1ON8A

Crystal structure of mouse alpha-1,4-n-acetylhexosaminyltransferase (extl2) with udp and glcuab(1-3)galb(1-o)-naphthalenelmethanol an acceptor substrate analog
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
265
structure length
265
Chain Sequence
ALDSFTLIMQTYNRTDLLLRLLNHYQAVPSLHKVIVVWNNVGEKGPEELWNSLGPHPIPVIFKPQTANKMRNRLQVFPEVETNAVLMVDDDTLISAQDLVFAFSIWQQFPDQIIGFVPRKHVSTSSGIYSYGGFELQTPGPGNGDQYSMVLIGASFFNSKYLELFQKQPAAVHALIDETQNCDDIAMNFLVTRHTGKPSGIFVKPINMVNLEKETNGYSGMWHRAEHFLQRSYCINKLVNIYDGMPLKYSNIMISQFGFPYANHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Alpha-1,4-N-acetylhexosaminyltransferase EXTL2
publication title Crystal structure of an alpha-1,4-N-acetylhexosaminyltransferase (EXTL2), a member of the exostosin gene family involved in heparan sulfate biosynthesis
pubmed doi rcsb
source organism Mus musculus
total genus 89
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 2.4.1.223: Glucuronosyl-galactosyl-proteoglycan 4-alpha-N-
pdb deposition date 2003-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09258 Glyco_transf_64 Glycosyl transferase family 64 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1on8A00
2VSHA 1VZXA 5C3DA 2V0HA 2RJ5A 3PNNA 3JTJA 3K8DA 4LW6A 5FU0A 3JUJA 3IOJA 2BO8A 4KC2A 3OGZA 5C38A 4FRQA 5C4CA 5BXCA 2AH9A 4BMAA 4ZDQA 3V0OA 2WEEA 1ZI3A 1WT3A 2RIZA 3GUEA 5CMJA 2ZU8A 4EE5A 4ARWA 1VM8A 2FFUA 1G1LA 3DUVA 2X5SA 2X65A 3HL3A 3V0NA 2QKXA 3PKPA 4EE3A 2WVKA 3V0LA 3FOQA 2YQSA 4FCEA 4HO6A 4P00A 1VGWA 4NANA 5L6SA 1FO8A 5L6VA 1HM9A 2CU2A 4EEMA 1H7LA 4ASJA 2Y4JA 1G3LA 4FRPA 1R81A 2YQCA 3DJ4A 2BO6A 3F1CA 4UEGA 5JQQA 3QVBA 1FGGA 1ON6A 1O7OA 2YQJA 2RJ7A 4D11A 4Y9XA 2AM5A 1ZDFA 2O1HA 2PA4A 1ZJ2A 4B42A 3POLA 1FR9A 5CMIA 1MP4A 5CQMX 1HJLA 3OH4A 3K8EA 1S4NA 4JISA 1H7HA 1G9RA 1YP2A 