  3I0L A;  1R7V A;  3K8D A;  5CMH A;  4Q7C A;  1ZJ0 A;  1LL3 A;  1G9R A;  3Q7U A;  1O0R A;  1NHE B;  1FXO A;  5C36 A;  4HCQ A;  3POL A;  1YP2 A;  1TZF A;  1ON6 A;  1Z90 A;  4KPZ A;  2J0B A;  1VZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...