4KC1A

Structure of the blood group glycosyltransferase aaglyb in complex with a pyridine inhibitor as a neutral pyrophosphate surrogate
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
289
structure length
289
Chain Sequence
AIGEFMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYGGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase
publication title Design of glycosyltransferase inhibitors: pyridine as a pyrophosphate surrogate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 96
structure length 289
sequence length 289
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2013-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4kc1A00
3DK5A 1WT1A 2VXLA 2Z86A 5HS2A 1GWVA 1FOAA 3V0MA 4K6RA 4FRAA 4KC2A 3JUKA 1FXOA 1HM9A 4D0ZA 3V0QA 1ON8A 2V0KA 4B4MA 4KPXA 4Y6UA 5CQMX 1FGGA 2OEFA 2XWLA 3U2VA 1VH3A 1QGQA 5CQNX 3BCVA 2QKXA 1YROB 4B5BA 3T7NA 1LZ7A 2RJ5A 4NANA 5FTSA 1FWYA 1R7XA 3N9WA 3I0LA 3SPTA 3HL3A 2P73A 4HO0A 1NWGB 2A8WA 4EEGA 4KC4A 3D5NA 1HJLA 2RJ6A 3K8DA 1IIMA 3SXBA 4Y7VA 4GBPA 3USQA 1NMMB 1FO8A 3E26A 1W57A 4DDZA 5IDTA 3TZTA 2WEEA 1HM0A 3OH0A 4KNXA 3Q4SA 1H4EA 3SXEA 4EEAA 3OH3A 2X5SA 5C4DA 3SXGA 3Q7UA 3CU0A 1S4OA 1G97A 2YC3A 3FWWA 2WAWA 2FYDB 3DUVA 1FRWA 1VGZA 4IRQA 2I7BA 4UEGA 4B2WA 2RJ1A 2VS5A 5DDVA 2MZBA 4FCUA 1TZFA 1G0RA 5FU0A 2FFUA 4MYBA 4Y7TA 1H5SD 4LW6A 2D0JA 2PA4A 1LL2A 2BO6A 1I52A 5FV9A 1IINA 4YS8A 2BO7A 2AM5A 4L41C 2OEGA 2AGDA 5EJ1A 2RIXA 1H5RA 3JUJA 3DJ4A 2O1GA 2FYBA 1QWJA 3SX8A 1HM8A 5C1HA 1MP5A 4M28A 4JD0A 3QVBA 1OMZA 5C3AA 1H4DA 4B4BA 1TW1A 3CKNA 2ZU7A 1ZJ2A 4FREA 3U0YA 1TW5A 1ZJ0A 3I0FA 5FUHA 2D7RA 2Q4JA 3E25A 1GQCA 2OI7A 2RITA 1R7UA 1VZXA 1R7TA 4B2XA 3RMWA 4Y6NA 1SS9A 2I5EA 4B42A 2VSHA 2VFZA 2V0HA 1H3MA 1H5SB 2W0WA 2XMHA 3CGXA 2FYAA 2RJ7A 5FYEA 4ASYA 4Y9XA 3ZGFA 4NALA 1ON6A 5IFYA 2RIYA 1H7HA 1MP4A 2UX8A 3I0IX 4DE7A 1ZDGA 4EE4A 2XMEA 2Z87A 2RJ0A 4EVWA 2FYCB 1VGTA 2Y4JA 2WVMA 3ZF8A 1H7EA 4C2SA 4AYLA 4NAIA 5CQLX 4M4KA 1VGWA 4FRHA 3R2WA 2JCKA 2ZU8A 4EE3A 1GX0A 1MP3A 4AC3A 4Y64A 5C47A 4HO9A 3SXAA 1YP3A 1HV9A 1VH1A 3RSBA 4Y62A 1O0RA 1ZHJA 2RIZA 1R80A 2FFVA 3U2UA 4HO3A 1W55A 2E3DA 2YESA 5AJPA 4G3SA 1LZIA 2XWNA 1G3LA 5C36A 2YQJA 2D7IA 4B4GA 4HG6A 1ZI1A 1FG5N 3F1CA 4LW3A 4ECMA 1HJJA 1S4PA 3OC9A 5C48A 3T7OA 1G95A 1ZCTA 4HO2A 4HCQA 5BXCA 4EEMA 2PGYA 1G8OA 4D11A 2OI5A 4G3PA 2PGVA 4ARWA 4XWIA 5CQOA 1GA8A 1ZJ3A 4EE5A 1ZI3A 3IOJA 1EYRA 1O23B 4HO5A 5C4FA 2WVLA 1PZTA 2Y4MA 2AECA 2OI6A 1QG8A 2VS3A 3OGZA 4J18A 4Y63A 1KWSA 2PX7A 2CU2A 1YP4A 1ZJOA 5CMIA 4D48A 4KC1A 5CMFX 4HO6A 1H5TB 3TQDA 4CJCA 1FGXA 5C1LA 3CKQA 4FCEA 4M2BA 5C4CA 1LZJA 1FO9A 1VICA 3I0EA 4CJBA 5L6VA 3U2WA 1S4NA 3ZGGA 1H7GA 1GQ9A 5C3DA 3LW6A 3K8EA 1H5SA 4G87A 1G2VA 4FRQA 3T7MA 4E1KA 1YP2A 3U2TA 2WE9A 4FROA 2RJ8A 1LZ0A 4BMAA 1NHEB 3V0LA 1ZDFA 1R82A 1LL3A 2ICXA 4Y7GA 1JYKA 2GGOA 2Y4KA 1OQMB 1GWWA 2ZU9A 3IOHA 2X60A 4FQWA 2YCMA 2AM4A 4HO8A 1VPAA 5AJNA 4KRVA 4Y7FA 2GGQA 2QGIA 1WT0A 3OAMA 1E5KA 3ZLKA 2DPWA 3F1YA 1MC3A 3I0CA 4M2AA 5C1GA 1V84A 4NAKA 5JQQA 1OMXA 3I0DA 2Y4LA 4FRBA 1WT3A 1H7LA 2YQCA 4HO4A 3D98A 3OH2A 4HOCA 2O1HA 1H7QA 3SX5A 4FRDA 3RMVA 1FXJA 4CVHA 3V91A 1JVDA 2JCJA 2VSIA 4KQLA 1ZJPA 3CKJA 2WGZA 5IDSA 2RJ9A 1VZUA 3PKPA 3CKVA 3BRKX 3PNNA 4D11C 3U2XA 3PKQA 2ICYA 1JYLA 2A8UA 2VXMA 3V8ZA 1JVGA 4KT7A 3ZLLA 1GX4A 2VS4A 1ZCYA 2JCLA 1JV1A 2P6WA 2P72A 2JCOA 1K4VA 1G93A 2V0IA 3OH1A 5C8RA 4FRPA 3O3PA 2YC5A 1FR9A 1H5TA 1WSZA 3USRA 4FRMA 5I1FA 4G3QA 1LL0A 1LVWA 3Q80A 4P02A 2VD4A 5C38A 3ST8A 3SXDA 2AM3A 1XZ6A 1W77A 4AAWA 5DDTA 1WVCA 5EIYA 5AJOA 2X65A 1ZCUA 