5FU8A 1TZFA 2Q4JA 4AAWA 5EJ1A 1MC3A 2Y6PA 1VGUA 3D98A 3TQDA 4B3UA 5C49A 4G3PA 4AYJA 2YCMA 1FO9A 1Z90A 2A8UA 1H4CA 3V8ZA 2FYBA 1EYRA 1ZCTA 2P6WA 4KRVA 2VD4A 3E26A 1MP5A 2ICXA 2I5EA 2Y7AA 3FWWA 1LZ0A 2YESA 2OI5A 2BO4A 1YP3A 3OC9A 1S4OA 2RJ9A 1O0RA 4KPZA 4EEGA 3SX7A 3Q4SA 4FRBA 3I0CA 3T7OA 4B4BA 3Q7UA 1LZ7A 3IOIA 2E8BA 2YC3A 3ZLLA 1MP3A 1IIMA 1G23A 5AJNA 1HM0A 1EZIA 1H5SD 3SXCA 4HO3A 3USQA 4Y64A 4KPXA 2RIYA 1TW5A 5CQOA 1V83A 5C1LA 1JYLA 2XWMA 4KXOA 4KNXA 3I0EA 1JV3A 1OQMB 1ZCUA 3CKQA 1GA8A 2O1FA 4B5BA 2V0IA 4NALA 2Z86A 2P73A 4ASYA 5C3BA 2YC5A 2PGYA 2A8WA 3F1YA 4D11C 4FRMA 4Y63A 1H7GA 2P72A 4HO8A 1FGXA 1K4VA 5CQNX 1VICA 3RMWA 4HO0A 4Y7GA 4B4MA 5I1FA 2XMHA 1JVGA 1NQIB 4IRPA 4YS8A 1JV1A 1ZJPA 5C4EA 5C36A 2YQHA 1VH1A 2DPWA 3OAMA 1WT1A 5CQLX 1VPAA 4C2SA 2WAWA 1H5SA 2V0KA 1IINA 4Y7TA 1ZCYA 4KC1A 2PX7A 2OI7A 1ZJ3A 3ZLKA 1LL0A 2AE7A 2OEFA 1ZIZA 2VXMA 1LVWA 1V82A 1H7FA 4LW3A 5C4DA 1FR8A 3OKRA 1H3MA 2RJ1A 3ZF8A 1JVDA 3V91A 1ZI1A 2RJ8A 3BCVA 2JCOA 1ZJ0A 3U2VA 1G2VA 3V8YA 2VS5A 4CJCA 4Y6UA 2W0VA 1WT2A 1HM8A 1H5TA 1WSZA 2VXLA 1ZJ1A 1O23B 2VS4A 1H5SB 1H4EA 3U0YA 3I0GA 3EE5A 1VH3A 3OH1A 4D48A 4B2XA 3SXGA 4NAIA 1FOAA 1H4DA 2FYDB 4EEOA 2OEGA 3E25A 1QG8A 1GWWA 2Y4KA 3I0DA 5C8RA 4EEAA 3ZGGA 4KNRA 3RSBA 3OH2A 3SXAA 3ZGFA 1HJJA 2FYAA 4FRAA 5AJPA 4KT7A 5AJOA 3T7MA 4DE7A 4R7PA 4G87A 2PGVA 4G3QA 2AECA 1JYKA 1PZTA 1FG5N 1HV9A 1H5TB 2FY7A 1OMXA 2AGDA 1S4PA 1R82A 3SX8A 2JCLA 1VGZA 4AC3A 3V0PA 2V0JA 1FRWA 1H5SC 3CKNA 2I5KA 2ZU7A 4Y7FA 3LW6A 2BO7A 4D0TA 5C3AA 3CKJA 3N9WA 5EIYA 4HO5A 2JCKA 5C48A 3I0KA 3TZTA 1ON8A 2RJ6A 4HO4A 4D0ZA 5EJZA 3OH0A 3SPTA 2X5ZA 2RITA 1LL2A 1W57A 3V0QA 4J18A 1YROB 2RIXA 1LZIA 4MNDA 2D7IA 4FCUA 2E3DA 1O7QA 4MYBA 1INIA 3T7NA 1YP4A 1OMZA 3U2UA 1GWVA 2FYCB 1V84A 2VFZA 4L41C 4EVWA 1R7TA 1W55A 5DDVA 3U2WA 2MZBA 3D5NA 1R7YA 4HO9A 