4KC1A

Structure of the blood group glycosyltransferase aaglyb in complex with a pyridine inhibitor as a neutral pyrophosphate surrogate
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
289
structure length
289
Chain Sequence
AIGEFMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYGGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase
publication title Design of glycosyltransferase inhibitors: pyridine as a pyrophosphate surrogate.
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 289
sequence length 289
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2013-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4kc1A00
2P73A 5EJ1A 4LW3A 1R7XA 5EIYA 3JUKA 4HCQA 1H5SC 1VPAA 4CVHA 1TVYA 4B4BA 1S4NA 1G95A 4KPXA 2D7RA 4C2SA 3Q4SA 2I7BA 3RMVA 5CQNX 4Y7TA 3CKOA 3FWWA 2MZBA 3R2WA 4HO3A 3I0GA 3DUVA 5C48A 1SS9A 1H7EA 2VSIA 1H5RA 5FV9A 1TW5A 2V0HA 2RITA 5EJZA 1YP2A 3OH0A 4KNXA 1ZJOA 4FCEA 2Y4JA 5C49A 3U0XA 1JYKA 1W77A 1FR8A 2RIZA 4M4KA 1XZ6A 3I0HA 3LW6A 5C4CA 5FU8A 1WVCA 3I0FA 3I0JA 5FYEA 5IDTA 1QWJA 4FRQA 3V8ZA 2RJ7A 4HO5A 2OI6A 5CQLX 1O0RA 1FR9A 1LL3A 3ZLKA 4KC4A 4EE5A 3CGXA 4UEGA 1ZJ0A 1FGGA 5C4DA 2RJ0A 3SPTA 2VS4A 1W55A 3I0IX 3I0CA 5CQPA 2NXVA 4KXOA 2RJ6A 2OI5A 2RIYA 1ON8A 3FOQA 1FGXA 3U2VA 2E3DA 4M2AA 1H5SA 4B5BA 2GGOA 1XHBA 3V0PA 3CU0A 1H5RB 5C1GA 1JVDA 4EEMA 1H5SD 4FRMA 4HO4A 4D0TA 1ZHJA 4ASYA 3U2TA 3F1YA 4CJ8A 1WT2A 3I0DA 2VS3A 1TZFA 1V84A 5L6VA 1HM8A 3V0QA 3OC9A 4HO8A 4G3PA 1GQ9A 4IRPA 1NWGB 1ZI5A 1HJLA 5C1LA 2AGDA 4FRDA 3O3PA 3HL3A 1VM8A 1H7FA 1VZUA 1IINA 1R80A 2VFZA 2Y4LA 5CMFX 1NMMB 3BRKX 1ZCTA 5AJPA 4FREA 2X60A 1YROB 2AESA 2JCOA 1WSZA 1LZIA 5C4FA 2FFVA 1FO9A 1JYLA 2V0JA 2YQCA 3I0KA 2QH5A 3DK5A 5J49A 3R3IA 5DDVA 5HS2A 1JV3A 1H5SB 2PGYA 2WE9A 4HO2A 2XMEA 2Q4JA 4M28A 3TQDA 2JCJA 1GWWA 4B4GA 2X5SA 1GWVA 2OEFA 1H7QA 2Y4KA 1FRWA 1KWSA 2JCLA 2I5KA 4JISA 4MNDA 2RJ9A 3OH3A 2RJ1A 4FCUA 4KT7A 5C8RA 1NQIB 2BO6A 4P02A 5C36A 4D11C 3KIAA 1LZ7A 2GGQA 5IFYA 2ICXA 4G3QA 3QVBA 5C3BA 5CMHA 3USRA 2YQJA 3NGWA 4R7PA 4KC1A 1H4CA 1G1LA 1QGSA 1MC3A 3RSBA 2YQHA 3T7NA 1ON6A 2UX8A 3USQA 1K4VA 1LL2A 1FG5N 1OMZA 3SXEA 1ZDGA 1ZIZA 2CU2A 3CKVA 2AH9A 2O1HA 3CKQA 4B4MA 2RJ4A 2P72A 5C47A 1TW1A 3E26A 4HO0A 3OKRA 1INJA 1G97A 5C3DA 4Y6UA 2WGZA 5FTVA 2XMHA 2D0JA 1I52A 4GBPA 2FFUA 5C4BA 1FO8A 1R82A 5BXCA 3ZF8A 4J18A 1S4OA 1YP3A 1HM9A 2W0WA 1LL0A 2OI7A 3IOHA 4EEOA 1ZI4A 1PZTA 4ASJA 1ZCYA 2YQSA 3V8YA 1ZJPA 2Y6PA 2ZU9A 3U2UA 1IIMA 2XWNA 2VXMA 1EZIA 1H7LA 1ZJ3A 3PKQA 1LZ0A 3I0LA 4Y7FA 1H7HA 2X5ZA 3EE5A 4BQHA 3U0YA 5IDSA 4B2XA 4P00A 5CQOA 3SXCA 2Z86A 1OQMB 4B3UA 2PX7A 3JTJA 2BO8A 1Z90A 4FRHA 3PKPA 3ST8A 2RJ8A 4AAWA 4HO9A 4Y7VA 4KPZA 3SXAA 1G2VA 2Y4MA 1H7TA 4FRPA 2FYBA 1ZJ1A 4L41C 3Q80A 5JQQA 2VS5A 1H4DA 2A8WA 3T7MA 1FWYA 1VGTA 5C3AA 2P6WA 2QKXA 1MP5A 3V90A 2AM4A 4AC3A 1V83A 1H5TB 2FYDB 3ZGGA 2PA4A 4DDZA 2WVLA 4XWIA 2JCKA 4K6RA 5CMIA 1R7YA 2WVKA 2YESA 4D0ZA 5C4EA 1HV9A 1EYRA 5FTSA 3ZGFA 2AE7A 1G23A 3OH1A 3I0EA 2Y7AA 2BO7A 1VH3A 4Y64A 2YCMA 1O7QA 1G0RA 1ZDFA 2V0KA 4ARWA 3SXBA 4CJCA 4DE7A 5C1HA 1VGUA 4IRQA 1H3MA 1QGQA 2V0LA 3D5NA 3V0NA 4E1KA 1R7UA 1O23B 1FZWA 3PNNA 1FOAA 2APCA 4HOCA 5I1FA 2DPWA 2VD4A 4NAKA 1VZTA 2XWMA 2RJ5A 2QGIA 2VSHA 1INIA 1E5KA 3CKNA 3IOJA 4NANA 2XWLA 1NKHB 3OH2A 1JVGA 4KQLA 2ZU8A 5C38A 3F1CA 2I5EA 1VH1A 4EEGA 3E25A 2BO4A 1R81A 1FXJA 2O1FA 2AM3A 2YC3A 3D98A 4KNRA 4AYLA 4NALA 4Y62A 1OMXA 4Y7GA 2ICYA 4FRBA 3SX7A 1WT1A 3JUJA 1H5TA 2AECA 2WVMA 1ZCUA 2OEGA 5FUHA 3DJ4A 2WEEA 2W0VA 1GX0A 4HO6A 3SXDA 4D48A 4D11A 1W57A 2AM5A 3N9WA 3U2XA 1NHEB 