4KXOA 3V90A 2Y7AA 2V0JA 1O7OA 1G1LA 4MNDA 4DECA 3NGWA 2I5KA 1ZIZA 1H5SC 3V8YA 1INJA 1NKHB 1H4CA 2NXVA 3I0JA 4ZDQA 1ZJ1A 2WVKA 5FU8A 1FR8A 3POLA 1H7FA 3V0PA 1FZWA 1ZI4A 5C3BA 3SX7A 5CQPA 4R7PA 1G23A 1Z90A 1V82A 2YQHA 1H7TA 2O1FA 4Y7UA 4KNRA 2YQSA 4BQHA 1ZI5A 3V0NA 2QH5A 3FOQA 4JISA 1QGSA 3I0HA 2FY7A 5CMJA 2RJ4A 3GUEA 2XWMA 2E8BA 1VZTA 3D8VA 1XHBA 3OH4A 3CKOA 2Y6PA 1V83A 1TVYA 3EE5A 2BO4A 4P00A 3R3IA 1INIA 2AE7A 4B3UA 5C49A 5EJZA 1R7YA 2AESA 3KIAA 2AH9A 3OKRA 1JV3A 5CMGX 4EEOA 1G9RA 3U0XA 4FRLA 1R81A 1O7QA 1WT2A 2W0VA 1NF5B 5C4BA 1EZIA 1NQIB 2APCA 5FTVA 1H5RB 5L6SA 3IOIA 1PZYB 3V0OA 5J49A 5CMHA 2V0LA 4AYJA 5C4EA 4D0TA 1VGUA 1R7VA 3I0GA 2BO8A 4CJ8A 3SX3A 2X5ZA 4IRPA 3JTJA 3SXCA 1VM8A 3I0KA 4KPZA 4ASJA 1ZCVA
chains in the Genus database with same CATH superfamily
3DK5A 1WT1A 2VXLA 2Z86A 5HS2A 1GWVA 1FOAA 3V0MA 4K6RA 4FRAA 4KC2A 3JUKA 1FXOA 1HM9A 4D0ZA 3V0QA 1ON8A 2V0KA 4B4MA 4KPXA 4Y6UA 5CQMX 1FGGA 2OEFA 2XWLA 3U2VA 1VH3A 1QGQA 5CQNX 3BCVA 2QKXA 1YROB 4B5BA 3T7NA 1LZ7A 2RJ5A 4NANA 5FTSA 1FWYA 1R7XA 3N9WA 3I0LA 2C0NA 3SPTA 3HL3A 2P73A 4HO0A 1NWGB 2A8WA 4EEGA 4KC4A 3D5NA 1HJLA 2RJ6A 3K8DA 1IIMA 2J0AA 3SXBA 4Y7VA 4GBPA 3USQA 1NMMB 1FO8A 3E26A 1W57A 4DDZA 5IDTA 3TZTA 2WEEA 1HM0A 3OH0A 4KNXA 3Q4SA 1H4EA 3SXEA 2J0BA 4EEAA 3OH3A 2X5SA 5C4DA 3SXGA 3Q7UA 3CU0A 1S4OA 1G97A 2YC3A 3FWWA 2WAWA 2FYDB 3DUVA 1FRWA 1VGZA 4IRQA 2I7BA 4UEGA 4B2WA 2RJ1A 2VS5A 5DDVA 2MZBA 4FCUA 1TZFA 1G0RA 5FU0A 2FFUA 4MYBA 4Y7TA 1H5SD 4LW6A 2D0JA 2PA4A 1LL2A 2BO6A 1I52A 5FV9A 1IINA 4YS8A 2BO7A 2AM5A 4L41C 2OEGA 2AGDA 5EJ1A 2RIXA 1H5RA 3JUJA 3DJ4A 2O1GA 2FYBA 1QWJA 3SX8A 1HM8A 5C1HA 1MP5A 4M28A 4JD0A 3QVBA 2VK9A 1OMZA 5C3AA 1H4DA 4B4BA 1TW1A 3CKNA 2ZU7A 1ZJ2A 4FREA 3U0YA 1TW5A 1ZJ0A 3I0FA 5FUHA 2D7RA 2Q4JA 3E25A 1GQCA 2OI7A 2RITA 1R7UA 1VZXA 1R7TA 4B2XA 3RMWA 4Y6NA 1SS9A 2I5EA 4B42A 2VSHA 2VFZA 2V0HA 1H3MA 1H5SB 2W0WA 2XMHA 3CGXA 2FYAA 2RJ7A 5FYEA 4ASYA 4O6MA 4Y9XA 3ZGFA 4NALA 1ON6A 5IFYA 2RIYA 1H7HA 1MP4A 2UX8A 3I0IX 4DE7A 1ZDGA 4EE4A 2XMEA 2Z87A 4Q7CA 2RJ0A 4EVWA 2FYCB 1VGTA 2Y4JA 2WVMA 3ZF8A 1H7EA 4C2SA 4AYLA 4NAIA 5CQLX 4M4KA 1VGWA 4FRHA 3R2WA 2JCKA 2ZU8A 4EE3A 1GX0A 1MP3A 4AC3A 4Y64A 5C47A 4HO9A 3SXAA 1YP3A 1HV9A 1VH1A 3RSBA 4Y62A 1O0RA 1ZHJA 2RIZA 1R80A 2FFVA 3U2UA 4HO3A 1W55A 2E3DA 2YESA 5AJPA 4O6NA 4G3SA 1LZIA 2XWNA 1G3LA 5C36A 2YQJA 2D7IA 4B4GA 4HG6A 1ZI1A 1FG5N 3F1CA 4LW3A 4ECMA 1HJJA 1S4PA 3OC9A 5C48A 3T7OA 1G95A 1ZCTA 4HO2A 4HCQA 5D92A 5BXCA 4EEMA 2PGYA 1G8OA 4D11A 2OI5A 4G3PA 2PGVA 4FIYA 4ARWA 4XWIA 5CQOA 1GA8A 1ZJ3A 4EE5A 1ZI3A 3IOJA 1EYRA 1O23B 4HO5A 5C4FA 2WVLA 1PZTA 2Y4MA 2AECA 2OI6A 1QG8A 2VS3A 3OGZA 4J18A 4Y63A 1KWSA 2PX7A 2CU2A 1YP4A 1ZJOA 5CMIA 4D48A 4KC1A 5CMFX 4HO6A 1H5TB 3TQDA 4CJCA 1FGXA 5C1LA 3CKQA 4FCEA 4M2BA 5C4CA 1LZJA 1FO9A 1VICA 3I0EA 4CJBA 5L6VA 3U2WA 1S4NA 3ZGGA 1H7GA 1GQ9A 5C3DA 3LW6A 3K8EA 1H5SA 4G87A 1G2VA 4FRQA 3T7MA 4E1KA 1YP2A 3U2TA 2WE9A 4FROA 2RJ8A 1LZ0A 4BMAA 1NHEB 3V0LA 1ZDFA 1R82A 1LL3A 2ICXA 4Y7GA 1JYKA 2GGOA 2Y4KA 1OQMB 1GWWA 2ZU9A 3IOHA 2X60A 4FQWA 2YCMA 2AM4A 4HO8A 1VPAA 5AJNA 4KRVA 4Y7FA 2GGQA 2QGIA 1WT0A 3OAMA 1E5KA 3ZLKA 2DPWA 3F1YA 1MC3A 3I0CA 4M2AA 5C1GA 1V84A 4NAKA 5JQQA 1OMXA 3I0DA 2Y4LA 4FRBA 1WT3A 1H7LA 2YQCA 4HO4A 3D98A 3OH2A 4HOCA 2O1HA 1H7QA 3SX5A 4FRDA 3RMVA 1FXJA 4CVHA 3V91A 1JVDA 2JCJA 2VSIA 4KQLA 1ZJPA 5D91A 3CKJA 2WGZA 5IDSA 2RJ9A 1VZUA 3PKPA 3CKVA 3BRKX 3PNNA 4D11C 3U2XA 3PKQA 2ICYA 1JYLA 2A8UA 2VXMA 3V8ZA 1JVGA 4KT7A 3ZLLA 1GX4A 2VS4A 1ZCYA 2JCLA 1JV1A 2P6WA 2P72A 2JCOA 1K4VA 1G93A 2V0IA 3OH1A 5C8RA 4FRPA 