1O23B

Crystal structure of lactose synthase in the presence of udp-glucose
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
272
structure length
272
Chain Sequence
LTACPEESPLLVGPMLIEFNIPVDLKLVEQQNPKVKLGGRYTPMDCISPHKVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGESMFNRAKLLNVGFKEALKDYDYNCFVFSDVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLSINGFPNNYWGWGGEDDDIYNRLAFRGMSVSRPNAVIGKCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYMVLEVQRYPLYTKITVDIGTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-LACTALBUMIN
publication title Alpha-Lactalbumin (La) Stimulates Milk Beta-1,4-Galactosyltransferase I (Beta 4Gal-T1) to Transfer Glucose from Udp-Glucose to N-Acetylglucosamine. Crystal Structure of Beta 4Gal-T1 X La Complex with Udp-Glc.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase activator/transferase
total genus 96
structure length 272
sequence length 272
chains with identical sequence D
ec nomenclature ec 2.4.1.22: Lactose synthase.
pdb deposition date 2003-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02709 Glyco_transf_7C N-terminal domain of galactosyltransferase
B PF13733 Glyco_transf_7N N-terminal region of glycosyl transferase group 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1o23B00
2W0WA 4JD0A 1EYRA 5C36A 1ZCYA 3SX5A 1FR9A 3I0IX 2Z87A 4HO5A 2VD4A 1FOAA 3FWWA 1INIA 3ZLLA 1HM9A 1QG8A 4FCUA 4CJBA 1ZDFA 4HO3A 4EEAA 2OEGA 4R7PA 1G9RA 2VFZA 4ECMA 2AM5A 3SXGA 1GWWA 4Y62A 3FOQA 3E25A 4NALA 1ZCTA 1YROB 3K8EA 4G3QA 1H7TA 4GBPA 3V0LA 1HV9A 2I5KA 2RJ5A 3DJ4A 1LZ0A 4Y7FA 1IINA 2YC5A 3Q80A 3PKPA 3CKOA 4L41C 1LL0A 1JVGA 3BRKX 3V0NA 4HG6A 1WT1A 3V0QA 3OH0A 2Z86A 1FO9A 2YCMA 1H5SB 1H5RB 2RITA 1ON8A 5EIYA 2WVMA 4Y7UA 5C1HA 1HM8A 2RJ9A 4UEGA 1H7HA 4KC1A 2JCJA 4HO6A 5CQMX 2JCKA 5IDTA 3RSBA 2JCLA 1R7VA 4KRVA 5C49A 3JTJA 1WT2A 4M4KA 3CU0A 5C1LA 1FZWA 2X65A 2YC3A 3CKQA 1O23B 1O7QA 1VGUA 3I0CA 4HO8A 4P02A 3SXBA 4E1KA 1VPAA 3I0HA 1H4DA 4D11A 1VZXA 3V0PA 1S4NA 2AM3A 2P73A 5L6VA 5CMHA 1VH3A 3JUKA 3I0FA 5AJPA 2Y4KA 3LW6A 4B4GA 3OAMA 4G87A 1V84A 1H3MA 2VS4A 1R7TA 5DDVA 4CVHA 2BO7A 4HOCA 1G95A 1G93A 5HS2A 1ZI1A 3I0JA 3SPTA 5C4FA 5C4CA 4ASYA 2V0IA 1VZTA 1VGWA 4Y6UA 4KT7A 3SXDA 4NANA 5C38A 2D7RA 4B42A 5C8RA 2APCA 3D8VA 4DECA 5IDSA 4Y64A 4FRBA 1QGSA 2RJ7A 3IOJA 4G3PA 2PA4A 1LL3A 3ZGGA 3QVBA 1GQ9A 4G3SA 2E3DA 4XWIA 2QGIA 2P6WA 1ZI5A 1YP2A 5JQQA 4BMAA 2CU2A 3IOHA 4Y7TA 1HJJA 1GX4A 1H7LA 1ZCUA 5CMIA 4AAWA 1S4PA 3U2WA 2BO8A 4EVWA 3CGXA 4C2SA 1R80A 2VSHA 1G8OA 1WT0A 2AH9A 2O1HA 5J49A 4FRQA 1H7QA 1YP4A 2GGOA 3OH4A 2V0HA 5C1GA 2I7BA 4Y7VA 3KIAA 4FROA 4KQLA 4FRLA 1ZJPA 1MC3A 1VGZA 4B4MA 1FG5N 1NQIB 2ZU9A 1OQMB 1QWJA 5EJZA 4J18A 5CQPA 4KPZA 4DDZA 2FY7A 1R7YA 4ASJA 2FFVA 3T7NA 4EE3A 1FRWA 5I1FA 4FRPA 4B5BA 1LZIA 3OKRA 3DUVA 1HJLA 3ZLKA 2XWLA 2XWNA 1W77A 1NF5B 3F1CA 3I0EA 3N9WA 4HO9A 1MP3A 2AGDA 1JV1A 3SXEA 1PZTA 1ZJ3A 3RMWA 1MP4A 3V8ZA 2X5ZA 1H5SC 4B3UA 1GWVA 3ST8A 3DK5A 4EEGA 2WVLA 2X5SA 1Z90A 2BO6A 2ZU7A 5FTSA 3EE5A 1PZYB 3U2VA 1FO8A 4JISA 2PX7A 2YQSA 2ZU8A 3U2UA 1G23A 2Y4LA 1GA8A 4FQWA 4M2AA 5IFYA 2Q4JA 4Y9XA 1V82A 3JUJA 3SX3A 1SS9A 1K4VA 2E8BA 4EEMA 1JVDA 1VH1A 1G3LA 5CMFX 2FYBA 1S4OA 4EEOA 3SX8A 1IIMA 2Y6PA 5CMGX 3K8DA 4D0ZA 2ICXA 2MZBA 1R82A 1TW5A 4FRMA 1ZDGA 1W55A 2FYAA 2NXVA 2X60A 3I0DA 1W57A 2A8UA 4LW3A 2XMHA 3U2TA 1R7UA 3I0KA 3V8YA 3T7OA 4HCQA 3TZTA 1OMXA 1FXJA 1GX0A 3O3PA 4CJCA 5C4BA 5AJOA 3USQA 3E26A 1G2VA 3HL3A 4DE7A 2AE7A 4IRQA 4K6RA 2V0KA 2AM4A 1MP5A 4CJ8A 3D98A 4KNXA 5FUHA 1LVWA 3IOIA 3I0LA 2FFUA 2QH5A 5CQOA 3CKVA 2Y7AA 4ARWA 1O7OA 4BQHA 1GQCA 1LL2A 4KC2A 2RJ8A 3V90A 3GUEA 