2X65A 1GQCA 4FQWA 4HG6A 3V0LA 3V0MA 4G87A 1PZYB 2D7IA 2VXLA 1GA8A 1O7OA 3Q7UA 4FRLA 2PGVA 2RIXA 4EEAA 5CQMX 2V0IA 1H7GA 5DDTA 4FROA 1JV1A 4EE4A 5FU0A 3OH4A 1HM0A 2O1GA 4Y6NA 4MYBA 5AJNA 5L6SA 4LW6A 1R7VA 4G3SA 3TZTA 1QG8A 4EVWA 3GUEA 4Y63A 1MP4A 1VZXA 1HJJA 2A8UA 1YP4A 4ECMA 2YC5A 2FYAA 3RMWA 4B42A 2FY7A 3IOIA 4ZDQA 4KRVA 3SX8A 4JD0A 3SX5A 3OAMA 3V91A 1ZI3A 4CJBA 1G8OA 1G3LA 1G9RA 3D8VA 1VGZA 3V0OA 2WAWA 3SX3A 4EE3A 4KC2A 1MP3A 4YS8A 4B2WA 3U2WA 1R7TA 1G93A 2E8BA 4NAIA 4Y9XA 1V82A 1ZCVA 3POLA 1NF5B 1H4EA 1ZJ2A 1LVWA 1ZI1A 4AYJA 1S4PA 1WT3A 5CMGX 2ZU7A 5AJOA 1FXOA 4FRAA 1GX4A 1VICA 1LZJA 1WT0A 4M2BA 3ZLLA 4BMAA 4DECA 2Z87A 3K8EA 3OGZA 3T7OA 1VGWA 3K8DA 3BCVA 3CKJA 4Y7UA 3SXGA 5CMJA 2FYCB
chains in the Genus database with same CATH superfamily
2P73A 5EJ1A 4LW3A 1R7XA 5EIYA 3JUKA 4HCQA 1H5SC 1VPAA 4CVHA 1TVYA 4B4BA 1S4NA 1G95A 4KPXA 2D7RA 4C2SA 3Q4SA 2I7BA 3RMVA 5CQNX 4Y7TA 3CKOA 3FWWA 2MZBA 3R2WA 4HO3A 3I0GA 3DUVA 5C48A 1SS9A 1H7EA 2VSIA 1H5RA 5FV9A 1TW5A 2V0HA 2RITA 5EJZA 1YP2A 3OH0A 4KNXA 1ZJOA 4FCEA 2Y4JA 5C49A 3U0XA 1JYKA 1W77A 1FR8A 2RIZA 4M4KA 1XZ6A 3I0HA 3LW6A 5C4CA 5D91A 5FU8A 1WVCA 3I0FA 3I0JA 5FYEA 5IDTA 1QWJA 4FRQA 3V8ZA 2RJ7A 4HO5A 2OI6A 4Q7CA 5CQLX 1O0RA 1FR9A 1LL3A 3ZLKA 4KC4A 4EE5A 3CGXA 4UEGA 1ZJ0A 1FGGA 5C4DA 2RJ0A 3SPTA 2VS4A 1W55A 3I0IX 3I0CA 5CQPA 2NXVA 4KXOA 2RJ6A 2OI5A 2RIYA 1ON8A 3FOQA 1FGXA 3U2VA 2E3DA 4MIXA 4M2AA 1H5SA 4B5BA 2GGOA 1XHBA 3V0PA 3CU0A 1H5RB 5C1GA 1JVDA 4EEMA 1H5SD 4FRMA 4HO4A 4D0TA 1ZHJA 4ASYA 3U2TA 3F1YA 4CJ8A 1WT2A 3I0DA 2VS3A 1TZFA 1V84A 5L6VA 1HM8A 3V0QA 3OC9A 4HO8A 4G3PA 1GQ9A 4IRPA 1NWGB 1ZI5A 1HJLA 5C1LA 2AGDA 4FRDA 3O3PA 3HL3A 1VM8A 1H7FA 1VZUA 1IINA 4O6MA 1R80A 2VFZA 2Y4LA 5CMFX 1NMMB 3BRKX 1ZCTA 5AJPA 4FREA 2X60A 1YROB 2AESA 2JCOA 1WSZA 1LZIA 5C4FA 2FFVA 1FO9A 1JYLA 2V0JA 2YQCA 3I0KA 2QH5A 3DK5A 5J49A 3R3IA 5DDVA 5HS2A 1JV3A 1H5SB 2PGYA 4O6NA 2WE9A 4HO2A 2XMEA 2Q4JA 4M28A 3TQDA 2JCJA 1GWWA 4B4GA 2X5SA 1GWVA 2OEFA 1H7QA 2Y4KA 1FRWA 1KWSA 2JCLA 2I5KA 4JISA 4MNDA 5D92A 2RJ9A 3OH3A 2RJ1A 4FCUA 4KT7A 5C8RA 1NQIB 2BO6A 4P02A 5C36A 4D11C 3KIAA 1LZ7A 2GGQA 5IFYA 2ICXA 4G3QA 3QVBA 5C3BA 5CMHA 3USRA 2YQJA 3NGWA 4R7PA 4KC1A 1H4CA 1G1LA 1QGSA 1MC3A 3RSBA 2YQHA 3T7NA 1ON6A 2UX8A 3USQA 1K4VA 1LL2A 1FG5N 1OMZA 3SXEA 1ZDGA 1ZIZA 2CU2A 3CKVA 2AH9A 2O1HA 3CKQA 4B4MA 2RJ4A 2P72A 5C47A 1TW1A 3E26A 4HO0A 3OKRA 1INJA 1G97A 5C3DA 4Y6UA 2WGZA 5FTVA 2XMHA 2D0JA 1I52A 4GBPA 2FFUA 5C4BA 1FO8A 1R82A 5BXCA 3ZF8A 4J18A 1S4OA 1YP3A 1HM9A 2W0WA 1LL0A 2OI7A 3IOHA 4EEOA 1ZI4A 1PZTA 4ASJA 1ZCYA 2YQSA 3V8YA 1ZJPA 2Y6PA 2ZU9A 3U2UA 1IIMA 2XWNA 2VXMA 1EZIA 4FIXA 1H7LA 1ZJ3A 3PKQA 1LZ0A 3I0LA 4Y7FA 1H7HA 2X5ZA 3EE5A 4BQHA 3U0YA 5IDSA 4B2XA 4P00A 5CQOA 3SXCA 2Z86A 1OQMB 4B3UA 2PX7A 3JTJA 2BO8A 1Z90A 4FRHA 3PKPA 3ST8A 2RJ8A 4AAWA 4HO9A 4Y7VA 4KPZA 3SXAA 1G2VA 2Y4MA 1H7TA 4FRPA 2FYBA 1ZJ1A 4L41C 3Q80A 5JQQA 2VS5A 1H4DA 2A8WA 3T7MA 1FWYA 1VGTA 5C3AA 2P6WA 2QKXA 1MP5A 3V90A 2AM4A 4AC3A 1V83A 1H5TB 2FYDB 3ZGGA 2PA4A 4DDZA 2WVLA 4XWIA 2JCKA 4K6RA 5CMIA 1R7YA 2WVKA 2YESA 4D0ZA 5C4EA 1HV9A 1EYRA 5FTSA 3ZGFA 2AE7A 1G23A 3OH1A 3I0EA 2Y7AA 2BO7A 1VH3A 4Y64A 2YCMA 2J0BA 2VK9A 1O7QA 1G0RA 1ZDFA 2V0KA 4ARWA 3SXBA 4CJCA 4DE7A 5C1HA 1VGUA 4IRQA 1H3MA 1QGQA 2V0LA 3D5NA 3V0NA 4E1KA 1R7UA 1O23B 1FZWA 3PNNA 1FOAA 2APCA 4HOCA 5I1FA 2DPWA 2VD4A 4NAKA 1VZTA 2XWMA 2RJ5A 2QGIA 2VSHA 1INIA 1E5KA 3CKNA 3IOJA 4NANA 2XWLA 1NKHB 3OH2A 1JVGA 4KQLA 2ZU8A 5C38A 3F1CA 2I5EA 1VH1A 4EEGA 3E25A 2BO4A 1R81A 1FXJA 2O1FA 2AM3A 2YC3A 3D98A 4KNRA 4AYLA 4NALA 4Y62A 