1O23B

Crystal structure of lactose synthase in the presence of udp-glucose
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
272
structure length
272
Chain Sequence
LTACPEESPLLVGPMLIEFNIPVDLKLVEQQNPKVKLGGRYTPMDCISPHKVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGESMFNRAKLLNVGFKEALKDYDYNCFVFSDVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLSINGFPNNYWGWGGEDDDIYNRLAFRGMSVSRPNAVIGKCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYMVLEVQRYPLYTKITVDIGTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase activator/transferase
molecule keywords ALPHA-LACTALBUMIN
publication title Alpha-Lactalbumin (La) Stimulates Milk Beta-1,4-Galactosyltransferase I (Beta 4Gal-T1) to Transfer Glucose from Udp-Glucose to N-Acetylglucosamine. Crystal Structure of Beta 4Gal-T1 X La Complex with Udp-Glc.
pubmed doi rcsb
source organism Mus musculus
total genus 96
structure length 272
sequence length 272
chains with identical sequence D
ec nomenclature ec 2.4.1.22: Lactose synthase.
pdb deposition date 2003-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02709 Glyco_transf_7C N-terminal domain of galactosyltransferase
B PF13733 Glyco_transf_7N N-terminal region of glycosyl transferase group 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1o23B00
4ECMA 2BO8A 1HM0A 1GX4A 1VM8A 3V91A 5C36A 4CVHA 4Y6UA 3V8YA 1VGUA 4HO4A 4UEGA 1VPAA 1ZJ0A 2YESA 2RJ9A 3Q80A 2RJ1A 5C1GA 1QGSA 3OH0A 1VICA 5C4DA 1H5RB 3V0NA 2FFUA 3ZGGA 2AECA 3E25A 2X60A 2WVKA 5EIYA 5JQQA 2RIXA 1H4DA 2P6WA 4BQHA 1FOAA 4AYJA 4ASJA 5FU8A 2O1HA 3LW6A 1ON8A 4EEGA 4XWIA 5CQMX 2Y4KA 4FRHA 3OGZA 2JCKA 4NALA 1MC3A 3OKRA 1NF5B 4D11C 3F1CA 4FREA 4FRMA 3I0EA 1H5SA 1O23B 3PNNA 2VS3A 2WEEA 2X5ZA 1H5SB 1OQMB 1G23A 2D7IA 1H7TA 3CGXA 1FO8A 3OH3A 1GQCA 2XMHA 4ZDQA 3SXCA 4CJBA 3ZGFA 4EE3A 1ZDFA 2E8BA 2E3DA 4Y9XA 3U2UA 3KIAA 3V0MA 4CJCA 1NQIB 4FQWA 1VZUA 3R2WA 2JCJA 4R7PA 1FWYA 1ZI5A 1NKHB 2WE9A 5FYEA 1HJJA 4NAKA 1MP3A 1INJA 1FXOA 2XWNA 3BRKX 1JYKA 1H7HA 3I0DA 5FV9A 4G87A 2Z86A 2QH5A 1LL0A 2O1GA 2QGIA 4B42A 2PX7A 1ZJ2A 5L6SA 3I0HA 1EYRA 4Y7UA 4LW3A 5FTSA 3CKQA 1V84A 1S4OA 1W77A 5AJPA 2XMEA 1NHEB 1FXJA 2DPWA 1H7EA 5C47A 1WT3A 5CQNX 3U2WA 3U0XA 1GQ9A 1VZXA 1LZ0A 2BO4A 3K8DA 1S4NA 4G3QA 4HO0A 4AC3A 1HM9A 4B4BA 1VH3A 1K4VA 3USQA 5C1HA 3SX3A 1V82A 4EEOA 4KNRA 4D0TA 4Y7TA 3D8VA 3V8ZA 4MYBA 1VGTA 3U2VA 2AM4A 1O7OA 3I0GA 1Z90A 4HO5A 2I5KA 2ZU9A 4FCUA 4M2AA 1G97A 3I0FA 2NXVA 5DDTA 2P72A 1YP2A 2I5EA 4KXOA 5IDSA 1VH1A 1R7XA 4KQLA 3FOQA 2AE7A 3GUEA 3CKOA 4HG6A 3U0YA 3ST8A 3DUVA 3HL3A 4NANA 5L6VA 1LZJA 1ZI1A 1INIA 4KPXA 2Y7AA 3SXDA 2V0HA 1YROB 5CQLX 3ZLLA 5CMIA 4FCEA 1ZCYA 1ZI4A 1S4PA 2P73A 3OH2A 2BO7A 5C38A 4P00A 4DE7A 1JV1A 1MP4A 3TZTA 1TVYA 1FR9A 2YQSA 1VGWA 4FRLA 2FYDB 1XHBA 2O1FA 4KNXA 4D0ZA 3CU0A 1LZIA 2VXLA 4HO6A 5AJOA 1JVGA 4JISA 4M4KA 4KRVA 1G3LA 1H5TA 3O3PA 2I7BA 2GGOA 1W55A 5HS2A 1ZJ3A 3K8EA 1R7VA 3SXAA 1H7GA 5CQPA 2XWLA 1R80A 4KC4A 3POLA 1JV3A 1ZCTA 4Y62A 5C4FA 1R7YA 1YP4A 2YQCA 1H5SC 1NWGB 1PZYB 5IFYA 1H7QA 4K6RA 1WSZA 5C49A 5CMFX 3I0LA 2ICXA 3IOHA 2YC5A 2RJ8A 1LZ7A 2FYAA 5C1LA 1G0RA 4B4MA 4G3SA 3V90A 2RIYA 4EEMA 1G8OA 1ZJ1A 1I52A 2Z87A 4KC1A 1GWWA 2V0LA 5C8RA 1HM8A 2W0WA 4LW6A 4FRAA 4BMAA 3I0CA 4EE5A 4M28A 1G93A 2FYCB 4HO8A 2VXMA 4J18A 1FRWA 5J49A 3D98A 1GX0A 5CMJA 2YC3A 3NGWA 4CJ8A 4HOCA 1ZJPA 1H7LA 1V83A 3D5NA 2FFVA 1OMXA 3FWWA 3I0IX 1NMMB 4DDZA 3SX7A 4NAIA 4FRPA 1WT0A 4B3UA 5C3BA 5C4CA 3JTJA 4B4GA 1MP5A 1SS9A 5CMGX 4AAWA 1H4CA 4ARWA 3SXGA 2OI7A 3RMWA 2ZU7A 4HO2A 1W57A 1TZFA 1EZIA 1ZIZA 2MZBA 2V0IA 3Q7UA 1FGGA 1FR8A 2PGVA 1LL3A 1QG8A 2ICYA 1OMZA 4FROA 