1LZJA 2OI7A 1TZFA 5C3AA 5DDTA 1TVYA 1G97A 2DPWA 3OH1A 2RJ1A 5FYEA 4D0TA 4HO0A 4FRAA 2WEEA 3PNNA 1H5TA 1HM0A 3D5NA 3U0XA 4NAKA 1FGGA 3F1YA 4FRHA 1JV3A 1ZJ0A 3U2XA 3PKQA 1JYKA 4HO2A 1H4CA 2RJ6A 2Y4JA 5C4EA 1XHBA 1TW1A 3OGZA 1V83A 3V91A 5C3BA 3R2WA 1LZ7A 2RIYA 1H7FA 3RMVA 2AECA 4FCEA 5EJ1A 2WGZA 1ZJ1A 4AYLA 3SX7A 2WVKA 4M2BA 1H4EA 1ZJ2A 1JYLA 3SXCA 3I0GA 1NWGB 3V0MA 1H5SD 3NGWA 4Y7GA 2VXLA 2FYCB 1R81A 4MNDA 1KWSA 1FGXA 3Q7UA 1ZIZA 2RIZA 1WSZA 2YQHA 2WE9A 2YQJA 3V0OA 5BXCA 4D11C 3BCVA 4KPXA 2YQCA 3R3IA 2BO4A 2RIXA 4D48A 1ZCVA 4P00A 1ZI3A 2GGQA 2VXMA 1OMZA 2PGYA 4B2WA 4B4BA 1FR8A 1NMMB 2AESA 2Y4MA 2D7IA 2XWMA 1NHEB 2VS3A 5C48A 1EZIA 2WAWA 3SXAA 1VM8A 5L6SA 3CKNA 1WVCA 2ICYA 3Q4SA 3POLA 2QKXA 4AC3A 5C3DA 1VGTA 1E5KA 1O0RA 2A8WA 5FV9A 4B2XA 4FRDA 4KC4A 5CQNX 5AJNA 4NAIA 4EE5A 2UX8A 5C47A 2VSIA 1FXOA 1H7GA 1G1LA 4FREA 1XZ6A 2XMEA 2OI6A 3T7MA 2OEFA 1YP3A 1H7EA 4Y63A 3USRA 1FWYA 3ZF8A 2I5EA 1G0RA 1WT3A 1H5SA 1H5RA 1H5TB 4LW6A 2PGVA 4M28A 4ZDQA 1ON6A 3CKJA 4KNRA 2VS5A 1VZUA 1ZJOA 5FTVA 1VICA 2RJ4A 1QGQA 2OI5A 3ZGFA 3TQDA 4KXOA 2O1FA 2D0JA 2JCOA 2FYDB 5FU0A 1R7XA 5C4DA 1INJA 3OC9A 3U0YA 3OH3A 4IRPA 4YS8A 1ZI4A 1NKHB 1I52A 4MYBA 2V0LA 2W0VA 5FU8A 2RJ0A 4Y6NA 5CMJA 2O1GA 1ZHJA 3OH2A 2P72A 5CQLX 4EE4A 4AYJA 2YESA 2V0JA 4HO4A
chains in the Genus database with same CATH superfamily
2W0WA 4JD0A 1EYRA 5C36A 1ZCYA 3SX5A 1FR9A 3I0IX 2Z87A 4HO5A 2VD4A 1FOAA 3FWWA 1INIA 3ZLLA 1HM9A 1QG8A 4FCUA 4CJBA 1ZDFA 4HO3A 4EEAA 2OEGA 4R7PA 1G9RA 2VFZA 4ECMA 2AM5A 3SXGA 1GWWA 4Y62A 3FOQA 3E25A 4NALA 1ZCTA 1YROB 3K8EA 4G3QA 1H7TA 4GBPA 3V0LA 1HV9A 2I5KA 2RJ5A 3DJ4A 1LZ0A 4Y7FA 1IINA 2YC5A 3Q80A 3PKPA 4FIXA 3CKOA 4L41C 1LL0A 1JVGA 3BRKX 3V0NA 4HG6A 1WT1A 3V0QA 3OH0A 2Z86A 1FO9A 2YCMA 1H5SB 1H5RB 2RITA 1ON8A 5EIYA 2WVMA 4Y7UA 5C1HA 1HM8A 2RJ9A 4UEGA 1H7HA 4KC1A 2JCJA 4HO6A 5CQMX 2J0AA 2JCKA 5IDTA 3RSBA 2JCLA 1R7VA 4KRVA 5C49A 3JTJA 1WT2A 4M4KA 3CU0A 5C1LA 1FZWA 2X65A 2YC3A 3CKQA 1O23B 1O7QA 1VGUA 3I0CA 4HO8A 4P02A 3SXBA 4E1KA 1VPAA 3I0HA 1H4DA 4D11A 1VZXA 3V0PA 1S4NA 2AM3A 2P73A 5L6VA 5CMHA 1VH3A 3JUKA 3I0FA 5AJPA 2Y4KA 3LW6A 4B4GA 3OAMA 4G87A 1V84A 1H3MA 2J0BA 2C0NA 2VS4A 1R7TA 5DDVA 4CVHA 2BO7A 4HOCA 1G95A 1G93A 5HS2A 1ZI1A 3I0JA 3SPTA 5C4FA 5C4CA 4ASYA 2V0IA 1VZTA 1VGWA 4Y6UA 4KT7A 3SXDA 4NANA 5C38A 2D7RA 4B42A 5C8RA 2APCA 3D8VA 4DECA 5IDSA 4Y64A 4FRBA 1QGSA 2RJ7A 3IOJA 4G3PA 2PA4A 1LL3A 3ZGGA 3QVBA 1GQ9A 4G3SA 4MIXA 2E3DA 4XWIA 2QGIA 2P6WA 1ZI5A 1YP2A 5JQQA 4BMAA 2CU2A 3IOHA 4Y7TA 1HJJA 1GX4A 1H7LA 1ZCUA 5CMIA 4AAWA 1S4PA 3U2WA 2BO8A 4EVWA 3CGXA 4C2SA 1R80A 2VSHA 1G8OA 1WT0A 2AH9A 2O1HA 5J49A 4FRQA 1H7QA 1YP4A 2GGOA 3OH4A 2V0HA 5C1GA 2I7BA 4Y7VA 3KIAA 4FROA 4KQLA 4FRLA 1ZJPA 1MC3A 1VGZA 4B4MA 4Q7CA 1FG5N 1NQIB 2ZU9A 1OQMB 1QWJA 5EJZA 4J18A 5CQPA 4KPZA 4DDZA 2FY7A 1R7YA 4ASJA 2FFVA 3T7NA 4EE3A 1FRWA 5I1FA 4FRPA 4B5BA 1LZIA 3OKRA 3DUVA 1HJLA 3ZLKA 2XWLA 2XWNA 1W77A 1NF5B 3F1CA 3I0EA 3N9WA 4HO9A 1MP3A 2AGDA 1JV1A 3SXEA 1PZTA 1ZJ3A 3RMWA 1MP4A 3V8ZA 2X5ZA 1H5SC 4B3UA 1GWVA 3ST8A 3DK5A 4EEGA 2WVLA 2X5SA 1Z90A 2BO6A 2VK9A 2ZU7A 5FTSA 3EE5A 1PZYB 3U2VA 1FO8A 4JISA 2PX7A 2YQSA 2ZU8A 5D92A 3U2UA 1G23A 2Y4LA 1GA8A 4FQWA 4M2AA 5IFYA 2Q4JA 4Y9XA 1V82A 3JUJA 3SX3A 1SS9A 1K4VA 2E8BA 4EEMA 1JVDA 1VH1A 1G3LA 5CMFX 2FYBA 1S4OA 4EEOA 3SX8A 1IIMA 2Y6PA 5CMGX 3K8DA 4D0ZA 2ICXA 2MZBA 1R82A 1TW5A 4FRMA 1ZDGA 1W55A 2FYAA 2NXVA 2X60A 3I0DA 1W57A 2A8UA 4LW3A 2XMHA 3U2TA 1R7UA 3I0KA 3V8YA 3T7OA 4HCQA 3TZTA 1OMXA 1FXJA 1GX0A 3O3PA 4CJCA 5C4BA 5AJOA 3USQA 3E26A 1G2VA 3HL3A 4DE7A 2AE7A 4IRQA 4K6RA 2V0KA 2AM4A 1MP5A 4CJ8A 3D98A 4KNXA 5FUHA 1LVWA 3IOIA 3I0LA 2FFUA 