1OMXA 4Y7GA 2ICYA 4FRBA 3SX7A 1WT1A 3JUJA 1H5TA 2AECA 2WVMA 1ZCUA 2OEGA 5FUHA 2C0NA 3DJ4A 2WEEA 2W0VA 1GX0A 4HO6A 3SXDA 4D48A 4D11A 1W57A 2AM5A 3N9WA 3U2XA 1NHEB 2X65A 1GQCA 4FQWA 4HG6A 3V0LA 3V0MA 4G87A 1PZYB 2D7IA 2VXLA 1GA8A 1O7OA 3Q7UA 4FRLA 2PGVA 2RIXA 4EEAA 5CQMX 2V0IA 1H7GA 5DDTA 4FROA 1JV1A 4EE4A 5FU0A 3OH4A 1HM0A 2O1GA 4Y6NA 4MYBA 5AJNA 5L6SA 4LW6A 1R7VA 4G3SA 3TZTA 1QG8A 4EVWA 3GUEA 4Y63A 1MP4A 1VZXA 1HJJA 2A8UA 1YP4A 4ECMA 2YC5A 2FYAA 3RMWA 4B42A 2FY7A 3IOIA 4ZDQA 4KRVA 3SX8A 4JD0A 3SX5A 3OAMA 3V91A 1ZI3A 4CJBA 1G8OA 1G3LA 1G9RA 2J0AA 3D8VA 1VGZA 3V0OA 2WAWA 3SX3A 4EE3A 4KC2A 1MP3A 4YS8A 4B2WA 3U2WA 1R7TA 1G93A 2E8BA 4NAIA 4Y9XA 1V82A 1ZCVA 3POLA 1NF5B 1H4EA 1ZJ2A 1LVWA 1ZI1A 4AYJA 1S4PA 1WT3A 5CMGX 2ZU7A 5AJOA 1FXOA 4FRAA 1GX4A 1VICA 1LZJA 1WT0A 4M2BA 3ZLLA 4BMAA 4DECA 2Z87A 3K8EA 3OGZA 3T7OA 1VGWA 3K8DA 3BCVA 3CKJA 4FIYA 4Y7UA 3SXGA 5CMJA 2FYCB
chains in the Genus database with same CATH topology
2P73A 5EJ1A 4LW3A 1R7XA 5EIYA 3JUKA 4HCQA 1H5SC 1VPAA 4CVHA 1TVYA 4B4BA 1S4NA 1G95A 4KPXA 2D7RA 4C2SA 3Q4SA 2I7BA 3RMVA 5CQNX 4Y7TA 3CKOA 3FWWA 2MZBA 3R2WA 4HO3A 3I0GA 3DUVA 5C48A 1SS9A 1H7EA 2VSIA 1H5RA 5FV9A 1TW5A 2V0HA 2RITA 5EJZA 1YP2A 3OH0A 4KNXA 1ZJOA 4FCEA 2Y4JA 5C49A 3U0XA 1JYKA 1W77A 1FR8A 2RIZA 4M4KA 1XZ6A 3I0HA 3LW6A 5C4CA 5D91A 5FU8A 1WVCA 3I0FA 3I0JA 5FYEA 5IDTA 1QWJA 4FRQA 3V8ZA 2RJ7A 4HO5A 2OI6A 4Q7CA 5CQLX 1O0RA 1FR9A 1LL3A 3ZLKA 4KC4A 4EE5A 3CGXA 4UEGA 1ZJ0A 1FGGA 5C4DA 2RJ0A 3SPTA 2VS4A 1W55A 3I0IX 3I0CA 5CQPA 2NXVA 4KXOA 2RJ6A 2OI5A 2RIYA 1ON8A 3FOQA 1FGXA 3U2VA 2E3DA 4MIXA 4M2AA 1H5SA 4B5BA 2GGOA 1XHBA 3V0PA 3CU0A 1H5RB 5C1GA 1JVDA 4EEMA 1H5SD 4FRMA 4HO4A 4D0TA 1ZHJA 4ASYA 3U2TA 3F1YA 4CJ8A 1WT2A 3I0DA 2VS3A 1TZFA 1V84A 5L6VA 1HM8A 3V0QA 3OC9A 4HO8A 4G3PA 1GQ9A 4IRPA 1NWGB 1ZI5A 1HJLA 5C1LA 2AGDA 4FRDA 3O3PA 3HL3A 1VM8A 1H7FA 1VZUA 1IINA 4O6MA 1R80A 2VFZA 2Y4LA 5CMFX 1NMMB 3BRKX 1ZCTA 5AJPA 4FREA 2X60A 1YROB 2AESA 2JCOA 1WSZA 1LZIA 5C4FA 2FFVA 1FO9A 1JYLA 2V0JA 2YQCA 3I0KA 2QH5A 3DK5A 5J49A 3R3IA 5DDVA 5HS2A 1JV3A 1H5SB 2PGYA 4O6NA 2WE9A 4HO2A 2XMEA 2Q4JA 4M28A 3TQDA 2JCJA 1GWWA 4B4GA 2X5SA 1GWVA 2OEFA 1H7QA 2Y4KA 1FRWA 1KWSA 2JCLA 2I5KA 4JISA 4MNDA 5D92A 2RJ9A 3OH3A 2RJ1A 4FCUA 4KT7A 5C8RA 1NQIB 2BO6A 4P02A 5C36A 4D11C 3KIAA 1LZ7A 2GGQA 5IFYA 2ICXA 4G3QA 3QVBA 5C3BA 5CMHA 3USRA 2YQJA 3NGWA 4R7PA 4KC1A 1H4CA 1G1LA 1QGSA 1MC3A 3RSBA 2YQHA 3T7NA 1ON6A 2UX8A 3USQA 1K4VA 1LL2A 1FG5N 1OMZA 3SXEA 1ZDGA 1ZIZA 2CU2A 3CKVA 2AH9A 2O1HA 3CKQA 4B4MA 2RJ4A 2P72A 5C47A 1TW1A 3E26A 4HO0A 3OKRA 1INJA 1G97A 5C3DA 4Y6UA 2WGZA 5FTVA 2XMHA 2D0JA 1I52A 4GBPA 2FFUA 5C4BA 1FO8A 1R82A 5BXCA 3ZF8A 4J18A 1S4OA 1YP3A 1HM9A 2W0WA 1LL0A 2OI7A 3IOHA 4EEOA 1ZI4A 1PZTA 4ASJA 1ZCYA 2YQSA 3V8YA 1ZJPA 2Y6PA 2ZU9A 3U2UA 1IIMA 2XWNA 2VXMA 1EZIA 4FIXA 1H7LA 1ZJ3A 3PKQA 1LZ0A 3I0LA 4Y7FA 1H7HA 2X5ZA 3EE5A 4BQHA 3U0YA 5IDSA 4B2XA 4P00A 5CQOA 3SXCA 2Z86A 1OQMB 4B3UA 2PX7A 3JTJA 2BO8A 1Z90A 4FRHA 3PKPA 3ST8A 2RJ8A 4AAWA 4HO9A 4Y7VA 4KPZA 3SXAA 1G2VA 2Y4MA 1H7TA 4FRPA 2FYBA 1ZJ1A 4L41C 3Q80A 5JQQA 2VS5A 1H4DA 2A8WA 3T7MA 1FWYA 1VGTA 5C3AA 2P6WA 2QKXA 1MP5A 3V90A 2AM4A 4AC3A 1V83A 1H5TB 2FYDB 3ZGGA 2PA4A 4DDZA 2WVLA 4XWIA 2JCKA 4K6RA 5CMIA 1R7YA 2WVKA 2YESA 4D0ZA 5C4EA 1HV9A 1EYRA 5FTSA 3ZGFA 2AE7A 1G23A 3OH1A 3I0EA 2Y7AA 2BO7A 1VH3A 4Y64A 2YCMA 2J0BA 2VK9A 1O7QA 1G0RA 1ZDFA 2V0KA 4ARWA 3SXBA 4CJCA 4DE7A 5C1HA 1VGUA 4IRQA 1H3MA 1QGQA 2V0LA 3D5NA 3V0NA 4E1KA 1R7UA 1O23B 1FZWA 3PNNA 1FOAA 2APCA 4HOCA 5I1FA 2DPWA 2VD4A 4NAKA 1VZTA 2XWMA 2RJ5A 2QGIA 