1R7UA 4HO3A 3T7NA 3SXEA 1IINA 2RJ4A 2YQJA 2D7RA 2RJ0A 4DECA 4HCQA 4L41C 1XZ6A 3CKJA 4D48A 3TQDA 1ZCVA 1H5RA 2AGDA 2AM3A 3IOIA 5FTVA 1WT1A 4B5BA 3E26A 2W0VA 3OH1A 2OEGA 2V0JA 4Y7FA 1VGZA 4FRBA 3RSBA 4D11A 3Q4SA 3R3IA 4HO9A 4ASYA 2XWMA 2VS4A 2VSHA 4KPZA 2VSIA 1PZTA 3EE5A 4C2SA 1JVDA 1H4EA 5FUHA 1KWSA 4KC2A 3SXBA 3DJ4A 1VZTA 1LVWA 5FU0A 2PA4A 3T7MA 1H5TB 2VS5A 1ZDGA 4EE4A 2Y4JA 1R7TA 5AJNA 5DDVA 2JCOA 3OC9A 3I0JA 5C3AA 3BCVA 5C3DA 3PKPA 1ON6A 1H7FA 2ZU8A 4G3PA 4Y7GA 2RJ6A 3USRA 5EJ1A 1G1LA 3IOJA 4KT7A 2WVLA 1FGXA 1QWJA 4JD0A 3JUJA 2RIZA 2RJ5A 2VFZA 5CQOA 3V0PA 3SPTA 5EJZA 2QKXA 1TW1A 4EEAA 3N9WA 2D0JA 3ZLKA 4P02A 1G9RA 2AESA 3OH4A 1G95A 2YQHA 2WAWA 2WGZA 3V0QA 5IDTA 1HV9A 3PKQA 4IRPA 1R82A 2X65A 1GA8A 3SX5A 2AH9A 1H3MA 2YCMA 2Y4LA 1GWVA 2OEFA 1E5KA 1LL2A 2UX8A 4YS8A 1ZJOA 4MNDA 4Y7VA 3V0OA 2OI6A 4B2XA 5CMHA 1ZHJA 2RJ7A 1IIMA 3DK5A 1JYLA 1H5SD 3QVBA 1WVCA 2GGQA 4FRQA 4AYLA 2A8UA 3CKNA 2OI5A 4Y6NA 3U2XA 1FO9A 3CKVA 2APCA 2X5SA 3OAMA 4GBPA 3SX8A 2BO6A 2CU2A 4EVWA 1FZWA 2WVMA 5C4EA 1HJLA 2JCLA 2FY7A 5C48A 4B2WA 3RMVA 5C4BA 1QGQA 1R81A 3V0LA 3U2TA 3JUKA 4FRDA 5BXCA 2Y4MA 3ZF8A 2AM5A 2Q4JA 2VD4A 1FG5N 1G2VA 1ZI3A 4Y63A 1ZCUA 1WT2A 2PGYA 1O0RA 4IRQA 1TW5A 3I0KA 4E1KA 3T7OA 4M2BA 2RITA 5I1FA 1YP3A 2A8WA 1O7QA 2V0KA 3F1YA 2Y6PA 4Y64A 2FYBA
chains in the Genus database with same CATH superfamily
4ECMA 2BO8A 1HM0A 1GX4A 1VM8A 3V91A 5C36A 4CVHA 4Y6UA 3V8YA 1VGUA 4HO4A 4UEGA 1VPAA 1ZJ0A 2YESA 2RJ9A 3Q80A 2RJ1A 5C1GA 1QGSA 3OH0A 1VICA 5C4DA 1H5RB 3V0NA 2FFUA 3ZGGA 2AECA 3E25A 2X60A 2WVKA 5EIYA 5JQQA 2RIXA 1H4DA 2P6WA 4BQHA 1FOAA 4AYJA 4ASJA 5FU8A 2O1HA 3LW6A 5D92A 1ON8A 4EEGA 4XWIA 5CQMX 2Y4KA 4FRHA 3OGZA 2JCKA 4NALA 1MC3A 3OKRA 1NF5B 4Q7CA 4D11C 3F1CA 4FREA 4FRMA 2C0NA 3I0EA 1H5SA 1O23B 3PNNA 2VS3A 2WEEA 2X5ZA 1H5SB 1OQMB 1G23A 2D7IA 5D91A 1H7TA 3CGXA 1FO8A 3OH3A 1GQCA 2XMHA 4ZDQA 3SXCA 4CJBA 3ZGFA 4EE3A 1ZDFA 2E8BA 2E3DA 4Y9XA 3U2UA 3KIAA 3V0MA 4CJCA 1NQIB 4FQWA 1VZUA 3R2WA 2JCJA 4R7PA 1FWYA 1ZI5A 1NKHB 2WE9A 5FYEA 1HJJA 4NAKA 1MP3A 1INJA 1FXOA 2XWNA 3BRKX 4O6MA 1JYKA 1H7HA 2VK9A 3I0DA 5FV9A 4G87A 2Z86A 2QH5A 1LL0A 2O1GA 2QGIA 4B42A 2PX7A 1ZJ2A 5L6SA 3I0HA 1EYRA 4Y7UA 4FIXA 4LW3A 5FTSA 3CKQA 1V84A 1S4OA 1W77A 5AJPA 2XMEA 1NHEB 1FXJA 2DPWA 1H7EA 5C47A 1WT3A 5CQNX 3U2WA 3U0XA 1GQ9A 1VZXA 1LZ0A 2BO4A 3K8DA 1S4NA 4G3QA 4HO0A 4AC3A 1HM9A 4B4BA 1VH3A 1K4VA 3USQA 5C1HA 3SX3A 1V82A 4EEOA 4KNRA 4D0TA 4Y7TA 3D8VA 3V8ZA 4MYBA 2J0BA 1VGTA 3U2VA 2AM4A 1O7OA 3I0GA 1Z90A 4HO5A 2I5KA 2ZU9A 4FCUA 4M2AA 1G97A 3I0FA 2NXVA 5DDTA 2P72A 1YP2A 2I5EA 4KXOA 5IDSA 1VH1A 1R7XA 4KQLA 3FOQA 2AE7A 3GUEA 3CKOA 4MIXA 4HG6A 3U0YA 3ST8A 3DUVA 3HL3A 4NANA 5L6VA 1LZJA 1ZI1A 1INIA 4KPXA 2Y7AA 3SXDA 2V0HA 1YROB 5CQLX 3ZLLA 5CMIA 4FCEA 1ZCYA 1ZI4A 1S4PA 2P73A 3OH2A 2BO7A 5C38A 4P00A 4DE7A 1JV1A 1MP4A 3TZTA 1TVYA 1FR9A 2YQSA 1VGWA 4FRLA 2FYDB 1XHBA 2O1FA 4KNXA 4D0ZA 3CU0A 1LZIA 2VXLA 4HO6A 5AJOA 1JVGA 4JISA 4M4KA 4KRVA 1G3LA 1H5TA 3O3PA 2I7BA 2GGOA 1W55A 5HS2A 1ZJ3A 3K8EA 1R7VA 3SXAA 1H7GA 5CQPA 2XWLA 1R80A 4KC4A 3POLA 1JV3A 1ZCTA 4Y62A 5C4FA 1R7YA 1YP4A 2YQCA 1H5SC 1NWGB 1PZYB 5IFYA 1H7QA 4K6RA 1WSZA 5C49A 5CMFX 3I0LA 2ICXA 3IOHA 2YC5A 2RJ8A 1LZ7A 2FYAA 5C1LA 1G0RA 4B4MA 4G3SA 3V90A 2RIYA 4EEMA 1G8OA 1ZJ1A 1I52A 2Z87A 4KC1A 1GWWA 2V0LA 5C8RA 1HM8A 2W0WA 4LW6A 4FRAA 4BMAA 3I0CA 4EE5A 4M28A 1G93A 2FYCB 4HO8A 2VXMA 4J18A 1FRWA 5J49A 3D98A 1GX0A 5CMJA 2YC3A 3NGWA 4CJ8A 4HOCA 1ZJPA 4O6NA 1H7LA 1V83A 3D5NA 2FFVA 1OMXA 3FWWA 3I0IX 1NMMB 4DDZA 3SX7A 4NAIA 4FRPA 1WT0A 4B3UA 5C3BA 5C4CA 3JTJA 4B4GA 1MP5A 1SS9A 5CMGX 4AAWA 1H4CA 4ARWA 3SXGA 2OI7A 3RMWA 2ZU7A 4HO2A 1W57A 