2QH5A 5CQOA 3CKVA 2Y7AA 4ARWA 1O7OA 4BQHA 1GQCA 1LL2A 4KC2A 2RJ8A 3V90A 3GUEA 1LZJA 2OI7A 1TZFA 5C3AA 5DDTA 1TVYA 1G97A 2DPWA 3OH1A 2RJ1A 5FYEA 4D0TA 4HO0A 4FRAA 2WEEA 3PNNA 1H5TA 1HM0A 3D5NA 3U0XA 4NAKA 1FGGA 3F1YA 4FRHA 1JV3A 1ZJ0A 3U2XA 3PKQA 1JYKA 4HO2A 1H4CA 2RJ6A 2Y4JA 5C4EA 1XHBA 1TW1A 3OGZA 1V83A 3V91A 5C3BA 3R2WA 1LZ7A 2RIYA 1H7FA 3RMVA 2AECA 4FCEA 5EJ1A 2WGZA 1ZJ1A 4AYLA 3SX7A 2WVKA 4M2BA 1H4EA 1ZJ2A 1JYLA 3SXCA 3I0GA 1NWGB 3V0MA 1H5SD 3NGWA 4Y7GA 2VXLA 2FYCB 1R81A 4MNDA 1KWSA 4FIYA 1FGXA 3Q7UA 1ZIZA 2RIZA 1WSZA 2YQHA 2WE9A 2YQJA 3V0OA 5BXCA 4D11C 3BCVA 4KPXA 2YQCA 3R3IA 2BO4A 2RIXA 4D48A 1ZCVA 4P00A 1ZI3A 2GGQA 2VXMA 1OMZA 2PGYA 4B2WA 4B4BA 1FR8A 1NMMB 2AESA 2Y4MA 2D7IA 2XWMA 1NHEB 2VS3A 5C48A 1EZIA 2WAWA 3SXAA 1VM8A 5L6SA 3CKNA 1WVCA 2ICYA 3Q4SA 3POLA 2QKXA 4AC3A 5C3DA 1VGTA 1E5KA 1O0RA 2A8WA 5FV9A 4B2XA 4FRDA 4KC4A 5CQNX 5AJNA 4NAIA 4EE5A 2UX8A 5C47A 2VSIA 1FXOA 1H7GA 1G1LA 4FREA 1XZ6A 2XMEA 2OI6A 3T7MA 2OEFA 1YP3A 1H7EA 4O6MA 4Y63A 3USRA 1FWYA 3ZF8A 2I5EA 1G0RA 1WT3A 1H5SA 1H5RA 1H5TB 4LW6A 2PGVA 4M28A 4ZDQA 1ON6A 3CKJA 4KNRA 2VS5A 1VZUA 1ZJOA 5FTVA 1VICA 4O6NA 2RJ4A 1QGQA 2OI5A 3ZGFA 3TQDA 4KXOA 2O1FA 2D0JA 2JCOA 2FYDB 5FU0A 1R7XA 5C4DA 1INJA 5D91A 3OC9A 3U0YA 3OH3A 4IRPA 4YS8A 1ZI4A 1NKHB 1I52A 4MYBA 2V0LA 2W0VA 5FU8A 2RJ0A 4Y6NA 5CMJA 2O1GA 1ZHJA 3OH2A 2P72A 5CQLX 4EE4A 4AYJA 2YESA 2V0JA 4HO4A
chains in the Genus database with same CATH topology
2W0WA 4JD0A 1EYRA 5C36A 1ZCYA 3SX5A 1FR9A 3I0IX 2Z87A 4HO5A 2VD4A 1FOAA 3FWWA 1INIA 3ZLLA 1HM9A 1QG8A 4FCUA 4CJBA 1ZDFA 4HO3A 4EEAA 2OEGA 4R7PA 1G9RA 2VFZA 4ECMA 2AM5A 3SXGA 1GWWA 4Y62A 3FOQA 3E25A 4NALA 1ZCTA 1YROB 3K8EA 4G3QA 1H7TA 4GBPA 3V0LA 1HV9A 2I5KA 2RJ5A 3DJ4A 1LZ0A 4Y7FA 1IINA 2YC5A 3Q80A 3PKPA 4FIXA 3CKOA 4L41C 1LL0A 1JVGA 3BRKX 3V0NA 4HG6A 1WT1A 3V0QA 3OH0A 2Z86A 1FO9A 2YCMA 1H5SB 1H5RB 2RITA 1ON8A 5EIYA 2WVMA 4Y7UA 5C1HA 1HM8A 2RJ9A 4UEGA 1H7HA 4KC1A 2JCJA 4HO6A 5CQMX 2J0AA 2JCKA 5IDTA 3RSBA 2JCLA 1R7VA 4KRVA 5C49A 3JTJA 1WT2A 4M4KA 3CU0A 5C1LA 1FZWA 2X65A 2YC3A 3CKQA 1O23B 1O7QA 1VGUA 3I0CA 4HO8A 4P02A 3SXBA 4E1KA 1VPAA 3I0HA 1H4DA 4D11A 1VZXA 3V0PA 1S4NA 2AM3A 2P73A 5L6VA 5CMHA 1VH3A 3JUKA 3I0FA 5AJPA 2Y4KA 3LW6A 4B4GA 3OAMA 4G87A 1V84A 1H3MA 2J0BA 2C0NA 2VS4A 1R7TA 5DDVA 4CVHA 2BO7A 4HOCA 1G95A 1G93A 5HS2A 1ZI1A 3I0JA 3SPTA 5C4FA 5C4CA 4ASYA 2V0IA 1VZTA 1VGWA 4Y6UA 4KT7A 3SXDA 4NANA 5C38A 2D7RA 4B42A 5C8RA 2APCA 3D8VA 4DECA 5IDSA 4Y64A 4FRBA 1QGSA 2RJ7A 3IOJA 4G3PA 2PA4A 1LL3A 3ZGGA 3QVBA 1GQ9A 4G3SA 4MIXA 2E3DA 4XWIA 2QGIA 2P6WA 1ZI5A 1YP2A 5JQQA 4BMAA 2CU2A 3IOHA 4Y7TA 1HJJA 1GX4A 1H7LA 1ZCUA 5CMIA 4AAWA 1S4PA 3U2WA 2BO8A 4EVWA 3CGXA 4C2SA 1R80A 2VSHA 1G8OA 1WT0A 2AH9A 2O1HA 5J49A 4FRQA 1H7QA 1YP4A 2GGOA 3OH4A 2V0HA 5C1GA 2I7BA 4Y7VA 3KIAA 4FROA 4KQLA 4FRLA 1ZJPA 1MC3A 1VGZA 4B4MA 4Q7CA 1FG5N 1NQIB 2ZU9A 1OQMB 1QWJA 5EJZA 4J18A 5CQPA 4KPZA 4DDZA 2FY7A 1R7YA 4ASJA 2FFVA 3T7NA 4EE3A 1FRWA 5I1FA 4FRPA 4B5BA 1LZIA 3OKRA 3DUVA 1HJLA 3ZLKA 2XWLA 2XWNA 1W77A 1NF5B 3F1CA 3I0EA 3N9WA 4HO9A 1MP3A 2AGDA 1JV1A 3SXEA 1PZTA 1ZJ3A 3RMWA 1MP4A 3V8ZA 2X5ZA 1H5SC 4B3UA 1GWVA 3ST8A 3DK5A 4EEGA 2WVLA 2X5SA 1Z90A 2BO6A 2VK9A 2ZU7A 5FTSA 3EE5A 1PZYB 3U2VA 1FO8A 4JISA 2PX7A 2YQSA 2ZU8A 5D92A 3U2UA 1G23A 2Y4LA 1GA8A 4FQWA 4M2AA 5IFYA 2Q4JA 4Y9XA 1V82A 3JUJA 3SX3A 1SS9A 1K4VA 2E8BA 4EEMA 1JVDA 1VH1A 1G3LA 5CMFX 2FYBA 1S4OA 4EEOA 3SX8A 1IIMA 2Y6PA 5CMGX 3K8DA 4D0ZA 2ICXA 2MZBA 1R82A 1TW5A 4FRMA 1ZDGA 1W55A 2FYAA 2NXVA 2X60A 3I0DA 1W57A 2A8UA 4LW3A 2XMHA 3U2TA 1R7UA 3I0KA 3V8YA 3T7OA 4HCQA 3TZTA 1OMXA 1FXJA 1GX0A 3O3PA 4CJCA 5C4BA 5AJOA 3USQA 3E26A 1G2VA 