2VSHA 1INIA 1E5KA 3CKNA 3IOJA 4NANA 2XWLA 1NKHB 3OH2A 1JVGA 4KQLA 2ZU8A 5C38A 3F1CA 2I5EA 1VH1A 4EEGA 3E25A 2BO4A 1R81A 1FXJA 2O1FA 2AM3A 2YC3A 3D98A 4KNRA 4AYLA 4NALA 4Y62A 1OMXA 4Y7GA 2ICYA 4FRBA 3SX7A 1WT1A 3JUJA 1H5TA 2AECA 2WVMA 1ZCUA 2OEGA 5FUHA 2C0NA 3DJ4A 2WEEA 2W0VA 1GX0A 4HO6A 3SXDA 4D48A 4D11A 1W57A 2AM5A 3N9WA 3U2XA 1NHEB 2X65A 1GQCA 4FQWA 4HG6A 3V0LA 3V0MA 4G87A 1PZYB 2D7IA 2VXLA 1GA8A 1O7OA 3Q7UA 4FRLA 2PGVA 2RIXA 4EEAA 5CQMX 2V0IA 1H7GA 5DDTA 4FROA 1JV1A 4EE4A 5FU0A 3OH4A 1HM0A 2O1GA 4Y6NA 4MYBA 5AJNA 5L6SA 4LW6A 1R7VA 4G3SA 3TZTA 1QG8A 4EVWA 3GUEA 4Y63A 1MP4A 1VZXA 1HJJA 2A8UA 1YP4A 4ECMA 2YC5A 2FYAA 3RMWA 4B42A 2FY7A 3IOIA 4ZDQA 4KRVA 3SX8A 4JD0A 3SX5A 3OAMA 3V91A 1ZI3A 4CJBA 1G8OA 1G3LA 1G9RA 2J0AA 3D8VA 1VGZA 3V0OA 2WAWA 3SX3A 4EE3A 4KC2A 1MP3A 4YS8A 4B2WA 3U2WA 1R7TA 1G93A 2E8BA 4NAIA 4Y9XA 1V82A 1ZCVA 3POLA 1NF5B 1H4EA 1ZJ2A 1LVWA 1ZI1A 4AYJA 1S4PA 1WT3A 5CMGX 2ZU7A 5AJOA 1FXOA 4FRAA 1GX4A 1VICA 1LZJA 1WT0A 4M2BA 3ZLLA 4BMAA 4DECA 2Z87A 3K8EA 3OGZA 3T7OA 1VGWA 3K8DA 3BCVA 3CKJA 4FIYA 4Y7UA 3SXGA 5CMJA 2FYCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P73 A;  5EJ1 A;  4LW3 A;  1R7X A;  5EIY A;  3JUK A;  4HCQ A;  1H5S C;  1VPA A;  4CVH A;  1TVY A;  4B4B A;  1S4N A;  1G95 A;  4KPX A;  2D7R A;  4C2S A;  3Q4S A;  2I7B A;  3RMV A;  5CQN X;  4Y7T A;  3CKO A;  3FWW A;  2MZB A;  3R2W A;  4HO3 A;  3I0G A;  3DUV A;  5C48 A;  1SS9 A;  1H7E A;  2VSI A;  1H5R A;  5FV9 A;  1TW5 A;  2V0H A;  2RIT A;  5EJZ A;  1YP2 A;  3OH0 A;  4KNX A;  1ZJO A;  4FCE A;  2Y4J A;  5C49 A;  3U0X A;  1JYK A;  1W77 A;  1FR8 A;  2RIZ A;  4M4K A;  1XZ6 A;  3I0H A;  3LW6 A;  5C4C A;  5FU8 A;  1WVC A;  3I0F A;  3I0J A;  5FYE A;  5IDT A;  1QWJ A;  4FRQ A;  3V8Z A;  2RJ7 A;  4HO5 A;  2OI6 A;  5CQL X;  1O0R A;  1FR9 A;  1LL3 A;  3ZLK A;  4KC4 A;  4EE5 A;  3CGX A;  4UEG A;  1ZJ0 A;  1FGG A;  5C4D A;  2RJ0 A;  3SPT A;  2VS4 A;  1W55 A;  3I0I X;  3I0C A;  5CQP A;  2NXV A;  4KXO A;  2RJ6 A;  2OI5 A;  2RIY A;  1ON8 A;  3FOQ A;  1FGX A;  3U2V A;  2E3D A;  4M2A A;  1H5S A;  4B5B A;  2GGO A;  1XHB A;  3V0P A;  3CU0 A;  1H5R B;  5C1G A;  1JVD A;  4EEM A;  1H5S D;  4FRM A;  4HO4 A;  4D0T A;  1ZHJ A;  4ASY A;  3U2T A;  3F1Y A;  4CJ8 A;  1WT2 A;  3I0D A;  2VS3 A;  1TZF A;  1V84 A;  5L6V A;  1HM8 A;  3V0Q A;  3OC9 A;  4HO8 A;  4G3P A;  1GQ9 A;  4IRP A;  1NWG B;  1ZI5 A;  1HJL A;  5C1L A;  2AGD A;  4FRD A;  3O3P A;  3HL3 A;  1VM8 A;  1H7F A;  1VZU A;  1IIN A;  1R80 A;  2VFZ A;  2Y4L A;  5CMF X;  1NMM B;  3BRK X;  1ZCT A;  5AJP A;  4FRE A;  2X60 A;  1YRO B;  2AES A;  2JCO A;  1WSZ A;  1LZI A;  5C4F A;  2FFV A;  1FO9 A;  1JYL A;  2V0J A;  2YQC A;  3I0K A;  2QH5 A;  3DK5 A;  5J49 A;  3R3I A;  5DDV A;  5HS2 A;  1JV3 A;  1H5S B;  2PGY A;  2WE9 A;  4HO2 A;  2XME A;  2Q4J A;  4M28 A;  3TQD A;  2JCJ A;  1GWW A;  4B4G A;  2X5S A;  1GWV A;  2OEF A;  1H7Q A;  2Y4K A;  1FRW A;  1KWS A;  2JCL A;  2I5K A;  4JIS A;  4MND A;  2RJ9 A;  3OH3 A;  2RJ1 A;  4FCU A;  4KT7 A;  5C8R A;  1NQI B;  2BO6 A;  4P02 A;  5C36 A;  4D11 C;  3KIA A;  1LZ7 A;  2GGQ A;  5IFY A;  2ICX A;  4G3Q A;  3QVB A;  5C3B A;  5CMH A;  3USR A;  2YQJ A;  3NGW A;  4R7P A;  4KC1 A;  1H4C A;  1G1L A;  1QGS A;  1MC3 A;  3RSB A;  2YQH A;  3T7N A;  1ON6 A;  2UX8 A;  3USQ A;  1K4V A;  1LL2 A;  1FG5 N;  1OMZ A;  3SXE A;  1ZDG A;  1ZIZ A;  2CU2 A;  3CKV A;  2AH9 A;  2O1H A;  3CKQ A;  4B4M A;  2RJ4 A;  2P72 A;  5C47 A;  1TW1 A;  3E26 A;  4HO0 A;  3OKR A;  1INJ A;  1G97 A;  5C3D A;  4Y6U A;  2WGZ A;  5FTV A;  2XMH