1TZFA 1EZIA 1ZIZA 2MZBA 2V0IA 3Q7UA 1FGGA 1FR8A 2PGVA 1LL3A 1QG8A 2ICYA 1OMZA 4FROA 1R7UA 4HO3A 3T7NA 3SXEA 1IINA 2RJ4A 2YQJA 2D7RA 2RJ0A 4DECA 4HCQA 4L41C 1XZ6A 3CKJA 4D48A 3TQDA 1ZCVA 1H5RA 2AGDA 2AM3A 3IOIA 5FTVA 1WT1A 4B5BA 3E26A 2W0VA 3OH1A 2OEGA 2V0JA 4Y7FA 1VGZA 4FRBA 3RSBA 4D11A 3Q4SA 3R3IA 4HO9A 4ASYA 2XWMA 2VS4A 2VSHA 4KPZA 2VSIA 1PZTA 3EE5A 4C2SA 1JVDA 1H4EA 5FUHA 1KWSA 4KC2A 3SXBA 3DJ4A 1VZTA 1LVWA 5FU0A 2PA4A 3T7MA 1H5TB 2VS5A 1ZDGA 4EE4A 2Y4JA 1R7TA 5AJNA 5DDVA 2JCOA 3OC9A 3I0JA 5C3AA 3BCVA 5C3DA 3PKPA 1ON6A 1H7FA 2ZU8A 4G3PA 4Y7GA 2RJ6A 3USRA 5EJ1A 1G1LA 3IOJA 4KT7A 2WVLA 1FGXA 1QWJA 4JD0A 3JUJA 2RIZA 2RJ5A 2VFZA 5CQOA 3V0PA 3SPTA 5EJZA 2QKXA 1TW1A 4EEAA 3N9WA 2D0JA 3ZLKA 4P02A 1G9RA 2AESA 3OH4A 1G95A 2YQHA 2WAWA 2WGZA 3V0QA 5IDTA 1HV9A 3PKQA 4FIYA 4IRPA 1R82A 2X65A 1GA8A 3SX5A 2AH9A 1H3MA 2YCMA 2Y4LA 1GWVA 2OEFA 1E5KA 1LL2A 2UX8A 4YS8A 1ZJOA 4MNDA 4Y7VA 3V0OA 2J0AA 2OI6A 4B2XA 5CMHA 1ZHJA 2RJ7A 1IIMA 3DK5A 1JYLA 1H5SD 3QVBA 1WVCA 2GGQA 4FRQA 4AYLA 2A8UA 3CKNA 2OI5A 4Y6NA 3U2XA 1FO9A 3CKVA 2APCA 2X5SA 3OAMA 4GBPA 3SX8A 2BO6A 2CU2A 4EVWA 1FZWA 2WVMA 5C4EA 1HJLA 2JCLA 2FY7A 5C48A 4B2WA 3RMVA 5C4BA 1QGQA 1R81A 3V0LA 3U2TA 3JUKA 4FRDA 5BXCA 2Y4MA 3ZF8A 2AM5A 2Q4JA 2VD4A 1FG5N 1G2VA 1ZI3A 4Y63A 1ZCUA 1WT2A 2PGYA 1O0RA 4IRQA 1TW5A 3I0KA 4E1KA 3T7OA 4M2BA 2RITA 5I1FA 1YP3A 2A8WA 1O7QA 2V0KA 3F1YA 2Y6PA 4Y64A 2FYBA
chains in the Genus database with same CATH topology
4ECMA 2BO8A 1HM0A 1GX4A 1VM8A 3V91A 5C36A 4CVHA 4Y6UA 3V8YA 1VGUA 4HO4A 4UEGA 1VPAA 1ZJ0A 2YESA 2RJ9A 3Q80A 2RJ1A 5C1GA 1QGSA 3OH0A 1VICA 5C4DA 1H5RB 3V0NA 2FFUA 3ZGGA 2AECA 3E25A 2X60A 2WVKA 5EIYA 5JQQA 2RIXA 1H4DA 2P6WA 4BQHA 1FOAA 4AYJA 4ASJA 5FU8A 2O1HA 3LW6A 5D92A 1ON8A 4EEGA 4XWIA 5CQMX 2Y4KA 4FRHA 3OGZA 2JCKA 4NALA 1MC3A 3OKRA 1NF5B 4Q7CA 4D11C 3F1CA 4FREA 4FRMA 2C0NA 3I0EA 1H5SA 1O23B 3PNNA 2VS3A 2WEEA 2X5ZA 1H5SB 1OQMB 1G23A 2D7IA 5D91A 1H7TA 3CGXA 1FO8A 3OH3A 1GQCA 2XMHA 4ZDQA 3SXCA 4CJBA 3ZGFA 4EE3A 1ZDFA 2E8BA 2E3DA 4Y9XA 3U2UA 3KIAA 3V0MA 4CJCA 1NQIB 4FQWA 1VZUA 3R2WA 2JCJA 4R7PA 1FWYA 1ZI5A 1NKHB 2WE9A 5FYEA 1HJJA 4NAKA 1MP3A 1INJA 1FXOA 2XWNA 3BRKX 4O6MA 1JYKA 1H7HA 2VK9A 3I0DA 5FV9A 4G87A 2Z86A 2QH5A 1LL0A 2O1GA 2QGIA 4B42A 2PX7A 1ZJ2A 5L6SA 3I0HA 1EYRA 4Y7UA 4FIXA 4LW3A 5FTSA 3CKQA 1V84A 1S4OA 1W77A 5AJPA 2XMEA 1NHEB 1FXJA 2DPWA 1H7EA 5C47A 1WT3A 5CQNX 3U2WA 3U0XA 1GQ9A 1VZXA 1LZ0A 2BO4A 3K8DA 1S4NA 4G3QA 4HO0A 4AC3A 1HM9A 4B4BA 1VH3A 1K4VA 3USQA 5C1HA 3SX3A 1V82A 4EEOA 4KNRA 4D0TA 4Y7TA 3D8VA 3V8ZA 4MYBA 2J0BA 1VGTA 3U2VA 2AM4A 1O7OA 3I0GA 1Z90A 4HO5A 2I5KA 2ZU9A 4FCUA 4M2AA 1G97A 3I0FA 2NXVA 5DDTA 2P72A 1YP2A 2I5EA 4KXOA 5IDSA 1VH1A 1R7XA 4KQLA 3FOQA 2AE7A 3GUEA 3CKOA 4MIXA 4HG6A 3U0YA 3ST8A 3DUVA 3HL3A 4NANA 5L6VA 1LZJA 1ZI1A 1INIA 4KPXA 2Y7AA 3SXDA 2V0HA 1YROB 5CQLX 3ZLLA 5CMIA 4FCEA 1ZCYA 1ZI4A 1S4PA 2P73A 3OH2A 2BO7A 5C38A 4P00A 4DE7A 1JV1A 1MP4A 3TZTA 1TVYA 1FR9A 2YQSA 1VGWA 4FRLA 2FYDB 1XHBA 2O1FA 4KNXA 4D0ZA 3CU0A 1LZIA 2VXLA 4HO6A 5AJOA 1JVGA 4JISA 4M4KA 4KRVA 1G3LA 1H5TA 3O3PA 2I7BA 2GGOA 1W55A 5HS2A 1ZJ3A 3K8EA 1R7VA 3SXAA 1H7GA 5CQPA 2XWLA 1R80A 4KC4A 3POLA 1JV3A 1ZCTA 4Y62A 5C4FA 1R7YA 1YP4A 2YQCA 1H5SC 1NWGB 1PZYB 5IFYA 1H7QA 4K6RA 1WSZA 5C49A 5CMFX 3I0LA 2ICXA 3IOHA 2YC5A 2RJ8A 1LZ7A 2FYAA 5C1LA 1G0RA 4B4MA 4G3SA 3V90A 2RIYA 4EEMA 1G8OA 1ZJ1A 1I52A 2Z87A 4KC1A 1GWWA 2V0LA 5C8RA 1HM8A 2W0WA 4LW6A 4FRAA 4BMAA 3I0CA 4EE5A 4M28A 1G93A 2FYCB 4HO8A 2VXMA 4J18A 1FRWA 5J49A 3D98A 1GX0A 5CMJA 2YC3A 3NGWA 4CJ8A 4HOCA 1ZJPA 4O6NA 1H7LA 1V83A 3D5NA 2FFVA 1OMXA 3FWWA 3I0IX 1NMMB 4DDZA 3SX7A 4NAIA 4FRPA 1WT0A 4B3UA 