3HL3A 4DE7A 2AE7A 4IRQA 4K6RA 2V0KA 2AM4A 1MP5A 4CJ8A 3D98A 4KNXA 5FUHA 1LVWA 3IOIA 3I0LA 2FFUA 2QH5A 5CQOA 3CKVA 2Y7AA 4ARWA 1O7OA 4BQHA 1GQCA 1LL2A 4KC2A 2RJ8A 3V90A 3GUEA 1LZJA 2OI7A 1TZFA 5C3AA 5DDTA 1TVYA 1G97A 2DPWA 3OH1A 2RJ1A 5FYEA 4D0TA 4HO0A 4FRAA 2WEEA 3PNNA 1H5TA 1HM0A 3D5NA 3U0XA 4NAKA 1FGGA 3F1YA 4FRHA 1JV3A 1ZJ0A 3U2XA 3PKQA 1JYKA 4HO2A 1H4CA 2RJ6A 2Y4JA 5C4EA 1XHBA 1TW1A 3OGZA 1V83A 3V91A 5C3BA 3R2WA 1LZ7A 2RIYA 1H7FA 3RMVA 2AECA 4FCEA 5EJ1A 2WGZA 1ZJ1A 4AYLA 3SX7A 2WVKA 4M2BA 1H4EA 1ZJ2A 1JYLA 3SXCA 3I0GA 1NWGB 3V0MA 1H5SD 3NGWA 4Y7GA 2VXLA 2FYCB 1R81A 4MNDA 1KWSA 4FIYA 1FGXA 3Q7UA 1ZIZA 2RIZA 1WSZA 2YQHA 2WE9A 2YQJA 3V0OA 5BXCA 4D11C 3BCVA 4KPXA 2YQCA 3R3IA 2BO4A 2RIXA 4D48A 1ZCVA 4P00A 1ZI3A 2GGQA 2VXMA 1OMZA 2PGYA 4B2WA 4B4BA 1FR8A 1NMMB 2AESA 2Y4MA 2D7IA 2XWMA 1NHEB 2VS3A 5C48A 1EZIA 2WAWA 3SXAA 1VM8A 5L6SA 3CKNA 1WVCA 2ICYA 3Q4SA 3POLA 2QKXA 4AC3A 5C3DA 1VGTA 1E5KA 1O0RA 2A8WA 5FV9A 4B2XA 4FRDA 4KC4A 5CQNX 5AJNA 4NAIA 4EE5A 2UX8A 5C47A 2VSIA 1FXOA 1H7GA 1G1LA 4FREA 1XZ6A 2XMEA 2OI6A 3T7MA 2OEFA 1YP3A 1H7EA 4O6MA 4Y63A 3USRA 1FWYA 3ZF8A 2I5EA 1G0RA 1WT3A 1H5SA 1H5RA 1H5TB 4LW6A 2PGVA 4M28A 4ZDQA 1ON6A 3CKJA 4KNRA 2VS5A 1VZUA 1ZJOA 5FTVA 1VICA 4O6NA 2RJ4A 1QGQA 2OI5A 3ZGFA 3TQDA 4KXOA 2O1FA 2D0JA 2JCOA 2FYDB 5FU0A 1R7XA 5C4DA 1INJA 5D91A 3OC9A 3U0YA 3OH3A 4IRPA 4YS8A 1ZI4A 1NKHB 1I52A 4MYBA 2V0LA 2W0VA 5FU8A 2RJ0A 4Y6NA 5CMJA 2O1GA 1ZHJA 3OH2A 2P72A 5CQLX 4EE4A 4AYJA 2YESA 2V0JA 4HO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W0W A;  4JD0 A;  1EYR A;  5C36 A;  1ZCY A;  3SX5 A;  1FR9 A;  3I0I X;  2Z87 A;  4HO5 A;  2VD4 A;  1FOA A;  3FWW A;  1INI A;  3ZLL A;  1HM9 A;  1QG8 A;  4FCU A;  4CJB A;  1ZDF A;  4HO3 A;  4EEA A;  2OEG A;  4R7P A;  1G9R A;  2VFZ A;  4ECM A;  2AM5 A;  3SXG A;  1GWW A;  4Y62 A;  3FOQ A;  3E25 A;  4NAL A;  1ZCT A;  1YRO B;  3K8E A;  4G3Q A;  1H7T A;  4GBP A;  3V0L A;  1HV9 A;  2I5K A;  2RJ5 A;  3DJ4 A;  1LZ0 A;  4Y7F A;  1IIN A;  2YC5 A;  3Q80 A;  3PKP A;  3CKO A;  4L41 C;  1LL0 A;  1JVG A;  3BRK X;  3V0N A;  4HG6 A;  1WT1 A;  3V0Q A;  3OH0 A;  2Z86 A;  1FO9 A;  2YCM A;  1H5S B;  1H5R B;  2RIT A;  1ON8 A;  5EIY A;  2WVM A;  4Y7U A;  5C1H A;  1HM8 A;  2RJ9 A;  4UEG A;  1H7H A;  4KC1 A;  2JCJ A;  4HO6 A;  5CQM X;  2JCK A;  5IDT A;  3RSB A;  2JCL A;  1R7V A;  4KRV A;  5C49 A;  3JTJ A;  1WT2 A;  4M4K A;  3CU0 A;  5C1L A;  1FZW A;  2X65 A;  2YC3 A;  3CKQ A;  1O23 B;  1O7Q A;  1VGU A;  3I0C A;  4HO8 A;  4P02 A;  3SXB A;  4E1K A;  1VPA A;  3I0H A;  1H4D A;  4D11 A;  1VZX A;  3V0P A;  1S4N A;  2AM3 A;  2P73 A;  5L6V A;  5CMH A;  1VH3 A;  3JUK A;  3I0F A;  5AJP A;  2Y4K A;  3LW6 A;  4B4G A;  3OAM A;  4G87 A;  1V84 A;  1H3M A;  2VS4 A;  1R7T A;  5DDV A;  4CVH A;  2BO7 A;  4HOC A;  1G95 A;  1G93 A;  5HS2 A;  1ZI1 A;  3I0J A;  3SPT A;  5C4F A;  5C4C A;  4ASY A;  2V0I A;  1VZT A;  1VGW A;  4Y6U A;  4KT7 A;  3SXD A;  4NAN A;  5C38 A;  2D7R A;  4B42 A;  5C8R A;  2APC A;  3D8V A;  4DEC A;  5IDS A;  4Y64 A;  4FRB A;  1QGS A;  2RJ7 A;  3IOJ A;  4G3P A;  2PA4 A;  1LL3 A;  3ZGG A;  3QVB A;  1GQ9 A;  4G3S A;  2E3D A;  4XWI A;  2QGI A;  2P6W A;  1ZI5 A;  1YP2 A;  5JQQ A;  4BMA A;  2CU2 A;  3IOH A;  4Y7T A;  1HJJ A;  1GX4 A;  1H7L A;  1ZCU A;  5CMI A;  4AAW A;  1S4P A;  3U2W A;  2BO8 A;  4EVW A;  3CGX A;  4C2S A;  1R80 A;  2VSH A;  1G8O A;  1WT0 A;  2AH9 A;  2O1H A;  5J49 A;  4FRQ A;  1H7Q A;  1YP4 A;  2GGO A;  3OH4 A;  2V0H A;  5C1G A;  2I7B A;  4Y7V A;  3KIA A;  4FRO A;  4KQL A;  4FRL A;  1ZJP A;  1MC3 A;  1VGZ A;  4B4M A;  1FG5 N;  1NQI B;  2ZU9 A;  1OQM B;  1QWJ A;  5EJZ A;  4J18 A;  5CQP A;  4KPZ A;  4DDZ A;  2FY7 A;  1R7Y A;  4ASJ A;  2FFV A;  3T7N A;  4EE3 A;  1FRW A;  5I1F A;  4FRP A;  4B5B A;  1LZI A;  3OKR A;  3DUV A;  1HJL A;  3ZLK A;  2XWL A;  2XWN A;  1W77 A;  1NF5 B;  3F1C A;  3I0E A;  3N9W A;  4HO9 A;  1MP3 A;  2AGD A;  1JV1 A;  3SXE A;  1PZT A;  1ZJ3 A;  3RMW A;  1MP4 A;  3V8Z A;  2X5Z A;  1H5S C;  4B3U A;  1GWV A;  3ST8 A;  3DK5 A;  4EEG A;  2WVL A;  2X5S A;  1Z90 A;  2BO6 A;  2ZU7 A;  5FTS A;  3EE5 A;  1PZY B;  3U2V A;  1FO8 A;  4JIS A;  2PX7 A;  2YQS A;  2ZU8 A;  3U2U A;  1G23 A;  2Y4L A;  1GA8 A;  4FQW A;  4M2A A;  5IFY A;  2Q4J A;  4Y9X A;  1V82 A;  3JUJ A;  3SX3 A;  1SS9 A;  1K4V A;  2E8B A;  4EEM A;  1JVD A;  1VH1 A;  1G3L A;  5CMF X;  2FYB A;  1S4O A;  4EEO A;  3SX8 A;  1IIM A;  2Y6P A;  5CMG X;  3K8D A;  4D0Z A;  2ICX A;  2MZB A;  1R82 A;  1TW5 A;  4FRM A;  1ZDG A;  1W55 A;  2FYA A;  2NXV A;  2X60 A;  3I0D A;  1W57 A;  2A8U A;  4LW3 A;  2XMH A;  3U2T A;  1R7U A;  3I0K A;  3V8Y A;  3T7O A;  4HCQ A;  3TZT A;  1OMX A;  1FXJ A;  1GX0 A;  3O3P A;  4CJC A;  5C4B A;  5AJO A;  3USQ A;  3E26 A;  1G2V A;  3HL3 A;  4DE7 A;  2AE7 A;  4IRQ A;  4K6R A;  2V0K A;  2AM4 A;  1MP5 A;  4CJ8 A;  3D98 A;  4KNX A;  5FUH A;  1LVW A;  3IOI A;  3I0L A;  2FFU A;  2QH5 A;  5CQO A;  3CKV A;  2Y7A A;  4ARW A;  1O7O A;  4BQH A;  1GQC A;  1LL2 A;  4KC2 A;  2RJ8 A;  3V90 A;  3GUE A;  1LZJ A;  2OI7 A;  1TZF A;  5C3A A;  5DDT A;  1TVY A;  1G97 A;  2DPW A;  3OH1 A;  2RJ1 A;  5FYE A;  4D0T A;  4HO0 A;  4FRA A;  2WEE A;  3PNN A;  1H5T A;  1HM0 A;  3D5N A;  3U0X A;  4NAK A;  1FGG A;  3F1Y A;  4FRH A;  1JV3 A;  1ZJ0 A;  3U2X A;  3PKQ A;  1JYK A;  4HO2 A;  1H4C A;  2RJ6 A;  2Y4J A;  5C4E A;  1XHB A;  1TW1 A;  3OGZ A;  1V83 A;  3V91 A;  5C3B A;  3R2W A;  1LZ7 A;  2RIY A;  1H7F A;  3RMV A;  2AEC A;  4FCE A;  5EJ1 A;  2WGZ A;  1ZJ1 A;  4AYL A;  3SX7 A;  2WVK A;  4M2B A;  1H4E A;  1ZJ2 A;  1JYL A;  3SXC A;  3I0G A;  1NWG B;  3V0M A;  1H5S D;  3NGW A;  4Y7G A;  2VXL A;  2FYC B;  1R81 A;  4MND A;  1KWS A;  1FGX A;  3Q7U A;  1ZIZ A;  2RIZ A;  1WSZ A;  2YQH A;  2WE9 A;  2YQJ A;  3V0O A;  5BXC A;  4D11 C;  3BCV A;  4KPX A;  2YQC A;  3R3I A;  2BO4 A;  2RIX A;  4D48 A;  1ZCV A;  4P00 A;  1ZI3 A;  2GGQ A;  2VXM A;  1OMZ A;  2PGY A;  4B2W A;  4B4B A;  1FR8 A;  1NMM B;  2AES A;  2Y4M A;  2D7I A;  2XWM A;  1NHE B;  2VS3 A;  5C48 A;  1EZI A;  2WAW A;  3SXA A;  1VM8 A;  5L6S A;  3CKN A;  1WVC A;  2ICY A;  3Q4S A;  3POL A;  2QKX A;  4AC3 A;  5C3D A;  1VGT A;  1E5K A;  1O0R A;  2A8W A;  5FV9 A;  4B2X A;  4FRD A;  4KC4 A;  5CQN X;  5AJN A;  4NAI A;  4EE5 A;  2UX8 A;  5C47 A;  2VSI A;  1FXO A;  1H7G A;  1G1L A;  4FRE A;  1XZ6 A;  2XME A;  2OI6 A;  3T7M A;  2OEF A;  1YP3 A;  1H7E A;  4Y63 A;  3USR A;  1FWY A;  3ZF8 A;  2I5E A;  1G0R A;  1WT3 A;  1H5S A;  1H5R A;  1H5T B;  4LW6 A;  2PGV A;  4M28 A;  4ZDQ A;  1ON6 A;  3CKJ A;  4KNR A;  2VS5 A;  1VZU A;  1ZJO A;  5FTV A;  1VIC A;  2RJ4 A;  1QGQ A;  2OI5 A;  3ZGF A;  3TQD A;  4KXO A;  2O1F A;  2D0J A;  2JCO A;  2FYD B;  5FU0 A;  1R7X A;  5C4D A;  1INJ A;  3OC9 A;  3U0Y A;  3OH3 A;  4IRP A;  4YS8 A;  1ZI4 A;  1NKH B;  1I52 A;  4MYB A;  2V0L A;  2W0V A;  5FU8 A;  2RJ0 A;  4Y6N A;  5CMJ A;  2O1G A;  1ZHJ A;  3OH2 A;  2P72 A;  5CQL X;  4EE4 A;  4AYJ A;  2YES A;  2V0J A;  4HO4 A; 
#chains in the Genus database with same CATH topology