3O3PA 2YC5A 1FR9A 1H5TA 1WSZA 3USRA 4FRMA 5I1FA 4G3QA 1LL0A 1LVWA 3Q80A 4P02A 2VD4A 5C38A 3ST8A 3SXDA 2AM3A 1XZ6A 1W77A 4AAWA 5DDTA 1WVCA 5EIYA 5AJOA 2X65A 1ZCUA 4KXOA 3V90A 2Y7AA 2V0JA 1O7OA 1G1LA 4MNDA 4DECA 3NGWA 2I5KA 1ZIZA 1H5SC 3V8YA 1INJA 1NKHB 1H4CA 2NXVA 3I0JA 4ZDQA 1ZJ1A 2WVKA 5FU8A 1FR8A 3POLA 1H7FA 3V0PA 1FZWA 1ZI4A 5C3BA 3SX7A 5CQPA 4R7PA 1G23A 1Z90A 1V82A 2YQHA 1H7TA 2O1FA 4Y7UA 4KNRA 2YQSA 4BQHA 1ZI5A 3V0NA 2QH5A 3FOQA 4JISA 1QGSA 3I0HA 2FY7A 5CMJA 2RJ4A 3GUEA 2XWMA 2E8BA 1VZTA 3D8VA 1XHBA 3OH4A 3CKOA 2Y6PA 1V83A 1TVYA 3EE5A 2BO4A 4P00A 3R3IA 1INIA 2AE7A 4B3UA 5C49A 5EJZA 1R7YA 2AESA 3KIAA 2AH9A 3OKRA 1JV3A 5CMGX 4EEOA 1G9RA 3U0XA 4FRLA 4FIXA 1R81A 1O7QA 1WT2A 2W0VA 1NF5B 5C4BA 1EZIA 1NQIB 2APCA 5FTVA 1H5RB 5L6SA 3IOIA 1PZYB 4MIXA 3V0OA 5J49A 5CMHA 2V0LA 4AYJA 5C4EA 4D0TA 1VGUA 1R7VA 3I0GA 2BO8A 4CJ8A 3SX3A 2X5ZA 4IRPA 3JTJA 3SXCA 1VM8A 3I0KA 4KPZA 4ASJA 1ZCVA
chains in the Genus database with same CATH topology
3DK5A 1WT1A 2VXLA 2Z86A 5HS2A 1GWVA 1FOAA 3V0MA 4K6RA 4FRAA 4KC2A 3JUKA 1FXOA 1HM9A 4D0ZA 3V0QA 1ON8A 2V0KA 4B4MA 4KPXA 4Y6UA 5CQMX 1FGGA 2OEFA 2XWLA 3U2VA 1VH3A 1QGQA 5CQNX 3BCVA 2QKXA 1YROB 4B5BA 3T7NA 1LZ7A 2RJ5A 4NANA 5FTSA 1FWYA 1R7XA 3N9WA 3I0LA 2C0NA 3SPTA 3HL3A 2P73A 4HO0A 1NWGB 2A8WA 4EEGA 4KC4A 3D5NA 1HJLA 2RJ6A 3K8DA 1IIMA 2J0AA 3SXBA 4Y7VA 4GBPA 3USQA 1NMMB 1FO8A 3E26A 1W57A 4DDZA 5IDTA 3TZTA 2WEEA 1HM0A 3OH0A 4KNXA 3Q4SA 1H4EA 3SXEA 2J0BA 4EEAA 3OH3A 2X5SA 5C4DA 3SXGA 3Q7UA 3CU0A 1S4OA 1G97A 2YC3A 3FWWA 2WAWA 2FYDB 3DUVA 1FRWA 1VGZA 4IRQA 2I7BA 4UEGA 4B2WA 2RJ1A 2VS5A 5DDVA 2MZBA 4FCUA 1TZFA 1G0RA 5FU0A 2FFUA 4MYBA 4Y7TA 1H5SD 4LW6A 2D0JA 2PA4A 1LL2A 2BO6A 1I52A 5FV9A 1IINA 4YS8A 2BO7A 2AM5A 4L41C 2OEGA 2AGDA 5EJ1A 2RIXA 1H5RA 3JUJA 3DJ4A 2O1GA 2FYBA 1QWJA 3SX8A 1HM8A 5C1HA 1MP5A 4M28A 4JD0A 3QVBA 2VK9A 1OMZA 5C3AA 1H4DA 4B4BA 1TW1A 3CKNA 2ZU7A 1ZJ2A 4FREA 3U0YA 1TW5A 1ZJ0A 3I0FA 5FUHA 2D7RA 2Q4JA 3E25A 1GQCA 2OI7A 2RITA 1R7UA 1VZXA 1R7TA 4B2XA 3RMWA 4Y6NA 1SS9A 2I5EA 4B42A 2VSHA 2VFZA 2V0HA 1H3MA 1H5SB 2W0WA 2XMHA 3CGXA 2FYAA 2RJ7A 5FYEA 4ASYA 4O6MA 4Y9XA 3ZGFA 4NALA 1ON6A 5IFYA 2RIYA 1H7HA 1MP4A 2UX8A 3I0IX 4DE7A 1ZDGA 4EE4A 2XMEA 2Z87A 4Q7CA 2RJ0A 4EVWA 2FYCB 1VGTA 2Y4JA 2WVMA 3ZF8A 1H7EA 4C2SA 4AYLA 4NAIA 5CQLX 4M4KA 1VGWA 4FRHA 3R2WA 2JCKA 2ZU8A 4EE3A 1GX0A 1MP3A 4AC3A 4Y64A 5C47A 4HO9A 3SXAA 1YP3A 1HV9A 1VH1A 3RSBA 4Y62A 1O0RA 1ZHJA 2RIZA 1R80A 2FFVA 3U2UA 4HO3A 1W55A 2E3DA 2YESA 5AJPA 4O6NA 4G3SA 1LZIA 2XWNA 1G3LA 5C36A 2YQJA 2D7IA 4B4GA 4HG6A 1ZI1A 1FG5N 3F1CA 4LW3A 4ECMA 1HJJA 1S4PA 3OC9A 5C48A 3T7OA 1G95A 1ZCTA 4HO2A 4HCQA 5D92A 5BXCA 4EEMA 2PGYA 1G8OA 4D11A 2OI5A 4G3PA 2PGVA 4FIYA 4ARWA 4XWIA 5CQOA 1GA8A 1ZJ3A 4EE5A 1ZI3A 3IOJA 1EYRA 1O23B 4HO5A 5C4FA 2WVLA 1PZTA 2Y4MA 2AECA 2OI6A 1QG8A 2VS3A 3OGZA 4J18A 4Y63A 1KWSA 2PX7A 2CU2A 1YP4A 1ZJOA 5CMIA 4D48A 4KC1A 5CMFX 4HO6A 1H5TB 3TQDA 4CJCA 1FGXA 5C1LA 3CKQA 4FCEA 4M2BA 5C4CA 1LZJA 1FO9A 1VICA 3I0EA 4CJBA 5L6VA 3U2WA 1S4NA 3ZGGA 1H7GA 1GQ9A 5C3DA 3LW6A 3K8EA 1H5SA 4G87A 1G2VA 4FRQA 3T7MA 4E1KA 1YP2A 3U2TA 2WE9A 4FROA 2RJ8A 1LZ0A 4BMAA 1NHEB 3V0LA 1ZDFA 1R82A 1LL3A 2ICXA 4Y7GA 1JYKA 2GGOA 2Y4KA 1OQMB 1GWWA 2ZU9A 3IOHA 2X60A 4FQWA 2YCMA 2AM4A 4HO8A 1VPAA 5AJNA 4KRVA 4Y7FA 2GGQA 2QGIA 1WT0A 3OAMA 1E5KA 3ZLKA 2DPWA 3F1YA 1MC3A 3I0CA 4M2AA 5C1GA 1V84A 4NAKA 5JQQA 1OMXA 3I0DA 2Y4LA 4FRBA 1WT3A 1H7LA 2YQCA 4HO4A 3D98A 3OH2A 4HOCA 2O1HA 1H7QA 3SX5A 4FRDA 3RMVA 1FXJA 4CVHA 3V91A 1JVDA 2JCJA 2VSIA 4KQLA 1ZJPA 5D91A 3CKJA 2WGZA 5IDSA 2RJ9A 1VZUA 3PKPA 