5C3BA 5C4CA 3JTJA 4B4GA 1MP5A 1SS9A 5CMGX 4AAWA 1H4CA 4ARWA 3SXGA 2OI7A 3RMWA 2ZU7A 4HO2A 1W57A 1TZFA 1EZIA 1ZIZA 2MZBA 2V0IA 3Q7UA 1FGGA 1FR8A 2PGVA 1LL3A 1QG8A 2ICYA 1OMZA 4FROA 1R7UA 4HO3A 3T7NA 3SXEA 1IINA 2RJ4A 2YQJA 2D7RA 2RJ0A 4DECA 4HCQA 4L41C 1XZ6A 3CKJA 4D48A 3TQDA 1ZCVA 1H5RA 2AGDA 2AM3A 3IOIA 5FTVA 1WT1A 4B5BA 3E26A 2W0VA 3OH1A 2OEGA 2V0JA 4Y7FA 1VGZA 4FRBA 3RSBA 4D11A 3Q4SA 3R3IA 4HO9A 4ASYA 2XWMA 2VS4A 2VSHA 4KPZA 2VSIA 1PZTA 3EE5A 4C2SA 1JVDA 1H4EA 5FUHA 1KWSA 4KC2A 3SXBA 3DJ4A 1VZTA 1LVWA 5FU0A 2PA4A 3T7MA 1H5TB 2VS5A 1ZDGA 4EE4A 2Y4JA 1R7TA 5AJNA 5DDVA 2JCOA 3OC9A 3I0JA 5C3AA 3BCVA 5C3DA 3PKPA 1ON6A 1H7FA 2ZU8A 4G3PA 4Y7GA 2RJ6A 3USRA 5EJ1A 1G1LA 3IOJA 4KT7A 2WVLA 1FGXA 1QWJA 4JD0A 3JUJA 2RIZA 2RJ5A 2VFZA 5CQOA 3V0PA 3SPTA 5EJZA 2QKXA 1TW1A 4EEAA 3N9WA 2D0JA 3ZLKA 4P02A 1G9RA 2AESA 3OH4A 1G95A 2YQHA 2WAWA 2WGZA 3V0QA 5IDTA 1HV9A 3PKQA 4FIYA 4IRPA 1R82A 2X65A 1GA8A 3SX5A 2AH9A 1H3MA 2YCMA 2Y4LA 1GWVA 2OEFA 1E5KA 1LL2A 2UX8A 4YS8A 1ZJOA 4MNDA 4Y7VA 3V0OA 2J0AA 2OI6A 4B2XA 5CMHA 1ZHJA 2RJ7A 1IIMA 3DK5A 1JYLA 1H5SD 3QVBA 1WVCA 2GGQA 4FRQA 4AYLA 2A8UA 3CKNA 2OI5A 4Y6NA 3U2XA 1FO9A 3CKVA 2APCA 2X5SA 3OAMA 4GBPA 3SX8A 2BO6A 2CU2A 4EVWA 1FZWA 2WVMA 5C4EA 1HJLA 2JCLA 2FY7A 5C48A 4B2WA 3RMVA 5C4BA 1QGQA 1R81A 3V0LA 3U2TA 3JUKA 4FRDA 5BXCA 2Y4MA 3ZF8A 2AM5A 2Q4JA 2VD4A 1FG5N 1G2VA 1ZI3A 4Y63A 1ZCUA 1WT2A 2PGYA 1O0RA 4IRQA 1TW5A 3I0KA 4E1KA 3T7OA 4M2BA 2RITA 5I1FA 1YP3A 2A8WA 1O7QA 2V0KA 3F1YA 2Y6PA 4Y64A 2FYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ECM A;  2BO8 A;  1HM0 A;  1GX4 A;  1VM8 A;  3V91 A;  5C36 A;  4CVH A;  4Y6U A;  3V8Y A;  1VGU A;  4HO4 A;  4UEG A;  1VPA A;  1ZJ0 A;  2YES A;  2RJ9 A;  3Q80 A;  2RJ1 A;  5C1G A;  1QGS A;  3OH0 A;  1VIC A;  5C4D A;  1H5R B;  3V0N A;  2FFU A;  3ZGG A;  2AEC A;  3E25 A;  2X60 A;  2WVK A;  5EIY A;  5JQQ A;  2RIX A;  1H4D A;  2P6W A;  4BQH A;  1FOA A;  4AYJ A;  4ASJ A;  5FU8 A;  2O1H A;  3LW6 A;  1ON8 A;  4EEG A;  4XWI A;  5CQM X;  2Y4K A;  4FRH A;  3OGZ A;  2JCK A;  4NAL A;  1MC3 A;  3OKR A;  1NF5 B;  4D11 C;  3F1C A;  4FRE A;  4FRM A;  3I0E A;  1H5S A;  1O23 B;  3PNN A;  2VS3 A;  2WEE A;  2X5Z A;  1H5S B;  1OQM B;  1G23 A;  2D7I A;  1H7T A;  3CGX A;  1FO8 A;  3OH3 A;  1GQC A;  2XMH A;  4ZDQ A;  3SXC A;  4CJB A;  3ZGF A;  4EE3 A;  1ZDF A;  2E8B A;  2E3D A;  4Y9X A;  3U2U A;  3KIA A;  3V0M A;  4CJC A;  1NQI B;  4FQW A;  1VZU A;  3R2W A;  2JCJ A;  4R7P A;  1FWY A;  1ZI5 A;  1NKH B;  2WE9 A;  5FYE A;  1HJJ A;  4NAK A;  1MP3 A;  1INJ A;  1FXO A;  2XWN A;  3BRK X;  1JYK A;  1H7H A;  3I0D A;  5FV9 A;  4G87 A;  2Z86 A;  2QH5 A;  1LL0 A;  2O1G A;  2QGI A;  4B42 A;  2PX7 A;  1ZJ2 A;  5L6S A;  3I0H A;  1EYR A;  4Y7U A;  4LW3 A;  5FTS A;  3CKQ A;  1V84 A;  1S4O A;  1W77 A;  5AJP A;  2XME A;  1NHE B;  1FXJ A;  2DPW A;  1H7E A;  5C47 A;  1WT3 A;  5CQN X;  3U2W A;  3U0X A;  1GQ9 A;  1VZX A;  1LZ0 A;  2BO4 A;  3K8D A;  1S4N A;  4G3Q A;  4HO0 A;  4AC3 A;  1HM9 A;  4B4B A;  1VH3 A;  1K4V A;  3USQ A;  5C1H A;  3SX3 A;  1V82 A;  4EEO A;  4KNR A;  4D0T A;  4Y7T A;  3D8V A;  3V8Z A;  4MYB A;  1VGT A;  3U2V A;  2AM4 A;  1O7O A;  3I0G A;  1Z90 A;  4HO5 A;  2I5K A;  2ZU9 A;  4FCU A;  4M2A A;  1G97 A;  3I0F A;  2NXV A;  5DDT A;  2P72 A;  1YP2 A;  2I5E A;  4KXO A;  5IDS A;  1VH1 A;  1R7X A;  4KQL A;  3FOQ A;  2AE7 A;  3GUE A;  3CKO A;  4HG6 A;  3U0Y A;  3ST8 A;  3DUV A;  3HL3 A;  4NAN A;  5L6V A;  1LZJ A;  1ZI1 A;  1INI A;  4KPX A;  2Y7A A;  3SXD A;  2V0H A;  1YRO B;  5CQL X;  3ZLL A;  5CMI A;  4FCE A;  1ZCY A;  1ZI4 A;  1S4P A;  2P73 A;  3OH2 A;  2BO7 A;  5C38 A;  4P00 