 2W0W A;  4JD0 A;  1EYR A;  5C36 A;  1ZCY A;  3SX5 A;  1FR9 A;  3I0I X;  2Z87 A;  4HO5 A;  2VD4 A;  1FOA A;  3FWW A;  1INI A;  3ZLL A;  1HM9 A;  1QG8 A;  4FCU A;  4CJB A;  1ZDF A;  4HO3 A;  4EEA A;  2OEG A;  4R7P A;  1G9R A;  2VFZ A;  4ECM A;  2AM5 A;  3SXG A;  1GWW A;  4Y62 A;  3FOQ A;  3E25 A;  4NAL A;  1ZCT A;  1YRO B;  3K8E A;  4G3Q A;  1H7T A;  4GBP A;  3V0L A;  1HV9 A;  2I5K A;  2RJ5 A;  3DJ4 A;  1LZ0 A;  4Y7F A;  1IIN A;  2YC5 A;  3Q80 A;  3PKP A;  4FIX A;  3CKO A;  4L41 C;  1LL0 A;  1JVG A;  3BRK X;  3V0N A;  4HG6 A;  1WT1 A;  3V0Q A;  3OH0 A;  2Z86 A;  1FO9 A;  2YCM A;  1H5S B;  1H5R B;  2RIT A;  1ON8 A;  5EIY A;  2WVM A;  4Y7U A;  5C1H A;  1HM8 A;  2RJ9 A;  4UEG A;  1H7H A;  4KC1 A;  2JCJ A;  4HO6 A;  5CQM X;  2J0A A;  2JCK A;  5IDT A;  3RSB A;  2JCL A;  1R7V A;  4KRV A;  5C49 A;  3JTJ A;  1WT2 A;  4M4K A;  3CU0 A;  5C1L A;  1FZW A;  2X65 A;  2YC3 A;  3CKQ A;  1O23 B;  1O7Q A;  1VGU A;  3I0C A;  4HO8 A;  4P02 A;  3SXB A;  4E1K A;  1VPA A;  3I0H A;  1H4D A;  4D11 A;  1VZX A;  3V0P A;  1S4N A;  2AM3 A;  2P73 A;  5L6V A;  5CMH A;  1VH3 A;  3JUK A;  3I0F A;  5AJP A;  2Y4K A;  3LW6 A;  4B4G A;  3OAM A;  4G87 A;  1V84 A;  1H3M A;  2J0B A;  2C0N A;  2VS4 A;  1R7T A;  5DDV A;  4CVH A;  2BO7 A;  4HOC A;  1G95 A;  1G93 A;  5HS2 A;  1ZI1 A;  3I0J A;  3SPT A;  5C4F A;  5C4C A;  4ASY A;  2V0I A;  1VZT A;  1VGW A;  4Y6U A;  4KT7 A;  3SXD A;  4NAN A;  5C38 A;  2D7R A;  4B42 A;  5C8R A;  2APC A;  3D8V A;  4DEC A;  5IDS A;  4Y64 A;  4FRB A;  1QGS A;  2RJ7 A;  3IOJ A;  4G3P A;  2PA4 A;  1LL3 A;  3ZGG A;  3QVB A;  1GQ9 A;  4G3S A;  4MIX A;  2E3D A;  4XWI A;  2QGI A;  2P6W A;  1ZI5 A;  1YP2 A;  5JQQ A;  4BMA A;  2CU2 A;  3IOH A;  4Y7T A;  1HJJ A;  1GX4 A;  1H7L A;  1ZCU A;  5CMI A;  4AAW A;  1S4P A;  3U2W A;  2BO8 A;  4EVW A;  3CGX A;  4C2S A;  1R80 A;  2VSH A;  1G8O A;  1WT0 A;  2AH9 A;  2O1H A;  5J49 A;  4FRQ A;  1H7Q A;  1YP4 A;  2GGO A;  3OH4 A;  2V0H A;  5C1G A;  2I7B A;  4Y7V A;  3KIA A;  4FRO A;  4KQL A;  4FRL A;  1ZJP A;  1MC3 A;  1VGZ A;  4B4M A;  4Q7C A;  1FG5 N;  1NQI B;  2ZU9 A;  1OQM B;  1QWJ A;  5EJZ A;  4J18 A;  5CQP A;  4KPZ A;  4DDZ A;  2FY7 A;  1R7Y A;  4ASJ A;  2FFV A;  3T7N A;  4EE3 A;  1FRW A;  5I1F A;  4FRP A;  4B5B A;  1LZI A;  3OKR A;  3DUV A;  1HJL A;  3ZLK A;  2XWL A;  2XWN A;  1W77 A;  1NF5 B;  3F1C A;  3I0E A;  3N9W A;  4HO9 A;  1MP3 A;  2AGD A;  1JV1 A;  3SXE A;  1PZT A;  1ZJ3 A;  3RMW A;  1MP4 A;  3V8Z A;  2X5Z A;  1H5S C;  4B3U A;  1GWV A;  3ST8 A;  3DK5 A;  4EEG A;  2WVL A;  2X5S A;  1Z90 A;  2BO6 A;  2VK9 A;  2ZU7 A;  5FTS A;  3EE5 A;  1PZY B;  3U2V A;  1FO8 A;  4JIS A;  2PX7 A;  2YQS A;  2ZU8 A;  5D92 A;  3U2U A;  1G23 A;  2Y4L A;  1GA8 A;  4FQW A;  4M2A A;  5IFY A;  2Q4J A;  4Y9X A;  1V82 A;  3JUJ A;  3SX3 A;  1SS9 A;  1K4V A;  2E8B A;  4EEM A;  1JVD A;  1VH1 A;  1G3L A;  5CMF X;  2FYB A;  1S4O A;  4EEO A;  3SX8 A;  1IIM A;  2Y6P A;  5CMG X;  3K8D A;  4D0Z A;  2ICX A;  2MZB A;  1R82 A;  1TW5 A;  4FRM A;  1ZDG A;  1W55 A;  2FYA A;  2NXV A;  2X60 A;  3I0D A;  1W57 A;  2A8U A;  4LW3 A;  2XMH A;  3U2T A;  1R7U A;  3I0K A;  3V8Y A;  3T7O A;  4HCQ A;  3TZT A;  1OMX A;  1FXJ A;  1GX0 A;  3O3P A;  4CJC A;  5C4B A;  5AJO A;  3USQ A;  3E26 A;  1G2V A;  3HL3 A;  4DE7 A;  2AE7 A;  4IRQ A;  4K6R A;  2V0K A;  2AM4 A;  1MP5 A;  4CJ8 A;  3D98 A;  4KNX A;  5FUH A;  1LVW A;  3IOI A;  3I0L A;  2FFU A;  2QH5 A;  5CQO A;  3CKV A;  2Y7A A;  4ARW A;  1O7O A;  4BQH A;  1GQC A;  1LL2 A;  4KC2 A;  2RJ8 A;  3V90 A;  3GUE A;  1LZJ A;  2OI7 A;  1TZF A;  5C3A A;  5DDT A;  1TVY A;  1G97 A;  2DPW A;  3OH1 A;  2RJ1 A;  5FYE A;  4D0T A;  4HO0 A;  4FRA A;  2WEE A;  3PNN A;  1H5T A;  1HM0 A;  3D5N A;  3U0X A;  4NAK A;  1FGG A;  3F1Y A;  4FRH A;  1JV3 A;  1ZJ0 A;  3U2X A;  3PKQ A;  1JYK A;  4HO2 A;  1H4C A;  2RJ6 A;  2Y4J A;  5C4E A;  1XHB A;  1TW1 