3CKVA 3BRKX 3PNNA 4D11C 3U2XA 3PKQA 2ICYA 1JYLA 2A8UA 2VXMA 3V8ZA 1JVGA 4KT7A 3ZLLA 1GX4A 2VS4A 1ZCYA 2JCLA 1JV1A 2P6WA 2P72A 2JCOA 1K4VA 1G93A 2V0IA 3OH1A 5C8RA 4FRPA 3O3PA 2YC5A 1FR9A 1H5TA 1WSZA 3USRA 4FRMA 5I1FA 4G3QA 1LL0A 1LVWA 3Q80A 4P02A 2VD4A 5C38A 3ST8A 3SXDA 2AM3A 1XZ6A 1W77A 4AAWA 5DDTA 1WVCA 5EIYA 5AJOA 2X65A 1ZCUA 4KXOA 3V90A 2Y7AA 2V0JA 1O7OA 1G1LA 4MNDA 4DECA 3NGWA 2I5KA 1ZIZA 1H5SC 3V8YA 1INJA 1NKHB 1H4CA 2NXVA 3I0JA 4ZDQA 1ZJ1A 2WVKA 5FU8A 1FR8A 3POLA 1H7FA 3V0PA 1FZWA 1ZI4A 5C3BA 3SX7A 5CQPA 4R7PA 1G23A 1Z90A 1V82A 2YQHA 1H7TA 2O1FA 4Y7UA 4KNRA 2YQSA 4BQHA 1ZI5A 3V0NA 2QH5A 3FOQA 4JISA 1QGSA 3I0HA 2FY7A 5CMJA 2RJ4A 3GUEA 2XWMA 2E8BA 1VZTA 3D8VA 1XHBA 3OH4A 3CKOA 2Y6PA 1V83A 1TVYA 3EE5A 2BO4A 4P00A 3R3IA 1INIA 2AE7A 4B3UA 5C49A 5EJZA 1R7YA 2AESA 3KIAA 2AH9A 3OKRA 1JV3A 5CMGX 4EEOA 1G9RA 3U0XA 4FRLA 4FIXA 1R81A 1O7QA 1WT2A 2W0VA 1NF5B 5C4BA 1EZIA 1NQIB 2APCA 5FTVA 1H5RB 5L6SA 3IOIA 1PZYB 4MIXA 3V0OA 5J49A 5CMHA 2V0LA 4AYJA 5C4EA 4D0TA 1VGUA 1R7VA 3I0GA 2BO8A 4CJ8A 3SX3A 2X5ZA 4IRPA 3JTJA 3SXCA 1VM8A 3I0KA 4KPZA 4ASJA 1ZCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DK5 A;  1WT1 A;  2VXL A;  2Z86 A;  5HS2 A;  1GWV A;  1FOA A;  3V0M A;  4K6R A;  4FRA A;  4KC2 A;  3JUK A;  1FXO A;  1HM9 A;  4D0Z A;  3V0Q A;  1ON8 A;  2V0K A;  4B4M A;  4KPX A;  4Y6U A;  5CQM X;  1FGG A;  2OEF A;  2XWL A;  3U2V A;  1VH3 A;  1QGQ A;  5CQN X;  3BCV A;  2QKX A;  1YRO B;  4B5B A;  3T7N A;  1LZ7 A;  2RJ5 A;  4NAN A;  5FTS A;  1FWY A;  1R7X A;  3N9W A;  3I0L A;  3SPT A;  3HL3 A;  2P73 A;  4HO0 A;  1NWG B;  2A8W A;  4EEG A;  4KC4 A;  3D5N A;  1HJL A;  2RJ6 A;  3K8D A;  1IIM A;  3SXB A;  4Y7V A;  4GBP A;  3USQ A;  1NMM B;  1FO8 A;  3E26 A;  1W57 A;  4DDZ A;  5IDT A;  3TZT A;  2WEE A;  1HM0 A;  3OH0 A;  4KNX A;  3Q4S A;  1H4E A;  3SXE A;  4EEA A;  3OH3 A;  2X5S A;  5C4D A;  3SXG A;  3Q7U A;  3CU0 A;  1S4O A;  1G97 A;  2YC3 A;  3FWW A;  2WAW A;  2FYD B;  3DUV A;  1FRW A;  1VGZ A;  4IRQ A;  2I7B A;  4UEG A;  4B2W A;  2RJ1 A;  2VS5 A;  5DDV A;  2MZB A;  4FCU A;  1TZF A;  1G0R A;  5FU0 A;  2FFU A;  4MYB A;  4Y7T A;  1H5S D;  4LW6 A;  2D0J A;  2PA4 A;  1LL2 A;  2BO6 A;  1I52 A;  5FV9 A;  1IIN A;  4YS8 A;  2BO7 A;  2AM5 A;  4L41 C;  2OEG A;  2AGD A;  5EJ1 A;  2RIX A;  1H5R A;  3JUJ A;  3DJ4 A;  2O1G A;  2FYB A;  1QWJ A;  3SX8 A;  1HM8 A;  5C1H A;  1MP5 A;  4M28 A;  4JD0 A;  3QVB A;  1OMZ A;  5C3A A;  1H4D A;  4B4B A;  1TW1 A;  3CKN A;  2ZU7 A;  1ZJ2 A;  4FRE A;  3U0Y A;  1TW5 A;  1ZJ0 A;  3I0F A;  5FUH A;  2D7R A;  2Q4J A;  3E25 A;  1GQC A;  2OI7 A;  2RIT A;  1R7U A;  1VZX A;  1R7T A;  4B2X A;  3RMW A;  4Y6N A;  1SS9 A;  2I5E A;  4B42 A;  2VSH A;  2VFZ A;  2V0H A;  1H3M A;  1H5S B;  2W0W A;  2XMH A;  3CGX A;  2FYA A;  2RJ7 A;  5FYE A;  4ASY A;  4Y9X A;  3ZGF A;  4NAL A;  1ON6 A;  5IFY A;  2RIY A;  1H7H A;  1MP4 A;  2UX8 A;  3I0I X;  4DE7 A;  1ZDG A;  4EE4 A;  2XME A;  2Z87 A;  2RJ0 A;  4EVW A;  2FYC B;  1VGT A;  2Y4J A;  2WVM A;  3ZF8 A;  1H7E A;  4C2S A;  4AYL A;  4NAI A;  5CQL X;  4M4K A;  1VGW A;  4FRH A;  3R2W A;  2JCK A;  2ZU8 A;  4EE3 A;  1GX0 A;  1MP3 A;  4AC3 A;  4Y64 A;  5C47 A;  4HO9 A;  3SXA A;  1YP3 A;  1HV9 A;  1VH1 A;  3RSB A;  4Y62 A;  1O0R A;  1ZHJ A;  2RIZ A;  1R80 A;  2FFV A;  3U2U A;  4HO3 A;  1W55 A;  2E3D A;  2YES A;  5AJP A;  4G3S A;  1LZI A;  2XWN A;  1G3L A;  5C36 A;  2YQJ A;  2D7I A;  4B4G A;  4HG6 A;  1ZI1 A;  1FG5 N;  3F1C A;  4LW3 A;  4ECM A;  1HJJ A;  1S4P A;  3OC9 A;  5C48 A;  3T7O A;  1G95 A;  1ZCT A;  4HO2 