A;  2D0J A;  1I52 A;  4GBP A;  2FFU A;  5C4B A;  1FO8 A;  1R82 A;  5BXC A;  3ZF8 A;  4J18 A;  1S4O A;  1YP3 A;  1HM9 A;  2W0W A;  1LL0 A;  2OI7 A;  3IOH A;  4EEO A;  1ZI4 A;  1PZT A;  4ASJ A;  1ZCY A;  2YQS A;  3V8Y A;  1ZJP A;  2Y6P A;  2ZU9 A;  3U2U A;  1IIM A;  2XWN A;  2VXM A;  1EZI A;  1H7L A;  1ZJ3 A;  3PKQ A;  1LZ0 A;  3I0L A;  4Y7F A;  1H7H A;  2X5Z A;  3EE5 A;  4BQH A;  3U0Y A;  5IDS A;  4B2X A;  4P00 A;  5CQO A;  3SXC A;  2Z86 A;  1OQM B;  4B3U A;  2PX7 A;  3JTJ A;  2BO8 A;  1Z90 A;  4FRH A;  3PKP A;  3ST8 A;  2RJ8 A;  4AAW A;  4HO9 A;  4Y7V A;  4KPZ A;  3SXA A;  1G2V A;  2Y4M A;  1H7T A;  4FRP A;  2FYB A;  1ZJ1 A;  4L41 C;  3Q80 A;  5JQQ A;  2VS5 A;  1H4D A;  2A8W A;  3T7M A;  1FWY A;  1VGT A;  5C3A A;  2P6W A;  2QKX A;  1MP5 A;  3V90 A;  2AM4 A;  4AC3 A;  1V83 A;  1H5T B;  2FYD B;  3ZGG A;  2PA4 A;  4DDZ A;  2WVL A;  4XWI A;  2JCK A;  4K6R A;  5CMI A;  1R7Y A;  2WVK A;  2YES A;  4D0Z A;  5C4E A;  1HV9 A;  1EYR A;  5FTS A;  3ZGF A;  2AE7 A;  1G23 A;  3OH1 A;  3I0E A;  2Y7A A;  2BO7 A;  1VH3 A;  4Y64 A;  2YCM A;  1O7Q A;  1G0R A;  1ZDF A;  2V0K A;  4ARW A;  3SXB A;  4CJC A;  4DE7 A;  5C1H A;  1VGU A;  4IRQ A;  1H3M A;  1QGQ A;  2V0L A;  3D5N A;  3V0N A;  4E1K A;  1R7U A;  1O23 B;  1FZW A;  3PNN A;  1FOA A;  2APC A;  4HOC A;  5I1F A;  2DPW A;  2VD4 A;  4NAK A;  1VZT A;  2XWM A;  2RJ5 A;  2QGI A;  2VSH A;  1INI A;  1E5K A;  3CKN A;  3IOJ A;  4NAN A;  2XWL A;  1NKH B;  3OH2 A;  1JVG A;  4KQL A;  2ZU8 A;  5C38 A;  3F1C A;  2I5E A;  1VH1 A;  4EEG A;  3E25 A;  2BO4 A;  1R81 A;  1FXJ A;  2O1F A;  2AM3 A;  2YC3 A;  3D98 A;  4KNR A;  4AYL A;  4NAL A;  4Y62 A;  1OMX A;  4Y7G A;  2ICY A;  4FRB A;  3SX7 A;  1WT1 A;  3JUJ A;  1H5T A;  2AEC A;  2WVM A;  1ZCU A;  2OEG A;  5FUH A;  3DJ4 A;  2WEE A;  2W0V A;  1GX0 A;  4HO6 A;  3SXD A;  4D48 A;  4D11 A;  1W57 A;  2AM5 A;  3N9W A;  3U2X A;  1NHE B;  2X65 A;  1GQC A;  4FQW A;  4HG6 A;  3V0L A;  3V0M A;  4G87 A;  1PZY B;  2D7I A;  2VXL A;  1GA8 A;  1O7O A;  3Q7U A;  4FRL A;  2PGV A;  2RIX A;  4EEA A;  5CQM X;  2V0I A;  1H7G A;  5DDT A;  4FRO A;  1JV1 A;  4EE4 A;  5FU0 A;  3OH4 A;  1HM0 A;  2O1G A;  4Y6N A;  4MYB A;  5AJN A;  5L6S A;  4LW6 A;  1R7V A;  4G3S A;  3TZT A;  1QG8 A;  4EVW A;  3GUE A;  4Y63 A;  1MP4 A;  1VZX A;  1HJJ A;  2A8U A;  1YP4 A;  4ECM A;  2YC5 A;  2FYA A;  3RMW A;  4B42 A;  2FY7 A;  3IOI A;  4ZDQ A;  4KRV A;  3SX8 A;  4JD0 A;  3SX5 A;  3OAM A;  3V91 A;  1ZI3 A;  4CJB A;  1G8O A;  1G3L A;  1G9R A;  3D8V A;  1VGZ A;  3V0O A;  2WAW A;  3SX3 A;  4EE3 A;  4KC2 A;  1MP3 A;  4YS8 A;  4B2W A;  3U2W A;  1R7T A;  1G93 A;  2E8B A;  4NAI A;  4Y9X A;  1V82 A;  1ZCV A;  3POL A;  1NF5 B;  1H4E A;  1ZJ2 A;  1LVW A;  1ZI1 A;  4AYJ A;  1S4P A;  1WT3 A;  5CMG X;  2ZU7 A;  5AJO A;  1FXO A;  4FRA A;  1GX4 A;  1VIC A;  1LZJ A;  1WT0 A;  4M2B A;  3ZLL A;  4BMA A;  4DEC A;  2Z87 A;  3K8E A;  3OGZ A;  3T7O A;  1VGW A;  3K8D A;  3BCV A;  3CKJ A;  4Y7U A;  3SXG A;  5CMJ A;  2FYC B; 
#chains in the Genus database with same CATH topology