A;  4DE7 A;  1JV1 A;  1MP4 A;  3TZT A;  1TVY A;  1FR9 A;  2YQS A;  1VGW A;  4FRL A;  2FYD B;  1XHB A;  2O1F A;  4KNX A;  4D0Z A;  3CU0 A;  1LZI A;  2VXL A;  4HO6 A;  5AJO A;  1JVG A;  4JIS A;  4M4K A;  4KRV A;  1G3L A;  1H5T A;  3O3P A;  2I7B A;  2GGO A;  1W55 A;  5HS2 A;  1ZJ3 A;  3K8E A;  1R7V A;  3SXA A;  1H7G A;  5CQP A;  2XWL A;  1R80 A;  4KC4 A;  3POL A;  1JV3 A;  1ZCT A;  4Y62 A;  5C4F A;  1R7Y A;  1YP4 A;  2YQC A;  1H5S C;  1NWG B;  1PZY B;  5IFY A;  1H7Q A;  4K6R A;  1WSZ A;  5C49 A;  5CMF X;  3I0L A;  2ICX A;  3IOH A;  2YC5 A;  2RJ8 A;  1LZ7 A;  2FYA A;  5C1L A;  1G0R A;  4B4M A;  4G3S A;  3V90 A;  2RIY A;  4EEM A;  1G8O A;  1ZJ1 A;  1I52 A;  2Z87 A;  4KC1 A;  1GWW A;  2V0L A;  5C8R A;  1HM8 A;  2W0W A;  4LW6 A;  4FRA A;  4BMA A;  3I0C A;  4EE5 A;  4M28 A;  1G93 A;  2FYC B;  4HO8 A;  2VXM A;  4J18 A;  1FRW A;  5J49 A;  3D98 A;  1GX0 A;  5CMJ A;  2YC3 A;  3NGW A;  4CJ8 A;  4HOC A;  1ZJP A;  1H7L A;  1V83 A;  3D5N A;  2FFV A;  1OMX A;  3FWW A;  3I0I X;  1NMM B;  4DDZ A;  3SX7 A;  4NAI A;  4FRP A;  1WT0 A;  4B3U A;  5C3B A;  5C4C A;  3JTJ A;  4B4G A;  1MP5 A;  1SS9 A;  5CMG X;  4AAW A;  1H4C A;  4ARW A;  3SXG A;  2OI7 A;  3RMW A;  2ZU7 A;  4HO2 A;  1W57 A;  1TZF A;  1EZI A;  1ZIZ A;  2MZB A;  2V0I A;  3Q7U A;  1FGG A;  1FR8 A;  2PGV A;  1LL3 A;  1QG8 A;  2ICY A;  1OMZ A;  4FRO A;  1R7U A;  4HO3 A;  3T7N A;  3SXE A;  1IIN A;  2RJ4 A;  2YQJ A;  2D7R A;  2RJ0 A;  4DEC A;  4HCQ A;  4L41 C;  1XZ6 A;  3CKJ A;  4D48 A;  3TQD A;  1ZCV A;  1H5R A;  2AGD A;  2AM3 A;  3IOI A;  5FTV A;  1WT1 A;  4B5B A;  3E26 A;  2W0V A;  3OH1 A;  2OEG A;  2V0J A;  4Y7F A;  1VGZ A;  4FRB A;  3RSB A;  4D11 A;  3Q4S A;  3R3I A;  4HO9 A;  4ASY A;  2XWM A;  2VS4 A;  2VSH A;  4KPZ A;  2VSI A;  1PZT A;  3EE5 A;  4C2S A;  1JVD A;  1H4E A;  5FUH A;  1KWS A;  4KC2 A;  3SXB A;  3DJ4 A;  1VZT A;  1LVW A;  5FU0 A;  2PA4 A;  3T7M A;  1H5T B;  2VS5 A;  1ZDG A;  4EE4 A;  2Y4J A;  1R7T A;  5AJN A;  5DDV A;  2JCO A;  3OC9 A;  3I0J A;  5C3A A;  3BCV A;  5C3D A;  3PKP A;  1ON6 A;  1H7F A;  2ZU8 A;  4G3P A;  4Y7G A;  2RJ6 A;  3USR A;  5EJ1 A;  1G1L A;  3IOJ A;  4KT7 A;  2WVL A;  1FGX A;  1QWJ A;  4JD0 A;  3JUJ A;  2RIZ A;  2RJ5 A;  2VFZ A;  5CQO A;  3V0P A;  3SPT A;  5EJZ A;  2QKX A;  1TW1 A;  4EEA A;  3N9W A;  2D0J A;  3ZLK A;  4P02 A;  1G9R A;  2AES A;  3OH4 A;  1G95 A;  2YQH A;  2WAW A;  2WGZ A;  3V0Q A;  5IDT A;  1HV9 A;  3PKQ A;  4IRP A;  1R82 A;  2X65 A;  1GA8 A;  3SX5 A;  2AH9 A;  1H3M A;  2YCM A;  2Y4L A;  1GWV A;  2OEF A;  1E5K A;  1LL2 A;  2UX8 A;  4YS8 A;  1ZJO A;  4MND A;  4Y7V A;  3V0O A;  2OI6 A;  4B2X A;  5CMH A;  1ZHJ A;  2RJ7 A;  1IIM A;  3DK5 A;  1JYL A;  1H5S D;  3QVB A;  1WVC A;  2GGQ A;  4FRQ A;  4AYL A;  2A8U A;  3CKN A;  2OI5 A;  4Y6N A;  3U2X A;  1FO9 A;  3CKV A;  2APC A;  2X5S A;  3OAM A;  4GBP A;  3SX8 A;  2BO6 A;  2CU2 A;  4EVW A;  1FZW A;  2WVM A;  5C4E A;  1HJL A;  2JCL A;  2FY7 A;  5C48 A;  4B2W A;  3RMV A;  5C4B A;  1QGQ A;  1R81 A;  3V0L A;  3U2T A;  3JUK A;  4FRD A;  5BXC A;  2Y4M A;  3ZF8 A;  2AM5 A;  2Q4J A;  2VD4 A;  1FG5 N;  1G2V A;  1ZI3 A;  4Y63 A;  1ZCU A;  1WT2 A;  2PGY A;  1O0R A;  4IRQ A;  1TW5 A;  3I0K A;  4E1K A;  3T7O A;  4M2B A;  2RIT A;  5I1F A;  1YP3 A;  2A8W A;  1O7Q A;  2V0K A;  3F1Y A;  2Y6P A;  4Y64 A;  2FYB A; 
#chains in the Genus database with same CATH topology