A;  4HCQ A;  5BXC A;  4EEM A;  2PGY A;  1G8O A;  4D11 A;  2OI5 A;  4G3P A;  2PGV A;  4ARW A;  4XWI A;  5CQO A;  1GA8 A;  1ZJ3 A;  4EE5 A;  1ZI3 A;  3IOJ A;  1EYR A;  1O23 B;  4HO5 A;  5C4F A;  2WVL A;  1PZT A;  2Y4M A;  2AEC A;  2OI6 A;  1QG8 A;  2VS3 A;  3OGZ A;  4J18 A;  4Y63 A;  1KWS A;  2PX7 A;  2CU2 A;  1YP4 A;  1ZJO A;  5CMI A;  4D48 A;  4KC1 A;  5CMF X;  4HO6 A;  1H5T B;  3TQD A;  4CJC A;  1FGX A;  5C1L A;  3CKQ A;  4FCE A;  4M2B A;  5C4C A;  1LZJ A;  1FO9 A;  1VIC A;  3I0E A;  4CJB A;  5L6V A;  3U2W A;  1S4N A;  3ZGG A;  1H7G A;  1GQ9 A;  5C3D A;  3LW6 A;  3K8E A;  1H5S A;  4G87 A;  1G2V A;  4FRQ A;  3T7M A;  4E1K A;  1YP2 A;  3U2T A;  2WE9 A;  4FRO A;  2RJ8 A;  1LZ0 A;  4BMA A;  1NHE B;  3V0L A;  1ZDF A;  1R82 A;  1LL3 A;  2ICX A;  4Y7G A;  1JYK A;  2GGO A;  2Y4K A;  1OQM B;  1GWW A;  2ZU9 A;  3IOH A;  2X60 A;  4FQW A;  2YCM A;  2AM4 A;  4HO8 A;  1VPA A;  5AJN A;  4KRV A;  4Y7F A;  2GGQ A;  2QGI A;  1WT0 A;  3OAM A;  1E5K A;  3ZLK A;  2DPW A;  3F1Y A;  1MC3 A;  3I0C A;  4M2A A;  5C1G A;  1V84 A;  4NAK A;  5JQQ A;  1OMX A;  3I0D A;  2Y4L A;  4FRB A;  1WT3 A;  1H7L A;  2YQC A;  4HO4 A;  3D98 A;  3OH2 A;  4HOC A;  2O1H A;  1H7Q A;  3SX5 A;  4FRD A;  3RMV A;  1FXJ A;  4CVH A;  3V91 A;  1JVD A;  2JCJ A;  2VSI A;  4KQL A;  1ZJP A;  3CKJ A;  2WGZ A;  5IDS A;  2RJ9 A;  1VZU A;  3PKP A;  3CKV A;  3BRK X;  3PNN A;  4D11 C;  3U2X A;  3PKQ A;  2ICY A;  1JYL A;  2A8U A;  2VXM A;  3V8Z A;  1JVG A;  4KT7 A;  3ZLL A;  1GX4 A;  2VS4 A;  1ZCY A;  2JCL A;  1JV1 A;  2P6W A;  2P72 A;  2JCO A;  1K4V A;  1G93 A;  2V0I A;  3OH1 A;  5C8R A;  4FRP A;  3O3P A;  2YC5 A;  1FR9 A;  1H5T A;  1WSZ A;  3USR A;  4FRM A;  5I1F A;  4G3Q A;  1LL0 A;  1LVW A;  3Q80 A;  4P02 A;  2VD4 A;  5C38 A;  3ST8 A;  3SXD A;  2AM3 A;  1XZ6 A;  1W77 A;  4AAW A;  5DDT A;  1WVC A;  5EIY A;  5AJO A;  2X65 A;  1ZCU A;  4KXO A;  3V90 A;  2Y7A A;  2V0J A;  1O7O A;  1G1L A;  4MND A;  4DEC A;  3NGW A;  2I5K A;  1ZIZ A;  1H5S C;  3V8Y A;  1INJ A;  1NKH B;  1H4C A;  2NXV A;  3I0J A;  4ZDQ A;  1ZJ1 A;  2WVK A;  5FU8 A;  1FR8 A;  3POL A;  1H7F A;  3V0P A;  1FZW A;  1ZI4 A;  5C3B A;  3SX7 A;  5CQP A;  4R7P A;  1G23 A;  1Z90 A;  1V82 A;  2YQH A;  1H7T A;  2O1F A;  4Y7U A;  4KNR A;  2YQS A;  4BQH A;  1ZI5 A;  3V0N A;  2QH5 A;  3FOQ A;  4JIS A;  1QGS A;  3I0H A;  2FY7 A;  5CMJ A;  2RJ4 A;  3GUE A;  2XWM A;  2E8B A;  1VZT A;  3D8V A;  1XHB A;  3OH4 A;  3CKO A;  2Y6P A;  1V83 A;  1TVY A;  3EE5 A;  2BO4 A;  4P00 A;  3R3I A;  1INI A;  2AE7 A;  4B3U A;  5C49 A;  5EJZ A;  1R7Y A;  2AES A;  3KIA A;  2AH9 A;  3OKR A;  1JV3 A;  5CMG X;  4EEO A;  1G9R A;  3U0X A;  4FRL A;  1R81 A;  1O7Q A;  1WT2 A;  2W0V A;  1NF5 B;  5C4B A;  1EZI A;  1NQI B;  2APC A;  5FTV A;  1H5R B;  5L6S A;  3IOI A;  1PZY B;  3V0O A;  5J49 A;  5CMH A;  2V0L A;  4AYJ A;  5C4E A;  4D0T A;  1VGU A;  1R7V A;  3I0G A;  2BO8 A;  4CJ8 A;  3SX3 A;  2X5Z A;  4IRP A;  3JTJ A;  3SXC A;  1VM8 A;  3I0K A;  4KPZ A;  4ASJ A;  1ZCV A; 
#chains in the Genus database with same CATH topology
 3DK5 A;  1WT1 A;  2VXL A;  2Z86 A;  5HS2 A;  1GWV A;  1FOA A;  3V0M A;  4K6R A;  4FRA A;  4KC2 A;  3JUK A;  1FXO A;  1HM9 A;  4D0Z A;  3V0Q A;  1ON8 A;  2V0K A;  4B4M A;  4KPX A;  4Y6U A;  5CQM X;  1FGG A;  2OEF A;  2XWL A;  3U2V A;  1VH3 A;  1QGQ A;  5CQN X;  3BCV A;  2QKX A;  1YRO B;  4B5B A;  3T7N A;  1LZ7 A;  2RJ5 A;  4NAN A;  5FTS A;  1FWY A;  1R7X A;  3N9W A;  3I0L A;  2C0N A;  3SPT A;  3HL3 A;  2P73 A;  4HO0 A;  1NWG B;  2A8W A;  4EEG A;  4KC4 A;  3D5N A;  1HJL A;  2RJ6 A;  3K8D A;  1IIM A;  2J0A A;  3SXB A;  4Y7V A;  4GBP A;  3USQ A;  1NMM B;  1FO8 A;  3E26 A;  1W57 A;  4DDZ A;  5IDT A;  3TZT A;  2WEE A;  1HM0 A;  3OH0 A;  4KNX A;  3Q4S A;  1H4E A;  3SXE A;  2J0B A;  4EEA A;  3OH3 A;  2X5S A;  5C4D A;  3SXG A;  3Q7U A;  3CU0 A;  1S4O A;  1G97 A;  2YC3 A;  3FWW A;  2WAW A;  2FYD B;  3DUV A;  1FRW A;  1VGZ A;  4IRQ A;  2I7B A;  4UEG A;  4B2W A;  2RJ1 A;  2VS5 A;  5DDV A;  2MZB A;  4FCU A;  1TZF A;  1G0R A;  5FU0 A;  2FFU A;  4MYB A;  4Y7T A;  1H5S D;  4LW6 A;  2D0J A;  2PA4 A;  1LL2 A;  2BO6 A;  1I52 A;  5FV9 A;  1IIN A;  4YS8 A;  2BO7 A;  2AM5 A;  4L41 C;  2OEG A;  2AGD A;  5EJ1 A;  2RIX A;  1H5R A;  3JUJ A;  3DJ4 A;  2O1G A;  2FYB A;  1QWJ A;  3SX8 A;  1HM8 A;  5C1H A;  1MP5 A;  4M28 A;  4JD0 A;  3QVB A;  2VK9 A;  1OMZ A;  5C3A A;  1H4D A;  4B4B A;  1TW1 A;  3CKN A;  2ZU7 A;  1ZJ2 A;  4FRE A;  3U0Y A;  1TW5 A;  1ZJ0 A;  3I0F A;  5FUH A;  2D7R A;  2Q4J A;  3E25 A;  1GQC A;  2OI7 A;  2RIT A;  1R7U A;  1VZX A;  1R7T A;  4B2X A;  3RMW A;  4Y6N A;  1SS9 A;  2I5E A;  4B42 A;  2VSH A;  2VFZ A;  2V0H A;  1H3M A;  1H5S B;  2W0W A;  2XMH A;  3CGX A;  2FYA A;  2RJ7 A;  5FYE A;  4ASY A;  4O6M A;  4Y9X A;  3ZGF A;  4NAL A;  1ON6 A;  5IFY A;  2RIY A;  1H7H A;  1MP4 A;  2UX8 A;  3I0I X;  4DE7 A;  1ZDG A;  4EE4 A;  2XME A;  2Z87 A;  4Q7C A;  2RJ0 A;  4EVW A;  2FYC B;  1VGT A;  2Y4J A;  2WVM A;  3ZF8 A;  1H7E A;  4C2S A;  4AYL A;  4NAI A;  5CQL X;  4M4K A;  1VGW A;  4FRH A;  3R2W A;  2JCK A;  2ZU8 A;  4EE3 A;  1GX0 A;  1MP3 A;  4AC3 A;  4Y64 A;  5C47 A;  4HO9 A;  3SXA A;  1YP3 A;  1HV9 A;  1VH1 A;  3RSB A;  4Y62 A;  1O0R A;  1ZHJ A;  2RIZ A;  1R80 A;  2FFV A;  3U2U A;  4HO3 A;  1W55 A;  2E3D A;  2YES A;  5AJP A;  4O6N A;  4G3S A;  1LZI A;  2XWN A;  1G3L A;  5C36 A;  2YQJ A;  2D7I A;  4B4G A;  4HG6 A;  1ZI1 A;  1FG5 N;  3F1C A;  4LW3 A;  4ECM A;  1HJJ A;  1S4P A;  3OC9 A;  5C48 A;  3T7O A;  1G95 A;  1ZCT A;  4HO2 A;  4HCQ A;  5D92 A;  5BXC A;  4EEM A;  2PGY A;  1G8O A;  4D11 A;  2OI5 A;  4G3P A;  2PGV A;  4FIY A;  4ARW A;  4XWI A;  5CQO A;  1GA8 A;  1ZJ3 A;  4EE5 A;  1ZI3 A;  3IOJ A;  1EYR A;  1O23 B;  4HO5 A;  5C4F A;  2WVL A;  1PZT A;  2Y4M A;  2AEC A;  2OI6 A;  1QG8 A;  2VS3 A;  3OGZ A;  4J18 A;  4Y63 A;  1KWS A;  2PX7 A;  2CU2 A;  1YP4 A;  1ZJO A;  5CMI A;  4D48 A;  4KC1 A;  5CMF X;  4HO6 A;  1H5T B;  3TQD A;  4CJC A;  1FGX A;  5C1L A;  3CKQ A;  4FCE A;  4M2B A;  5C4C A;  1LZJ A;  1FO9 A;  1VIC A;  3I0E A;  4CJB A;  5L6V A;  3U2W A;  1S4N A;  3ZGG A;  1H7G A;  1GQ9 A;  5C3D A;  3LW6 A;  3K8E A;  1H5S A;  4G87 A;  1G2V A;  4FRQ A;  3T7M A;  4E1K A;  1YP2 A;  3U2T A;  2WE9 A;  4FRO A;  2RJ8 A;  1LZ0 A;  4BMA A;  1NHE B;  3V0L A;  1ZDF A;  1R82 A;  1LL3 A;  2ICX A;  4Y7G A;  1JYK A;  2GGO A;  2Y4K A;  1OQM B;  1GWW A;  2ZU9 A;  3IOH A;  2X60 A;  4FQW A;  2YCM A;  2AM4 A;  4HO8 A;  1VPA A;  5AJN A;  4KRV A;  4Y7F A;  2GGQ A;  2QGI A;  1WT0 A;  3OAM A;  1E5K A;  3ZLK A;  2DPW A;  3F1Y A;  1MC3 A;  3I0C A;  4M2A A;  5C1G A;  1V84 A;  4NAK A;  5JQQ A;  1OMX A;  3I0D A;  2Y4L A;  4FRB A;  1WT3 A;  1H7L A;  2YQC A;  4HO4 A;  3D98 A;  3OH2 A;  4HOC A;  2O1H A;  1H7Q A;  3SX5 A;  4FRD A;  3RMV A;  1FXJ A;  4CVH A;  3V91 A;  1JVD A;  2JCJ A;  2VSI A;  4KQL A;  1ZJP A;  5D91 A;  3CKJ A;  2WGZ A;  5IDS A;  2RJ9 A;  1VZU A;  3PKP A;  3CKV A;  3BRK X;  3PNN A;  4D11 C;  3U2X A;  3PKQ A;  2ICY A;  1JYL A;  2A8U A;  2VXM A;  3V8Z A;  1JVG A;  4KT7 A;  3ZLL A;  1GX4 A;  2VS4 A;  1ZCY A;  2JCL A;  1JV1 A;  