 2P73 A;  5EJ1 A;  4LW3 A;  1R7X A;  5EIY A;  3JUK A;  4HCQ A;  1H5S C;  1VPA A;  4CVH A;  1TVY A;  4B4B A;  1S4N A;  1G95 A;  4KPX A;  2D7R A;  4C2S A;  3Q4S A;  2I7B A;  3RMV A;  5CQN X;  4Y7T A;  3CKO A;  3FWW A;  2MZB A;  3R2W A;  4HO3 A;  3I0G A;  3DUV A;  5C48 A;  1SS9 A;  1H7E A;  2VSI A;  1H5R A;  5FV9 A;  1TW5 A;  2V0H A;  2RIT A;  5EJZ A;  1YP2 A;  3OH0 A;  4KNX A;  1ZJO A;  4FCE A;  2Y4J A;  5C49 A;  3U0X A;  1JYK A;  1W77 A;  1FR8 A;  2RIZ A;  4M4K A;  1XZ6 A;  3I0H A;  3LW6 A;  5C4C A;  5D91 A;  5FU8 A;  1WVC A;  3I0F A;  3I0J A;  5FYE A;  5IDT A;  1QWJ A;  4FRQ A;  3V8Z A;  2RJ7 A;  4HO5 A;  2OI6 A;  4Q7C A;  5CQL X;  1O0R A;  1FR9 A;  1LL3 A;  3ZLK A;  4KC4 A;  4EE5 A;  3CGX A;  4UEG A;  1ZJ0 A;  1FGG A;  5C4D A;  2RJ0 A;  3SPT A;  2VS4 A;  1W55 A;  3I0I X;  3I0C A;  5CQP A;  2NXV A;  4KXO A;  2RJ6 A;  2OI5 A;  2RIY A;  1ON8 A;  3FOQ A;  1FGX A;  3U2V A;  2E3D A;  4MIX A;  4M2A A;  1H5S A;  4B5B A;  2GGO A;  1XHB A;  3V0P A;  3CU0 A;  1H5R B;  5C1G A;  1JVD A;  4EEM A;  1H5S D;  4FRM A;  4HO4 A;  4D0T A;  1ZHJ A;  4ASY A;  3U2T A;  3F1Y A;  4CJ8 A;  1WT2 A;  3I0D A;  2VS3 A;  1TZF A;  1V84 A;  5L6V A;  1HM8 A;  3V0Q A;  3OC9 A;  4HO8 A;  4G3P A;  1GQ9 A;  4IRP A;  1NWG B;  1ZI5 A;  1HJL A;  5C1L A;  2AGD A;  4FRD A;  3O3P A;  3HL3 A;  1VM8 A;  1H7F A;  1VZU A;  1IIN A;  4O6M A;  1R80 A;  2VFZ A;  2Y4L A;  5CMF X;  1NMM B;  3BRK X;  1ZCT A;  5AJP A;  4FRE A;  2X60 A;  1YRO B;  2AES A;  2JCO A;  1WSZ A;  1LZI A;  5C4F A;  2FFV A;  1FO9 A;  1JYL A;  2V0J A;  2YQC A;  3I0K A;  2QH5 A;  3DK5 A;  5J49 A;  3R3I A;  5DDV A;  5HS2 A;  1JV3 A;  1H5S B;  2PGY A;  4O6N A;  2WE9 A;  4HO2 A;  2XME A;  2Q4J A;  4M28 A;  3TQD A;  2JCJ A;  1GWW A;  4B4G A;  2X5S A;  1GWV A;  2OEF A;  1H7Q A;  2Y4K A;  1FRW A;  1KWS A;  2JCL A;  2I5K A;  4JIS A;  4MND A;  5D92 A;  2RJ9 A;  3OH3 A;  2RJ1 A;  4FCU A;  4KT7 A;  5C8R A;  1NQI B;  2BO6 A;  4P02 A;  5C36 A;  4D11 C;  3KIA A;  1LZ7 A;  2GGQ A;  5IFY A;  2ICX A;  4G3Q A;  3QVB A;  5C3B A;  5CMH A;  3USR A;  2YQJ A;  3NGW A;  4R7P A;  4KC1 A;  1H4C A;  1G1L A;  1QGS A;  1MC3 A;  3RSB A;  2YQH A;  3T7N A;  1ON6 A;  2UX8 A;  3USQ A;  1K4V A;  1LL2 A;  1FG5 N;  1OMZ A;  3SXE A;  1ZDG A;  1ZIZ A;  2CU2 A;  3CKV A;  2AH9 A;  2O1H A;  3CKQ A;  4B4M A;  2RJ4 A;  2P72 A;  5C47 A;  1TW1 A;  3E26 A;  4HO0 A;  3OKR A;  1INJ A;  1G97 A;  5C3D A;  4Y6U A;  2WGZ A;  5FTV A;  2XMH A;  2D0J A;  1I52 A;  4GBP A;  2FFU A;  5C4B A;  1FO8 A;  1R82 A;  5BXC A;  3ZF8 A;  4J18 A;  1S4O A;  1YP3 A;  1HM9 A;  2W0W A;  1LL0 A;  2OI7 A;  3IOH A;  4EEO A;  1ZI4 A;  1PZT A;  4ASJ A;  1ZCY A;  2YQS A;  3V8Y A;  1ZJP A;  2Y6P A;  2ZU9 A;  3U2U A;  1IIM A;  2XWN A;  2VXM A;  1EZI A;  4FIX A;  1H7L A;  1ZJ3 A;  3PKQ A;  1LZ0 A;  3I0L A;  4Y7F A;  1H7H A;  2X5Z A;  3EE5 A;  4BQH A;  3U0Y A;  5IDS A;  4B2X A;  4P00 A;  5CQO A;  3SXC A;  2Z86 A;  1OQM B;  4B3U A;  2PX7 A;  3JTJ A;  2BO8 A;  1Z90 A;  4FRH A;  3PKP A;  3ST8 A;  2RJ8 A;  4AAW A;  4HO9 A;  4Y7V A;  4KPZ A;  3SXA A;  1G2V A;  2Y4M A;  1H7T A;  4FRP A;  2FYB A;  1ZJ1 A;  4L41 C;  3Q80 A;  5JQQ A;  2VS5 A;  1H4D A;  2A8W A;  3T7M A;  1FWY A;  1VGT A;  5C3A A;  2P6W A;  2QKX A;  1MP5 A;  3V90 A;  2AM4 A;  4AC3 A;  1V83 A;  1H5T B;  2FYD B;  3ZGG A;  2PA4 A;  4DDZ A;  2WVL A;  4XWI A;  2JCK A;  4K6R A;  5CMI A;  1R7Y A;  2WVK A;  2YES A;  4D0Z A;  5C4E A;  1HV9 A;  1EYR A;  5FTS A;  3ZGF A;  2AE7 A;  1G23 A;  3OH1 A;  3I0E A;  2Y7A A;  2BO7 A;  1VH3 A;  4Y64 A;  2YCM A;  2J0B A;  2VK9 A;  1O7Q A;  1G0R A;  1ZDF A;  2V0K A;  4ARW A;  3SXB A;  4CJC A;  4DE7 A;  5C1H A;  1VGU A;  4IRQ A;  1H3M A;  1QGQ A;  2V0L A;  3D5N A;  3V0N A;  4E1K A;  1R7U A;  1O23 B;  1FZW A;  3PNN A;  1FOA A;  2APC A;  4HOC A;  5I1F A;  2DPW A;  2VD4 A;  4NAK A;  1VZT A;  2XWM A;  2RJ5 A;  2QGI A;  2VSH A;  1INI A;  1E5K A;  3CKN A;  3IOJ A;  4NAN A;  2XWL A;  1NKH B;  3OH2 A;  1JVG A;  4KQL A;  2ZU8 A;  5C38 A;  3F1C A;  2I5E A;  1VH1 A;  4EEG A;  3E25 