 4ECM A;  2BO8 A;  1HM0 A;  1GX4 A;  1VM8 A;  3V91 A;  5C36 A;  4CVH A;  4Y6U A;  3V8Y A;  1VGU A;  4HO4 A;  4UEG A;  1VPA A;  1ZJ0 A;  2YES A;  2RJ9 A;  3Q80 A;  2RJ1 A;  5C1G A;  1QGS A;  3OH0 A;  1VIC A;  5C4D A;  1H5R B;  3V0N A;  2FFU A;  3ZGG A;  2AEC A;  3E25 A;  2X60 A;  2WVK A;  5EIY A;  5JQQ A;  2RIX A;  1H4D A;  2P6W A;  4BQH A;  1FOA A;  4AYJ A;  4ASJ A;  5FU8 A;  2O1H A;  3LW6 A;  5D92 A;  1ON8 A;  4EEG A;  4XWI A;  5CQM X;  2Y4K A;  4FRH A;  3OGZ A;  2JCK A;  4NAL A;  1MC3 A;  3OKR A;  1NF5 B;  4Q7C A;  4D11 C;  3F1C A;  4FRE A;  4FRM A;  2C0N A;  3I0E A;  1H5S A;  1O23 B;  3PNN A;  2VS3 A;  2WEE A;  2X5Z A;  1H5S B;  1OQM B;  1G23 A;  2D7I A;  5D91 A;  1H7T A;  3CGX A;  1FO8 A;  3OH3 A;  1GQC A;  2XMH A;  4ZDQ A;  3SXC A;  4CJB A;  3ZGF A;  4EE3 A;  1ZDF A;  2E8B A;  2E3D A;  4Y9X A;  3U2U A;  3KIA A;  3V0M A;  4CJC A;  1NQI B;  4FQW A;  1VZU A;  3R2W A;  2JCJ A;  4R7P A;  1FWY A;  1ZI5 A;  1NKH B;  2WE9 A;  5FYE A;  1HJJ A;  4NAK A;  1MP3 A;  1INJ A;  1FXO A;  2XWN A;  3BRK X;  4O6M A;  1JYK A;  1H7H A;  2VK9 A;  3I0D A;  5FV9 A;  4G87 A;  2Z86 A;  2QH5 A;  1LL0 A;  2O1G A;  2QGI A;  4B42 A;  2PX7 A;  1ZJ2 A;  5L6S A;  3I0H A;  1EYR A;  4Y7U A;  4FIX A;  4LW3 A;  5FTS A;  3CKQ A;  1V84 A;  1S4O A;  1W77 A;  5AJP A;  2XME A;  1NHE B;  1FXJ A;  2DPW A;  1H7E A;  5C47 A;  1WT3 A;  5CQN X;  3U2W A;  3U0X A;  1GQ9 A;  1VZX A;  1LZ0 A;  2BO4 A;  3K8D A;  1S4N A;  4G3Q A;  4HO0 A;  4AC3 A;  1HM9 A;  4B4B A;  1VH3 A;  1K4V A;  3USQ A;  5C1H A;  3SX3 A;  1V82 A;  4EEO A;  4KNR A;  4D0T A;  4Y7T A;  3D8V A;  3V8Z A;  4MYB A;  2J0B A;  1VGT A;  3U2V A;  2AM4 A;  1O7O A;  3I0G A;  1Z90 A;  4HO5 A;  2I5K A;  2ZU9 A;  4FCU A;  4M2A A;  1G97 A;  3I0F A;  2NXV A;  5DDT A;  2P72 A;  1YP2 A;  2I5E A;  4KXO A;  5IDS A;  1VH1 A;  1R7X A;  4KQL A;  3FOQ A;  2AE7 A;  3GUE A;  3CKO A;  4MIX A;  4HG6 A;  3U0Y A;  3ST8 A;  3DUV A;  3HL3 A;  4NAN A;  5L6V A;  1LZJ A;  1ZI1 A;  1INI A;  4KPX A;  2Y7A A;  3SXD A;  2V0H A;  1YRO B;  5CQL X;  3ZLL A;  5CMI A;  4FCE A;  1ZCY A;  1ZI4 A;  1S4P A;  2P73 A;  3OH2 A;  2BO7 A;  5C38 A;  4P00 A;  4DE7 A;  1JV1 A;  1MP4 A;  3TZT A;  1TVY A;  1FR9 A;  2YQS A;  1VGW A;  4FRL A;  2FYD B;  1XHB A;  2O1F A;  4KNX A;  4D0Z A;  3CU0 A;  1LZI A;  2VXL A;  4HO6 A;  5AJO A;  1JVG A;  4JIS A;  4M4K A;  4KRV A;  1G3L A;  1H5T A;  3O3P A;  2I7B A;  2GGO A;  1W55 A;  5HS2 A;  1ZJ3 A;  3K8E A;  1R7V A;  3SXA A;  1H7G A;  5CQP A;  2XWL A;  1R80 A;  4KC4 A;  3POL A;  1JV3 A;  1ZCT A;  4Y62 A;  5C4F A;  1R7Y A;  1YP4 A;  2YQC A;  1H5S C;  1NWG B;  1PZY B;  5IFY A;  1H7Q A;  4K6R A;  1WSZ A;  5C49 A;  5CMF X;  3I0L A;  2ICX A;  3IOH A;  2YC5 A;  2RJ8 A;  1LZ7 A;  2FYA A;  5C1L A;  1G0R A;  4B4M A;  4G3S A;  3V90 A;  2RIY A;  4EEM A;  1G8O A;  1ZJ1 A;  1I52 A;  2Z87 A;  4KC1 A;  1GWW A;  2V0L A;  5C8R A;  1HM8 A;  2W0W A;  4LW6 A;  4FRA A;  4BMA A;  3I0C A;  4EE5 A;  4M28 A;  1G93 A;  2FYC B;  4HO8 A;  2VXM A;  4J18 A;  1FRW A;  5J49 A;  3D98 A;  1GX0 A;  5CMJ A;  2YC3 A;  3NGW A;  4CJ8 A;  4HOC A;  1ZJP A;  4O6N A;  1H7L A;  1V83 A;  3D5N A;  2FFV A;  1OMX A;  3FWW A;  3I0I X;  1NMM B;  4DDZ A;  3SX7 A;  4NAI A;  4FRP A;  1WT0 A;  4B3U A;  5C3B A;  5C4C A;  3JTJ A;  4B4G A;  1MP5 A;  1SS9 A;  5CMG X;  4AAW A;  1H4C A;  4ARW A;  3SXG A;  2OI7 A;  3RMW A;  2ZU7 A;  4HO2 A;  1W57 A;  1TZF A;  1EZI A;  1ZIZ A;  2MZB A;  2V0I A;  3Q7U A;  1FGG A;  1FR8 A;  2PGV A;  1LL3 A;  1QG8 A;  2ICY A;  1OMZ A;  4FRO A;  1R7U A;  4HO3 A;  3T7N A;  3SXE A;  1IIN A;  2RJ4 A;  2YQJ A;  2D7R A;  2RJ0 A;  4DEC A;  4HCQ A;  4L41 C;  1XZ6 A;  3CKJ A;  4D48 A;  3TQD A;  1ZCV A;  1H5R A;  2AGD A;  2AM3 A;  3IOI A;  5FTV A;  1WT1 A;  4B5B A;  3E26 A;  2W0V A;  3OH1 A;  2OEG A;  2V0J A;  4Y7F A;  1VGZ A;  4FRB A;  3RSB A;  4D11 A;  3Q4S A;  3R3I A;  