2P6W A;  2P72 A;  2JCO A;  1K4V A;  1G93 A;  2V0I A;  3OH1 A;  5C8R A;  4FRP A;  3O3P A;  2YC5 A;  1FR9 A;  1H5T A;  1WSZ A;  3USR A;  4FRM A;  5I1F A;  4G3Q A;  1LL0 A;  1LVW A;  3Q80 A;  4P02 A;  2VD4 A;  5C38 A;  3ST8 A;  3SXD A;  2AM3 A;  1XZ6 A;  1W77 A;  4AAW A;  5DDT A;  1WVC A;  5EIY A;  5AJO A;  2X65 A;  1ZCU A;  4KXO A;  3V90 A;  2Y7A A;  2V0J A;  1O7O A;  1G1L A;  4MND A;  4DEC A;  3NGW A;  2I5K A;  1ZIZ A;  1H5S C;  3V8Y A;  1INJ A;  1NKH B;  1H4C A;  2NXV A;  3I0J A;  4ZDQ A;  1ZJ1 A;  2WVK A;  5FU8 A;  1FR8 A;  3POL A;  1H7F A;  3V0P A;  1FZW A;  1ZI4 A;  5C3B A;  3SX7 A;  5CQP A;  4R7P A;  1G23 A;  1Z90 A;  1V82 A;  2YQH A;  1H7T A;  2O1F A;  4Y7U A;  4KNR A;  2YQS A;  4BQH A;  1ZI5 A;  3V0N A;  2QH5 A;  3FOQ A;  4JIS A;  1QGS A;  3I0H A;  2FY7 A;  5CMJ A;  2RJ4 A;  3GUE A;  2XWM A;  2E8B A;  1VZT A;  3D8V A;  1XHB A;  3OH4 A;  3CKO A;  2Y6P A;  1V83 A;  1TVY A;  3EE5 A;  2BO4 A;  4P00 A;  3R3I A;  1INI A;  2AE7 A;  4B3U A;  5C49 A;  5EJZ A;  1R7Y A;  2AES A;  3KIA A;  2AH9 A;  3OKR A;  1JV3 A;  5CMG X;  4EEO A;  1G9R A;  3U0X A;  4FRL A;  4FIX A;  1R81 A;  1O7Q A;  1WT2 A;  2W0V A;  1NF5 B;  5C4B A;  1EZI A;  1NQI B;  2APC A;  5FTV A;  1H5R B;  5L6S A;  3IOI A;  1PZY B;  4MIX A;  3V0O A;  5J49 A;  5CMH A;  2V0L A;  4AYJ A;  5C4E A;  4D0T A;  1VGU A;  1R7V A;  3I0G A;  2BO8 A;  4CJ8 A;  3SX3 A;  2X5Z A;  4IRP A;  3JTJ A;  3SXC A;  1VM8 A;  3I0K A;  4KPZ A;  4ASJ A;  1ZCV A; 
#chains in the Genus database with same CATH homology
 3DK5 A;  1WT1 A;  2VXL A;  2Z86 A;  5HS2 A;  1GWV A;  1FOA A;  3V0M A;  4K6R A;  4FRA A;  4KC2 A;  3JUK A;  1FXO A;  1HM9 A;  4D0Z A;  3V0Q A;  1ON8 A;  2V0K A;  4B4M A;  4KPX A;  4Y6U A;  5CQM X;  1FGG A;  2OEF A;  2XWL A;  3U2V A;  1VH3 A;  1QGQ A;  5CQN X;  3BCV A;  2QKX A;  1YRO B;  4B5B A;  3T7N A;  1LZ7 A;  2RJ5 A;  4NAN A;  5FTS A;  1FWY A;  1R7X A;  3N9W A;  3I0L A;  2C0N A;  3SPT A;  3HL3 A;  2P73 A;  4HO0 A;  1NWG B;  2A8W A;  4EEG A;  4KC4 A;  3D5N A;  1HJL A;  2RJ6 A;  3K8D A;  1IIM A;  2J0A A;  3SXB A;  4Y7V A;  4GBP A;  3USQ A;  1NMM B;  1FO8 A;  3E26 A;  1W57 A;  4DDZ A;  5IDT A;  3TZT A;  2WEE A;  1HM0 A;  3OH0 A;  4KNX A;  3Q4S A;  1H4E A;  3SXE A;  2J0B A;  4EEA A;  3OH3 A;  2X5S A;  5C4D A;  3SXG A;  3Q7U A;  3CU0 A;  1S4O A;  1G97 A;  2YC3 A;  3FWW A;  2WAW A;  2FYD B;  3DUV A;  1FRW A;  1VGZ A;  4IRQ A;  2I7B A;  4UEG A;  4B2W A;  2RJ1 A;  2VS5 A;  5DDV A;  2MZB A;  4FCU A;  1TZF A;  1G0R A;  5FU0 A;  2FFU A;  4MYB A;  4Y7T A;  1H5S D;  4LW6 A;  2D0J A;  2PA4 A;  1LL2 A;  2BO6 A;  1I52 A;  5FV9 A;  1IIN A;  4YS8 A;  2BO7 A;  2AM5 A;  4L41 C;  2OEG A;  2AGD A;  5EJ1 A;  2RIX A;  1H5R A;  3JUJ A;  3DJ4 A;  2O1G A;  2FYB A;  1QWJ A;  3SX8 A;  1HM8 A;  5C1H A;  1MP5 A;  4M28 A;  4JD0 A;  3QVB A;  2VK9 A;  1OMZ A;  5C3A A;  1H4D A;  4B4B A;  1TW1 A;  3CKN A;  2ZU7 A;  1ZJ2 A;  4FRE A;  3U0Y A;  1TW5 A;  1ZJ0 A;  3I0F A;  5FUH A;  2D7R A;  2Q4J A;  3E25 A;  1GQC A;  2OI7 A;  2RIT A;  1R7U A;  1VZX A;  1R7T A;  4B2X A;  3RMW A;  4Y6N A;  1SS9 A;  2I5E A;  4B42 A;  2VSH A;  2VFZ A;  2V0H A;  1H3M A;  1H5S B;  2W0W A;  2XMH A;  3CGX A;  2FYA A;  2RJ7 A;  5FYE A;  4ASY A;  4O6M A;  4Y9X A;  3ZGF A;  4NAL A;  1ON6 A;  5IFY A;  2RIY A;  1H7H A;  1MP4 A;  2UX8 A;  3I0I X;  4DE7 A;  1ZDG A;  4EE4 A;  2XME A;  2Z87 A;  4Q7C A;  2RJ0 A;  4EVW A;  2FYC B;  1VGT A;  2Y4J A;  2WVM A;  3ZF8 A;  1H7E A;  4C2S A;  4AYL A;  4NAI A;  5CQL X;  4M4K A;  1VGW A;  4FRH A;  3R2W A;  2JCK A;  2ZU8 A;  