A;  2BO4 A;  1R81 A;  1FXJ A;  2O1F A;  2AM3 A;  2YC3 A;  3D98 A;  4KNR A;  4AYL A;  4NAL A;  4Y62 A;  1OMX A;  4Y7G A;  2ICY A;  4FRB A;  3SX7 A;  1WT1 A;  3JUJ A;  1H5T A;  2AEC A;  2WVM A;  1ZCU A;  2OEG A;  5FUH A;  2C0N A;  3DJ4 A;  2WEE A;  2W0V A;  1GX0 A;  4HO6 A;  3SXD A;  4D48 A;  4D11 A;  1W57 A;  2AM5 A;  3N9W A;  3U2X A;  1NHE B;  2X65 A;  1GQC A;  4FQW A;  4HG6 A;  3V0L A;  3V0M A;  4G87 A;  1PZY B;  2D7I A;  2VXL A;  1GA8 A;  1O7O A;  3Q7U A;  4FRL A;  2PGV A;  2RIX A;  4EEA A;  5CQM X;  2V0I A;  1H7G A;  5DDT A;  4FRO A;  1JV1 A;  4EE4 A;  5FU0 A;  3OH4 A;  1HM0 A;  2O1G A;  4Y6N A;  4MYB A;  5AJN A;  5L6S A;  4LW6 A;  1R7V A;  4G3S A;  3TZT A;  1QG8 A;  4EVW A;  3GUE A;  4Y63 A;  1MP4 A;  1VZX A;  1HJJ A;  2A8U A;  1YP4 A;  4ECM A;  2YC5 A;  2FYA A;  3RMW A;  4B42 A;  2FY7 A;  3IOI A;  4ZDQ A;  4KRV A;  3SX8 A;  4JD0 A;  3SX5 A;  3OAM A;  3V91 A;  1ZI3 A;  4CJB A;  1G8O A;  1G3L A;  1G9R A;  2J0A A;  3D8V A;  1VGZ A;  3V0O A;  2WAW A;  3SX3 A;  4EE3 A;  4KC2 A;  1MP3 A;  4YS8 A;  4B2W A;  3U2W A;  1R7T A;  1G93 A;  2E8B A;  4NAI A;  4Y9X A;  1V82 A;  1ZCV A;  3POL A;  1NF5 B;  1H4E A;  1ZJ2 A;  1LVW A;  1ZI1 A;  4AYJ A;  1S4P A;  1WT3 A;  5CMG X;  2ZU7 A;  5AJO A;  1FXO A;  4FRA A;  1GX4 A;  1VIC A;  1LZJ A;  1WT0 A;  4M2B A;  3ZLL A;  4BMA A;  4DEC A;  2Z87 A;  3K8E A;  3OGZ A;  3T7O A;  1VGW A;  3K8D A;  3BCV A;  3CKJ A;  4FIY A;  4Y7U A;  3SXG A;  5CMJ A;  2FYC B; 
#chains in the Genus database with same CATH homology
 2P73 A;  5EJ1 A;  4LW3 A;  1R7X A;  5EIY A;  3JUK A;  4HCQ A;  1H5S C;  1VPA A;  4CVH A;  1TVY A;  4B4B A;  1S4N A;  1G95 A;  4KPX A;  2D7R A;  4C2S A;  3Q4S A;  2I7B A;  3RMV A;  5CQN X;  4Y7T A;  3CKO A;  3FWW A;  2MZB A;  3R2W A;  4HO3 A;  3I0G A;  3DUV A;  5C48 A;  1SS9 A;  1H7E A;  2VSI A;  1H5R A;  5FV9 A;  1TW5 A;  2V0H A;  2RIT A;  5EJZ A;  1YP2 A;  3OH0 A;  4KNX A;  1ZJO A;  4FCE A;  2Y4J A;  5C49 A;  3U0X A;  1JYK A;  1W77 A;  1FR8 A;  2RIZ A;  4M4K A;  1XZ6 A;  3I0H A;  3LW6 A;  5C4C A;  5D91 A;  5FU8 A;  1WVC A;  3I0F A;  3I0J A;  5FYE A;  5IDT A;  1QWJ A;  4FRQ A;  3V8Z A;  2RJ7 A;  4HO5 A;  2OI6 A;  4Q7C A;  5CQL X;  1O0R A;  1FR9 A;  1LL3 A;  3ZLK A;  4KC4 A;  4EE5 A;  3CGX A;  4UEG A;  1ZJ0 A;  1FGG A;  5C4D A;  2RJ0 A;  3SPT A;  2VS4 A;  1W55 A;  3I0I X;  3I0C A;  5CQP A;  2NXV A;  4KXO A;  2RJ6 A;  2OI5 A;  2RIY A;  1ON8 A;  3FOQ A;  1FGX A;  3U2V A;  2E3D A;  4MIX A;  4M2A A;  1H5S A;  4B5B A;  2GGO A;  1XHB A;  3V0P A;  3CU0 A;  1H5R B;  5C1G A;  1JVD A;  4EEM A;  1H5S D;  4FRM A;  4HO4 A;  4D0T A;  1ZHJ A;  4ASY A;  3U2T A;  3F1Y A;  4CJ8 A;  1WT2 A;  3I0D A;  2VS3 A;  1TZF A;  1V84 A;  5L6V A;  1HM8 A;  3V0Q A;  3OC9 A;  4HO8 A;  4G3P A;  1GQ9 A;  4IRP A;  1NWG B;  1ZI5 A;  1HJL A;  5C1L A;  2AGD A;  4FRD A;  3O3P A;  3HL3 A;  1VM8 A;  1H7F A;  1VZU A;  1IIN A;  4O6M A;  1R80 A;  2VFZ A;  2Y4L A;  5CMF X;  1NMM B;  3BRK X;  1ZCT A;  5AJP A;  4FRE A;  2X60 A;  1YRO B;  2AES A;  2JCO A;  1WSZ A;  1LZI A;  5C4F A;  2FFV A;  1FO9 A;  1JYL A;  2V0J A;  2YQC A;  3I0K A;  2QH5 A;  3DK5 A;  5J49 A;  3R3I A;  5DDV A;  5HS2 A;  1JV3 A;  1H5S B;  2PGY A;  4O6N A;  2WE9 A;  4HO2 A;  2XME A;  2Q4J A;  4M28 A;  3TQD A;  2JCJ A;  1GWW A;  4B4G A;  2X5S A;  1GWV A;  2OEF A;  1H7Q A;  2Y4K A;  1FRW A;  1KWS A;  2JCL A;  2I5K A;  4JIS A;  4MND A;  5D92 A;  2RJ9 A;  3OH3 A;  2RJ1 A;  4FCU A;  4KT7 A;  5C8R A;  1NQI B;  2BO6 A;  4P02 A;  5C36 A;  4D11 C;  3KIA A;  1LZ7 A;  2GGQ A;  5IFY A;  