A;  3OGZ A;  1V83 A;  3V91 A;  5C3B A;  3R2W A;  1LZ7 A;  2RIY A;  1H7F A;  3RMV A;  2AEC A;  4FCE A;  5EJ1 A;  2WGZ A;  1ZJ1 A;  4AYL A;  3SX7 A;  2WVK A;  4M2B A;  1H4E A;  1ZJ2 A;  1JYL A;  3SXC A;  3I0G A;  1NWG B;  3V0M A;  1H5S D;  3NGW A;  4Y7G A;  2VXL A;  2FYC B;  1R81 A;  4MND A;  1KWS A;  4FIY A;  1FGX A;  3Q7U A;  1ZIZ A;  2RIZ A;  1WSZ A;  2YQH A;  2WE9 A;  2YQJ A;  3V0O A;  5BXC A;  4D11 C;  3BCV A;  4KPX A;  2YQC A;  3R3I A;  2BO4 A;  2RIX A;  4D48 A;  1ZCV A;  4P00 A;  1ZI3 A;  2GGQ A;  2VXM A;  1OMZ A;  2PGY A;  4B2W A;  4B4B A;  1FR8 A;  1NMM B;  2AES A;  2Y4M A;  2D7I A;  2XWM A;  1NHE B;  2VS3 A;  5C48 A;  1EZI A;  2WAW A;  3SXA A;  1VM8 A;  5L6S A;  3CKN A;  1WVC A;  2ICY A;  3Q4S A;  3POL A;  2QKX A;  4AC3 A;  5C3D A;  1VGT A;  1E5K A;  1O0R A;  2A8W A;  5FV9 A;  4B2X A;  4FRD A;  4KC4 A;  5CQN X;  5AJN A;  4NAI A;  4EE5 A;  2UX8 A;  5C47 A;  2VSI A;  1FXO A;  1H7G A;  1G1L A;  4FRE A;  1XZ6 A;  2XME A;  2OI6 A;  3T7M A;  2OEF A;  1YP3 A;  1H7E A;  4O6M A;  4Y63 A;  3USR A;  1FWY A;  3ZF8 A;  2I5E A;  1G0R A;  1WT3 A;  1H5S A;  1H5R A;  1H5T B;  4LW6 A;  2PGV A;  4M28 A;  4ZDQ A;  1ON6 A;  3CKJ A;  4KNR A;  2VS5 A;  1VZU A;  1ZJO A;  5FTV A;  1VIC A;  4O6N A;  2RJ4 A;  1QGQ A;  2OI5 A;  3ZGF A;  3TQD A;  4KXO A;  2O1F A;  2D0J A;  2JCO A;  2FYD B;  5FU0 A;  1R7X A;  5C4D A;  1INJ A;  5D91 A;  3OC9 A;  3U0Y A;  3OH3 A;  4IRP A;  4YS8 A;  1ZI4 A;  1NKH B;  1I52 A;  4MYB A;  2V0L A;  2W0V A;  5FU8 A;  2RJ0 A;  4Y6N A;  5CMJ A;  2O1G A;  1ZHJ A;  3OH2 A;  2P72 A;  5CQL X;  4EE4 A;  4AYJ A;  2YES A;  2V0J A;  4HO4 A; 
#chains in the Genus database with same CATH homology
 2W0W A;  4JD0 A;  1EYR A;  5C36 A;  1ZCY A;  3SX5 A;  1FR9 A;  3I0I X;  2Z87 A;  4HO5 A;  2VD4 A;  1FOA A;  3FWW A;  1INI A;  3ZLL A;  1HM9 A;  1QG8 A;  4FCU A;  4CJB A;  1ZDF A;  4HO3 A;  4EEA A;  2OEG A;  4R7P A;  1G9R A;  2VFZ A;  4ECM A;  2AM5 A;  3SXG A;  1GWW A;  4Y62 A;  3FOQ A;  3E25 A;  4NAL A;  1ZCT A;  1YRO B;  3K8E A;  4G3Q A;  1H7T A;  4GBP A;  3V0L A;  1HV9 A;  2I5K A;  2RJ5 A;  3DJ4 A;  1LZ0 A;  4Y7F A;  1IIN A;  2YC5 A;  3Q80 A;  3PKP A;  4FIX A;  3CKO A;  4L41 C;  1LL0 A;  1JVG A;  3BRK X;  3V0N A;  4HG6 A;  1WT1 A;  3V0Q A;  3OH0 A;  2Z86 A;  1FO9 A;  2YCM A;  1H5S B;  1H5R B;  2RIT A;  1ON8 A;  5EIY A;  2WVM A;  4Y7U A;  5C1H A;  1HM8 A;  2RJ9 A;  4UEG A;  1H7H A;  4KC1 A;  2JCJ A;  4HO6 A;  5CQM X;  2J0A A;  2JCK A;  5IDT A;  3RSB A;  2JCL A;  1R7V A;  4KRV A;  5C49 A;  3JTJ A;  1WT2 A;  4M4K A;  3CU0 A;  5C1L A;  1FZW A;  2X65 A;  2YC3 A;  3CKQ A;  1O23 B;  1O7Q A;  1VGU A;  3I0C A;  4HO8 A;  4P02 A;  3SXB A;  4E1K A;  1VPA A;  3I0H A;  1H4D A;  4D11 A;  1VZX A;  3V0P A;  1S4N A;  2AM3 A;  2P73 A;  5L6V A;  5CMH A;  1VH3 A;  3JUK A;  3I0F A;  5AJP A;  2Y4K A;  3LW6 A;  4B4G A;  3OAM A;  4G87 A;  1V84 A;  1H3M A;  2J0B A;  2C0N A;  2VS4 A;  1R7T A;  5DDV A;  4CVH A;  2BO7 A;  4HOC A;  1G95 A;  1G93 A;  5HS2 A;  1ZI1 A;  3I0J A;  3SPT A;  5C4F A;  5C4C A;  4ASY A;  2V0I A;  1VZT A;  1VGW A;  4Y6U A;  4KT7 A;  3SXD A;  4NAN A;  5C38 A;  2D7R A;  4B42 A;  5C8R A;  2APC A;  3D8V A;  4DEC A;  5IDS A;  4Y64 A;  4FRB A;  1QGS A;  2RJ7 A;  3IOJ A;  4G3P A;  2PA4 A;  1LL3 A;  3ZGG A;  3QVB A;  1GQ9 A;  4G3S A;  4MIX A;  2E3D A;  4XWI A;  2QGI A;  2P6W A;  1ZI5 A;  1YP2 A;  5JQQ A;  4BMA A;  2CU2 A;  3IOH A;  4Y7T A;  1HJJ A;  1GX4 A;  1H7L A;  1ZCU A;  5CMI A;  4AAW A;  1S4P A;  3U2W A;  2BO8 A;  4EVW A;  3CGX A;  4C2S A;  1R80 A;  2VSH A;  1G8O A;  1WT0 A;  2AH9 A;  2O1H A;  5J49 A;  4FRQ A;  1H7Q A;  1YP4 