4HO9 A;  4ASY A;  2XWM A;  2VS4 A;  2VSH A;  4KPZ A;  2VSI A;  1PZT A;  3EE5 A;  4C2S A;  1JVD A;  1H4E A;  5FUH A;  1KWS A;  4KC2 A;  3SXB A;  3DJ4 A;  1VZT A;  1LVW A;  5FU0 A;  2PA4 A;  3T7M A;  1H5T B;  2VS5 A;  1ZDG A;  4EE4 A;  2Y4J A;  1R7T A;  5AJN A;  5DDV A;  2JCO A;  3OC9 A;  3I0J A;  5C3A A;  3BCV A;  5C3D A;  3PKP A;  1ON6 A;  1H7F A;  2ZU8 A;  4G3P A;  4Y7G A;  2RJ6 A;  3USR A;  5EJ1 A;  1G1L A;  3IOJ A;  4KT7 A;  2WVL A;  1FGX A;  1QWJ A;  4JD0 A;  3JUJ A;  2RIZ A;  2RJ5 A;  2VFZ A;  5CQO A;  3V0P A;  3SPT A;  5EJZ A;  2QKX A;  1TW1 A;  4EEA A;  3N9W A;  2D0J A;  3ZLK A;  4P02 A;  1G9R A;  2AES A;  3OH4 A;  1G95 A;  2YQH A;  2WAW A;  2WGZ A;  3V0Q A;  5IDT A;  1HV9 A;  3PKQ A;  4FIY A;  4IRP A;  1R82 A;  2X65 A;  1GA8 A;  3SX5 A;  2AH9 A;  1H3M A;  2YCM A;  2Y4L A;  1GWV A;  2OEF A;  1E5K A;  1LL2 A;  2UX8 A;  4YS8 A;  1ZJO A;  4MND A;  4Y7V A;  3V0O A;  2J0A A;  2OI6 A;  4B2X A;  5CMH A;  1ZHJ A;  2RJ7 A;  1IIM A;  3DK5 A;  1JYL A;  1H5S D;  3QVB A;  1WVC A;  2GGQ A;  4FRQ A;  4AYL A;  2A8U A;  3CKN A;  2OI5 A;  4Y6N A;  3U2X A;  1FO9 A;  3CKV A;  2APC A;  2X5S A;  3OAM A;  4GBP A;  3SX8 A;  2BO6 A;  2CU2 A;  4EVW A;  1FZW A;  2WVM A;  5C4E A;  1HJL A;  2JCL A;  2FY7 A;  5C48 A;  4B2W A;  3RMV A;  5C4B A;  1QGQ A;  1R81 A;  3V0L A;  3U2T A;  3JUK A;  4FRD A;  5BXC A;  2Y4M A;  3ZF8 A;  2AM5 A;  2Q4J A;  2VD4 A;  1FG5 N;  1G2V A;  1ZI3 A;  4Y63 A;  1ZCU A;  1WT2 A;  2PGY A;  1O0R A;  4IRQ A;  1TW5 A;  3I0K A;  4E1K A;  3T7O A;  4M2B A;  2RIT A;  5I1F A;  1YP3 A;  2A8W A;  1O7Q A;  2V0K A;  3F1Y A;  2Y6P A;  4Y64 A;  2FYB A; 
#chains in the Genus database with same CATH homology
 4ECM A;  2BO8 A;  1HM0 A;  1GX4 A;  1VM8 A;  3V91 A;  5C36 A;  4CVH A;  4Y6U A;  3V8Y A;  1VGU A;  4HO4 A;  4UEG A;  1VPA A;  1ZJ0 A;  2YES A;  2RJ9 A;  3Q80 A;  2RJ1 A;  5C1G A;  1QGS A;  3OH0 A;  1VIC A;  5C4D A;  1H5R B;  3V0N A;  2FFU A;  3ZGG A;  2AEC A;  3E25 A;  2X60 A;  2WVK A;  5EIY A;  5JQQ A;  2RIX A;  1H4D A;  2P6W A;  4BQH A;  1FOA A;  4AYJ A;  4ASJ A;  5FU8 A;  2O1H A;  3LW6 A;  5D92 A;  1ON8 A;  4EEG A;  4XWI A;  5CQM X;  2Y4K A;  4FRH A;  3OGZ A;  2JCK A;  4NAL A;  1MC3 A;  3OKR A;  1NF5 B;  4Q7C A;  4D11 C;  3F1C A;  4FRE A;  4FRM A;  2C0N A;  3I0E A;  1H5S A;  1O23 B;  3PNN A;  2VS3 A;  2WEE A;  2X5Z A;  1H5S B;  1OQM B;  1G23 A;  2D7I A;  5D91 A;  1H7T A;  3CGX A;  1FO8 A;  3OH3 A;  1GQC A;  2XMH A;  4ZDQ A;  3SXC A;  4CJB A;  3ZGF A;  4EE3 A;  1ZDF A;  2E8B A;  2E3D A;  4Y9X A;  3U2U A;  3KIA A;  3V0M A;  4CJC A;  1NQI B;  4FQW A;  1VZU A;  3R2W A;  2JCJ A;  4R7P A;  1FWY A;  1ZI5 A;  1NKH B;  2WE9 A;  5FYE A;  1HJJ A;  4NAK A;  1MP3 A;  1INJ A;  1FXO A;  2XWN A;  3BRK X;  4O6M A;  1JYK A;  1H7H A;  2VK9 A;  3I0D A;  5FV9 A;  4G87 A;  2Z86 A;  2QH5 A;  1LL0 A;  2O1G A;  2QGI A;  4B42 A;  2PX7 A;  1ZJ2 A;  5L6S A;  3I0H A;  1EYR A;  4Y7U A;  4FIX A;  4LW3 A;  5FTS A;  3CKQ A;  1V84 A;  1S4O A;  1W77 A;  5AJP A;  2XME A;  1NHE B;  1FXJ A;  2DPW A;  1H7E A;  5C47 A;  1WT3 A;  5CQN X;  3U2W A;  3U0X A;  1GQ9 A;  1VZX A;  1LZ0 A;  2BO4 A;  3K8D A;  1S4N A;  4G3Q A;  4HO0 A;  4AC3 A;  1HM9 A;  4B4B A;  1VH3 A;  1K4V A;  3USQ A;  5C1H A;  3SX3 A;  1V82 A;  4EEO A;  4KNR A;  4D0T A;  4Y7T A;  3D8V A;  3V8Z A;  4MYB A;  2J0B A;  1VGT A;  3U2V A;  2AM4 A;  1O7O A;  3I0G A;  1Z90 A;  4HO5 A;  2I5K A;  2ZU9 A;  4FCU A;  4M2A A;  1G97 A;  3I0F A;  2NXV A;  5DDT A;  2P72 A;  1YP2 A;  2I5E A;  4KXO A;  5IDS A;  1VH1 A;  1R7X A;  4KQL A;  3FOQ A;  2AE7 A;  3GUE A;  3CKO A;  4MIX A;  4HG6 A;  3U0Y A;  3ST8 A;  3DUV