2ICX A;  4G3Q A;  3QVB A;  5C3B A;  5CMH A;  3USR A;  2YQJ A;  3NGW A;  4R7P A;  4KC1 A;  1H4C A;  1G1L A;  1QGS A;  1MC3 A;  3RSB A;  2YQH A;  3T7N A;  1ON6 A;  2UX8 A;  3USQ A;  1K4V A;  1LL2 A;  1FG5 N;  1OMZ A;  3SXE A;  1ZDG A;  1ZIZ A;  2CU2 A;  3CKV A;  2AH9 A;  2O1H A;  3CKQ A;  4B4M A;  2RJ4 A;  2P72 A;  5C47 A;  1TW1 A;  3E26 A;  4HO0 A;  3OKR A;  1INJ A;  1G97 A;  5C3D A;  4Y6U A;  2WGZ A;  5FTV A;  2XMH A;  2D0J A;  1I52 A;  4GBP A;  2FFU A;  5C4B A;  1FO8 A;  1R82 A;  5BXC A;  3ZF8 A;  4J18 A;  1S4O A;  1YP3 A;  1HM9 A;  2W0W A;  1LL0 A;  2OI7 A;  3IOH A;  4EEO A;  1ZI4 A;  1PZT A;  4ASJ A;  1ZCY A;  2YQS A;  3V8Y A;  1ZJP A;  2Y6P A;  2ZU9 A;  3U2U A;  1IIM A;  2XWN A;  2VXM A;  1EZI A;  4FIX A;  1H7L A;  1ZJ3 A;  3PKQ A;  1LZ0 A;  3I0L A;  4Y7F A;  1H7H A;  2X5Z A;  3EE5 A;  4BQH A;  3U0Y A;  5IDS A;  4B2X A;  4P00 A;  5CQO A;  3SXC A;  2Z86 A;  1OQM B;  4B3U A;  2PX7 A;  3JTJ A;  2BO8 A;  1Z90 A;  4FRH A;  3PKP A;  3ST8 A;  2RJ8 A;  4AAW A;  4HO9 A;  4Y7V A;  4KPZ A;  3SXA A;  1G2V A;  2Y4M A;  1H7T A;  4FRP A;  2FYB A;  1ZJ1 A;  4L41 C;  3Q80 A;  5JQQ A;  2VS5 A;  1H4D A;  2A8W A;  3T7M A;  1FWY A;  1VGT A;  5C3A A;  2P6W A;  2QKX A;  1MP5 A;  3V90 A;  2AM4 A;  4AC3 A;  1V83 A;  1H5T B;  2FYD B;  3ZGG A;  2PA4 A;  4DDZ A;  2WVL A;  4XWI A;  2JCK A;  4K6R A;  5CMI A;  1R7Y A;  2WVK A;  2YES A;  4D0Z A;  5C4E A;  1HV9 A;  1EYR A;  5FTS A;  3ZGF A;  2AE7 A;  1G23 A;  3OH1 A;  3I0E A;  2Y7A A;  2BO7 A;  1VH3 A;  4Y64 A;  2YCM A;  2J0B A;  2VK9 A;  1O7Q A;  1G0R A;  1ZDF A;  2V0K A;  4ARW A;  3SXB A;  4CJC A;  4DE7 A;  5C1H A;  1VGU A;  4IRQ A;  1H3M A;  1QGQ A;  2V0L A;  3D5N A;  3V0N A;  4E1K A;  1R7U A;  1O23 B;  1FZW A;  3PNN A;  1FOA A;  2APC A;  4HOC A;  5I1F A;  2DPW A;  2VD4 A;  4NAK A;  1VZT A;  2XWM A;  2RJ5 A;  2QGI A;  2VSH A;  1INI A;  1E5K A;  3CKN A;  3IOJ A;  4NAN A;  2XWL A;  1NKH B;  3OH2 A;  1JVG A;  4KQL A;  2ZU8 A;  5C38 A;  3F1C A;  2I5E A;  1VH1 A;  4EEG A;  3E25 A;  2BO4 A;  1R81 A;  1FXJ A;  2O1F A;  2AM3 A;  2YC3 A;  3D98 A;  4KNR A;  4AYL A;  4NAL A;  4Y62 A;  1OMX A;  4Y7G A;  2ICY A;  4FRB A;  3SX7 A;  1WT1 A;  3JUJ A;  1H5T A;  2AEC A;  2WVM A;  1ZCU A;  2OEG A;  5FUH A;  2C0N A;  3DJ4 A;  2WEE A;  2W0V A;  1GX0 A;  4HO6 A;  3SXD A;  4D48 A;  4D11 A;  1W57 A;  2AM5 A;  3N9W A;  3U2X A;  1NHE B;  2X65 A;  1GQC A;  4FQW A;  4HG6 A;  3V0L A;  3V0M A;  4G87 A;  1PZY B;  2D7I A;  2VXL A;  1GA8 A;  1O7O A;  3Q7U A;  4FRL A;  2PGV A;  2RIX A;  4EEA A;  5CQM X;  2V0I A;  1H7G A;  5DDT A;  4FRO A;  1JV1 A;  4EE4 A;  5FU0 A;  3OH4 A;  1HM0 A;  2O1G A;  4Y6N A;  4MYB A;  5AJN A;  5L6S A;  4LW6 A;  1R7V A;  4G3S A;  3TZT A;  1QG8 A;  4EVW A;  3GUE A;  4Y63 A;  1MP4 A;  1VZX A;  1HJJ A;  2A8U A;  1YP4 A;  4ECM A;  2YC5 A;  2FYA A;  3RMW A;  4B42 A;  2FY7 A;  3IOI A;  4ZDQ A;  4KRV A;  3SX8 A;  4JD0 A;  3SX5 A;  3OAM A;  3V91 A;  1ZI3 A;  4CJB A;  1G8O A;  1G3L A;  1G9R A;  2J0A A;  3D8V A;  1VGZ A;  3V0O A;  2WAW A;  3SX3 A;  4EE3 A;  4KC2 A;  1MP3 A;  4YS8 A;  4B2W A;  3U2W A;  1R7T A;  1G93 A;  2E8B A;  4NAI A;  4Y9X A;  1V82 A;  1ZCV A;  3POL A;  1NF5 B;  1H4E A;  1ZJ2 A;  1LVW A;  1ZI1 A;  4AYJ A;  1S4P A;  1WT3 A;  5CMG X;  2ZU7 A;  5AJO A;  1FXO A;  4FRA A;  1GX4 A;  1VIC A;  1LZJ A;  1WT0 A;  4M2B A;  3ZLL A;  4BMA A;  4DEC A;  2Z87 A;  3K8E A;  3OGZ A;  3T7O A;  1VGW A;  3K8D A;  3BCV A;  3CKJ A;  4FIY A;  4Y7U A;  3SXG A;  5CMJ A;  2FYC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...