A;  2GGO A;  3OH4 A;  2V0H A;  5C1G A;  2I7B A;  4Y7V A;  3KIA A;  4FRO A;  4KQL A;  4FRL A;  1ZJP A;  1MC3 A;  1VGZ A;  4B4M A;  4Q7C A;  1FG5 N;  1NQI B;  2ZU9 A;  1OQM B;  1QWJ A;  5EJZ A;  4J18 A;  5CQP A;  4KPZ A;  4DDZ A;  2FY7 A;  1R7Y A;  4ASJ A;  2FFV A;  3T7N A;  4EE3 A;  1FRW A;  5I1F A;  4FRP A;  4B5B A;  1LZI A;  3OKR A;  3DUV A;  1HJL A;  3ZLK A;  2XWL A;  2XWN A;  1W77 A;  1NF5 B;  3F1C A;  3I0E A;  3N9W A;  4HO9 A;  1MP3 A;  2AGD A;  1JV1 A;  3SXE A;  1PZT A;  1ZJ3 A;  3RMW A;  1MP4 A;  3V8Z A;  2X5Z A;  1H5S C;  4B3U A;  1GWV A;  3ST8 A;  3DK5 A;  4EEG A;  2WVL A;  2X5S A;  1Z90 A;  2BO6 A;  2VK9 A;  2ZU7 A;  5FTS A;  3EE5 A;  1PZY B;  3U2V A;  1FO8 A;  4JIS A;  2PX7 A;  2YQS A;  2ZU8 A;  5D92 A;  3U2U A;  1G23 A;  2Y4L A;  1GA8 A;  4FQW A;  4M2A A;  5IFY A;  2Q4J A;  4Y9X A;  1V82 A;  3JUJ A;  3SX3 A;  1SS9 A;  1K4V A;  2E8B A;  4EEM A;  1JVD A;  1VH1 A;  1G3L A;  5CMF X;  2FYB A;  1S4O A;  4EEO A;  3SX8 A;  1IIM A;  2Y6P A;  5CMG X;  3K8D A;  4D0Z A;  2ICX A;  2MZB A;  1R82 A;  1TW5 A;  4FRM A;  1ZDG A;  1W55 A;  2FYA A;  2NXV A;  2X60 A;  3I0D A;  1W57 A;  2A8U A;  4LW3 A;  2XMH A;  3U2T A;  1R7U A;  3I0K A;  3V8Y A;  3T7O A;  4HCQ A;  3TZT A;  1OMX A;  1FXJ A;  1GX0 A;  3O3P A;  4CJC A;  5C4B A;  5AJO A;  3USQ A;  3E26 A;  1G2V A;  3HL3 A;  4DE7 A;  2AE7 A;  4IRQ A;  4K6R A;  2V0K A;  2AM4 A;  1MP5 A;  4CJ8 A;  3D98 A;  4KNX A;  5FUH A;  1LVW A;  3IOI A;  3I0L A;  2FFU A;  2QH5 A;  5CQO A;  3CKV A;  2Y7A A;  4ARW A;  1O7O A;  4BQH A;  1GQC A;  1LL2 A;  4KC2 A;  2RJ8 A;  3V90 A;  3GUE A;  1LZJ A;  2OI7 A;  1TZF A;  5C3A A;  5DDT A;  1TVY A;  1G97 A;  2DPW A;  3OH1 A;  2RJ1 A;  5FYE A;  4D0T A;  4HO0 A;  4FRA A;  2WEE A;  3PNN A;  1H5T A;  1HM0 A;  3D5N A;  3U0X A;  4NAK A;  1FGG A;  3F1Y A;  4FRH A;  1JV3 A;  1ZJ0 A;  3U2X A;  3PKQ A;  1JYK A;  4HO2 A;  1H4C A;  2RJ6 A;  2Y4J A;  5C4E A;  1XHB A;  1TW1 A;  3OGZ A;  1V83 A;  3V91 A;  5C3B A;  3R2W A;  1LZ7 A;  2RIY A;  1H7F A;  3RMV A;  2AEC A;  4FCE A;  5EJ1 A;  2WGZ A;  1ZJ1 A;  4AYL A;  3SX7 A;  2WVK A;  4M2B A;  1H4E A;  1ZJ2 A;  1JYL A;  3SXC A;  3I0G A;  1NWG B;  3V0M A;  1H5S D;  3NGW A;  4Y7G A;  2VXL A;  2FYC B;  1R81 A;  4MND A;  1KWS A;  4FIY A;  1FGX A;  3Q7U A;  1ZIZ A;  2RIZ A;  1WSZ A;  2YQH A;  2WE9 A;  2YQJ A;  3V0O A;  5BXC A;  4D11 C;  3BCV A;  4KPX A;  2YQC A;  3R3I A;  2BO4 A;  2RIX A;  4D48 A;  1ZCV A;  4P00 A;  1ZI3 A;  2GGQ A;  2VXM A;  1OMZ A;  2PGY A;  4B2W A;  4B4B A;  1FR8 A;  1NMM B;  2AES A;  2Y4M A;  2D7I A;  2XWM A;  1NHE B;  2VS3 A;  5C48 A;  1EZI A;  2WAW A;  3SXA A;  1VM8 A;  5L6S A;  3CKN A;  1WVC A;  2ICY A;  3Q4S A;  3POL A;  2QKX A;  4AC3 A;  5C3D A;  1VGT A;  1E5K A;  1O0R A;  2A8W A;  5FV9 A;  4B2X A;  4FRD A;  4KC4 A;  5CQN X;  5AJN A;  4NAI A;  4EE5 A;  2UX8 A;  5C47 A;  2VSI A;  1FXO A;  1H7G A;  1G1L A;  4FRE A;  1XZ6 A;  2XME A;  2OI6 A;  3T7M A;  2OEF A;  1YP3 A;  1H7E A;  4O6M A;  4Y63 A;  3USR A;  1FWY A;  3ZF8 A;  2I5E A;  1G0R A;  1WT3 A;  1H5S A;  1H5R A;  1H5T B;  4LW6 A;  2PGV A;  4M28 A;  4ZDQ A;  1ON6 A;  3CKJ A;  4KNR A;  2VS5 A;  1VZU A;  1ZJO A;  5FTV A;  1VIC A;  4O6N A;  2RJ4 A;  1QGQ A;  2OI5 A;  3ZGF A;  3TQD A;  4KXO A;  2O1F A;  2D0J A;  2JCO A;  2FYD B;  5FU0 A;  1R7X A;  5C4D A;  1INJ A;  5D91 A;  3OC9 A;  3U0Y A;  3OH3 A;  4IRP A;  4YS8 A;  1ZI4 A;  1NKH B;  1I52 A;  4MYB A;  2V0L A;  2W0V A;  5FU8 A;  2RJ0 A;  4Y6N A;  5CMJ A;  2O1G A;  1ZHJ A;  3OH2 A;  2P72 A;  5CQL X;  4EE4 A;  4AYJ A;  2YES A;  2V0J A;  4HO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...