A;  3HL3 A;  4NAN A;  5L6V A;  1LZJ A;  1ZI1 A;  1INI A;  4KPX A;  2Y7A A;  3SXD A;  2V0H A;  1YRO B;  5CQL X;  3ZLL A;  5CMI A;  4FCE A;  1ZCY A;  1ZI4 A;  1S4P A;  2P73 A;  3OH2 A;  2BO7 A;  5C38 A;  4P00 A;  4DE7 A;  1JV1 A;  1MP4 A;  3TZT A;  1TVY A;  1FR9 A;  2YQS A;  1VGW A;  4FRL A;  2FYD B;  1XHB A;  2O1F A;  4KNX A;  4D0Z A;  3CU0 A;  1LZI A;  2VXL A;  4HO6 A;  5AJO A;  1JVG A;  4JIS A;  4M4K A;  4KRV A;  1G3L A;  1H5T A;  3O3P A;  2I7B A;  2GGO A;  1W55 A;  5HS2 A;  1ZJ3 A;  3K8E A;  1R7V A;  3SXA A;  1H7G A;  5CQP A;  2XWL A;  1R80 A;  4KC4 A;  3POL A;  1JV3 A;  1ZCT A;  4Y62 A;  5C4F A;  1R7Y A;  1YP4 A;  2YQC A;  1H5S C;  1NWG B;  1PZY B;  5IFY A;  1H7Q A;  4K6R A;  1WSZ A;  5C49 A;  5CMF X;  3I0L A;  2ICX A;  3IOH A;  2YC5 A;  2RJ8 A;  1LZ7 A;  2FYA A;  5C1L A;  1G0R A;  4B4M A;  4G3S A;  3V90 A;  2RIY A;  4EEM A;  1G8O A;  1ZJ1 A;  1I52 A;  2Z87 A;  4KC1 A;  1GWW A;  2V0L A;  5C8R A;  1HM8 A;  2W0W A;  4LW6 A;  4FRA A;  4BMA A;  3I0C A;  4EE5 A;  4M28 A;  1G93 A;  2FYC B;  4HO8 A;  2VXM A;  4J18 A;  1FRW A;  5J49 A;  3D98 A;  1GX0 A;  5CMJ A;  2YC3 A;  3NGW A;  4CJ8 A;  4HOC A;  1ZJP A;  4O6N A;  1H7L A;  1V83 A;  3D5N A;  2FFV A;  1OMX A;  3FWW A;  3I0I X;  1NMM B;  4DDZ A;  3SX7 A;  4NAI A;  4FRP A;  1WT0 A;  4B3U A;  5C3B A;  5C4C A;  3JTJ A;  4B4G A;  1MP5 A;  1SS9 A;  5CMG X;  4AAW A;  1H4C A;  4ARW A;  3SXG A;  2OI7 A;  3RMW A;  2ZU7 A;  4HO2 A;  1W57 A;  1TZF A;  1EZI A;  1ZIZ A;  2MZB A;  2V0I A;  3Q7U A;  1FGG A;  1FR8 A;  2PGV A;  1LL3 A;  1QG8 A;  2ICY A;  1OMZ A;  4FRO A;  1R7U A;  4HO3 A;  3T7N A;  3SXE A;  1IIN A;  2RJ4 A;  2YQJ A;  2D7R A;  2RJ0 A;  4DEC A;  4HCQ A;  4L41 C;  1XZ6 A;  3CKJ A;  4D48 A;  3TQD A;  1ZCV A;  1H5R A;  2AGD A;  2AM3 A;  3IOI A;  5FTV A;  1WT1 A;  4B5B A;  3E26 A;  2W0V A;  3OH1 A;  2OEG A;  2V0J A;  4Y7F A;  1VGZ A;  4FRB A;  3RSB A;  4D11 A;  3Q4S A;  3R3I A;  4HO9 A;  4ASY A;  2XWM A;  2VS4 A;  2VSH A;  4KPZ A;  2VSI A;  1PZT A;  3EE5 A;  4C2S A;  1JVD A;  1H4E A;  5FUH A;  1KWS A;  4KC2 A;  3SXB A;  3DJ4 A;  1VZT A;  1LVW A;  5FU0 A;  2PA4 A;  3T7M A;  1H5T B;  2VS5 A;  1ZDG A;  4EE4 A;  2Y4J A;  1R7T A;  5AJN A;  5DDV A;  2JCO A;  3OC9 A;  3I0J A;  5C3A A;  3BCV A;  5C3D A;  3PKP A;  1ON6 A;  1H7F A;  2ZU8 A;  4G3P A;  4Y7G A;  2RJ6 A;  3USR A;  5EJ1 A;  1G1L A;  3IOJ A;  4KT7 A;  2WVL A;  1FGX A;  1QWJ A;  4JD0 A;  3JUJ A;  2RIZ A;  2RJ5 A;  2VFZ A;  5CQO A;  3V0P A;  3SPT A;  5EJZ A;  2QKX A;  1TW1 A;  4EEA A;  3N9W A;  2D0J A;  3ZLK A;  4P02 A;  1G9R A;  2AES A;  3OH4 A;  1G95 A;  2YQH A;  2WAW A;  2WGZ A;  3V0Q A;  5IDT A;  1HV9 A;  3PKQ A;  4FIY A;  4IRP A;  1R82 A;  2X65 A;  1GA8 A;  3SX5 A;  2AH9 A;  1H3M A;  2YCM A;  2Y4L A;  1GWV A;  2OEF A;  1E5K A;  1LL2 A;  2UX8 A;  4YS8 A;  1ZJO A;  4MND A;  4Y7V A;  3V0O A;  2J0A A;  2OI6 A;  4B2X A;  5CMH A;  1ZHJ A;  2RJ7 A;  1IIM A;  3DK5 A;  1JYL A;  1H5S D;  3QVB A;  1WVC A;  2GGQ A;  4FRQ A;  4AYL A;  2A8U A;  3CKN A;  2OI5 A;  4Y6N A;  3U2X A;  1FO9 A;  3CKV A;  2APC A;  2X5S A;  3OAM A;  4GBP A;  3SX8 A;  2BO6 A;  2CU2 A;  4EVW A;  1FZW A;  2WVM A;  5C4E A;  1HJL A;  2JCL A;  2FY7 A;  5C48 A;  4B2W A;  3RMV A;  5C4B A;  1QGQ A;  1R81 A;  3V0L A;  3U2T A;  3JUK A;  4FRD A;  5BXC A;  2Y4M A;  3ZF8 A;  2AM5 A;  2Q4J A;  2VD4 A;  1FG5 N;  1G2V A;  1ZI3 A;  4Y63 A;  1ZCU A;  1WT2 A;  2PGY A;  1O0R A;  4IRQ A;  1TW5 A;  3I0K A;  4E1K A;  3T7O A;  4M2B A;  2RIT A;  5I1F A;  1YP3 A;  2A8W A;  1O7Q A;  2V0K A;  3F1Y A;  2Y6P A;  4Y64 A;  2FYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...