4EE3 A;  1GX0 A;  1MP3 A;  4AC3 A;  4Y64 A;  5C47 A;  4HO9 A;  3SXA A;  1YP3 A;  1HV9 A;  1VH1 A;  3RSB A;  4Y62 A;  1O0R A;  1ZHJ A;  2RIZ A;  1R80 A;  2FFV A;  3U2U A;  4HO3 A;  1W55 A;  2E3D A;  2YES A;  5AJP A;  4O6N A;  4G3S A;  1LZI A;  2XWN A;  1G3L A;  5C36 A;  2YQJ A;  2D7I A;  4B4G A;  4HG6 A;  1ZI1 A;  1FG5 N;  3F1C A;  4LW3 A;  4ECM A;  1HJJ A;  1S4P A;  3OC9 A;  5C48 A;  3T7O A;  1G95 A;  1ZCT A;  4HO2 A;  4HCQ A;  5D92 A;  5BXC A;  4EEM A;  2PGY A;  1G8O A;  4D11 A;  2OI5 A;  4G3P A;  2PGV A;  4FIY A;  4ARW A;  4XWI A;  5CQO A;  1GA8 A;  1ZJ3 A;  4EE5 A;  1ZI3 A;  3IOJ A;  1EYR A;  1O23 B;  4HO5 A;  5C4F A;  2WVL A;  1PZT A;  2Y4M A;  2AEC A;  2OI6 A;  1QG8 A;  2VS3 A;  3OGZ A;  4J18 A;  4Y63 A;  1KWS A;  2PX7 A;  2CU2 A;  1YP4 A;  1ZJO A;  5CMI A;  4D48 A;  4KC1 A;  5CMF X;  4HO6 A;  1H5T B;  3TQD A;  4CJC A;  1FGX A;  5C1L A;  3CKQ A;  4FCE A;  4M2B A;  5C4C A;  1LZJ A;  1FO9 A;  1VIC A;  3I0E A;  4CJB A;  5L6V A;  3U2W A;  1S4N A;  3ZGG A;  1H7G A;  1GQ9 A;  5C3D A;  3LW6 A;  3K8E A;  1H5S A;  4G87 A;  1G2V A;  4FRQ A;  3T7M A;  4E1K A;  1YP2 A;  3U2T A;  2WE9 A;  4FRO A;  2RJ8 A;  1LZ0 A;  4BMA A;  1NHE B;  3V0L A;  1ZDF A;  1R82 A;  1LL3 A;  2ICX A;  4Y7G A;  1JYK A;  2GGO A;  2Y4K A;  1OQM B;  1GWW A;  2ZU9 A;  3IOH A;  2X60 A;  4FQW A;  2YCM A;  2AM4 A;  4HO8 A;  1VPA A;  5AJN A;  4KRV A;  4Y7F A;  2GGQ A;  2QGI A;  1WT0 A;  3OAM A;  1E5K A;  3ZLK A;  2DPW A;  3F1Y A;  1MC3 A;  3I0C A;  4M2A A;  5C1G A;  1V84 A;  4NAK A;  5JQQ A;  1OMX A;  3I0D A;  2Y4L A;  4FRB A;  1WT3 A;  1H7L A;  2YQC A;  4HO4 A;  3D98 A;  3OH2 A;  4HOC A;  2O1H A;  1H7Q A;  3SX5 A;  4FRD A;  3RMV A;  1FXJ A;  4CVH A;  3V91 A;  1JVD A;  2JCJ A;  2VSI A;  4KQL A;  1ZJP A;  5D91 A;  3CKJ A;  2WGZ A;  5IDS A;  2RJ9 A;  1VZU A;  3PKP A;  3CKV A;  3BRK X;  3PNN A;  4D11 C;  3U2X A;  3PKQ A;  2ICY A;  1JYL A;  2A8U A;  2VXM A;  3V8Z A;  1JVG A;  4KT7 A;  3ZLL A;  1GX4 A;  2VS4 A;  1ZCY A;  2JCL A;  1JV1 A;  2P6W A;  2P72 A;  2JCO A;  1K4V A;  1G93 A;  2V0I A;  3OH1 A;  5C8R A;  4FRP A;  3O3P A;  2YC5 A;  1FR9 A;  1H5T A;  1WSZ A;  3USR A;  4FRM A;  5I1F A;  4G3Q A;  1LL0 A;  1LVW A;  3Q80 A;  4P02 A;  2VD4 A;  5C38 A;  3ST8 A;  3SXD A;  2AM3 A;  1XZ6 A;  1W77 A;  4AAW A;  5DDT A;  1WVC A;  5EIY A;  5AJO A;  2X65 A;  1ZCU A;  4KXO A;  3V90 A;  2Y7A A;  2V0J A;  1O7O A;  1G1L A;  4MND A;  4DEC A;  3NGW A;  2I5K A;  1ZIZ A;  1H5S C;  3V8Y A;  1INJ A;  1NKH B;  1H4C A;  2NXV A;  3I0J A;  4ZDQ A;  1ZJ1 A;  2WVK A;  5FU8 A;  1FR8 A;  3POL A;  1H7F A;  3V0P A;  1FZW A;  1ZI4 A;  5C3B A;  3SX7 A;  5CQP A;  4R7P A;  1G23 A;  1Z90 A;  1V82 A;  2YQH A;  1H7T A;  2O1F A;  4Y7U A;  4KNR A;  2YQS A;  4BQH A;  1ZI5 A;  3V0N A;  2QH5 A;  3FOQ A;  4JIS A;  1QGS A;  3I0H A;  2FY7 A;  5CMJ A;  2RJ4 A;  3GUE A;  2XWM A;  2E8B A;  1VZT A;  3D8V A;  1XHB A;  3OH4 A;  3CKO A;  2Y6P A;  1V83 A;  1TVY A;  3EE5 A;  2BO4 A;  4P00 A;  3R3I A;  1INI A;  2AE7 A;  4B3U A;  5C49 A;  5EJZ A;  1R7Y A;  2AES A;  3KIA A;  2AH9 A;  3OKR A;  1JV3 A;  5CMG X;  4EEO A;  1G9R A;  3U0X A;  4FRL A;  4FIX A;  1R81 A;  1O7Q A;  1WT2 A;  2W0V A;  1NF5 B;  5C4B A;  1EZI A;  1NQI B;  2APC A;  5FTV A;  1H5R B;  5L6S A;  3IOI A;  1PZY B;  4MIX A;  3V0O A;  5J49 A;  5CMH A;  2V0L A;  4AYJ A;  5C4E A;  4D0T A;  1VGU A;  1R7V A;  3I0G A;  2BO8 A;  4CJ8 A;  3SX3 A;  2X5Z A;  4IRP A;  3JTJ A;  3SXC A;  1VM8 A;  3I0K A;  4KPZ A;  4ASJ A;  1ZCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...