5J49A 1R7XA 3R2WA 1QGSA 1E5KA 1ZHJA 4K6RA 4IRQA 3NGWA 2QGIA 1SS9A 4Y7UA 3CU0A 1G95A 3U0XA 3RMVA 4Y6NA 1NMMB 3SX5A 1I52A 4Y62A 5CMFX 4FQWA 3I0HA 4Y7VA 1R7UA 3Q80A 4M2AA 2AM3A 1FXOA 4GBPA 1GQ9A 4B2WA 1NKHB 5C4FA 3U2TA 3R3IA 2FFVA 3USRA 5HS2A 1ZDGA 5C1HA 2GGQA 3V90A 4NAKA 2QH5A 1FZWA 3IOHA 2WE9A 4M28A 3SXDA 1H7EA 4M4KA 1TVYA 1ZI5A 2D0JA 2OI6A 3CKOA 4BQHA 5IFYA 1H5RA 4XWIA 1WVCA 2Y4LA 2JCJA 5IDSA 1H7TA 3PKQA 4B4GA 4CJBA 5FV9A 5C1GA 4EE4A 1GQCA 1VZUA 1G0RA 1QGQA 4DDZA 2I7BA 3CGXA 4P02A 5CMGX 3SXEA 3SX3A 3DK5A 2WVMA 2XWNA 1G97A 3I0FA 3JUKA 2O1GA 2WVLA 1VZTA 1FWYA 2RJ4A 1FXJA 1H5RB 3KIAA 2XWLA 1XHBA 4ECMA 5FTVA 1ZI4A 4DECA 1VGTA 3V0MA 4KC4A 5C47A 2APCA 4HO2A 5CQPA 1G8OA 3SXBA 5C4BA 1PZYB 2XMEA 1GX4A 1NWGB 1G93A 3D8VA 1GX0A 2RJ0A 2W0WA 2UX8A 1NHEB 1ZJOA 2ZU9A 4M2BA 5FYEA 3I0JA 1QWJA 1ZCVA 2AESA 4FROA 2Y4MA 1XZ6A 4G3SA 1INJA 3I0LA 5DDTA 2VSIA 4CVHA 2AM4A 1KWSA 2NXVA 2ICYA 3I0IX 2WGZA 3BRKX 5CMHA 4E1KA 3U2XA 1WT0A 1R7VA 4HOCA 3ST8A 2GGOA 5FTSA 1TW1A 3O3PA 3CKVA 4HCQA 5FUHA 4FRDA 4CJ8A 4FRHA 4KQLA 4AYLA 2VS3A 4FRLA 2V0LA 4HG6A 1H7QA 1R80A 1LZJA 3OH3A 4FREA 2D7RA 2Z87A 1NF5B 5IDTA 1W77A 2X60A 4JD0A 1LL3A
chains in the Genus database with same CATH superfamily
2VSHA 1VZXA 5C3DA 2V0HA 2RJ5A 3PNNA 3JTJA 3K8DA 4LW6A 5FU0A 4O6NA 3JUJA 3IOJA 2BO8A 4KC2A 3OGZA 5C38A 4FRQA 5C4CA 5BXCA 2AH9A 4BMAA 4ZDQA 3V0OA 2WEEA 1ZI3A 1WT3A 2RIZA 3GUEA 5CMJA 2ZU8A 4EE5A 4ARWA 1VM8A 2FFUA 1G1LA 3DUVA 2X5SA 2X65A 3HL3A 3V0NA 2QKXA 3PKPA 4EE3A 2C0NA 2WVKA 3V0LA 3FOQA 2YQSA 4FCEA 4HO6A 4P00A 1VGWA 4NANA 5L6SA 1FO8A 5L6VA 1HM9A 2CU2A 4EEMA 1H7LA 4ASJA 2Y4JA 1G3LA 4FRPA 1R81A 2YQCA 3DJ4A 2BO6A 3F1CA 4UEGA 5JQQA 3QVBA 1FGGA 1ON6A 1O7OA 2YQJA 2RJ7A 4D11A 4Y9XA 5D91A 2AM5A 1ZDFA 2O1HA 2PA4A 1ZJ2A 4B42A 3POLA 1FR9A 5CMIA 1MP4A 5CQMX 1HJLA 3OH4A 3K8EA 1S4NA 4JISA 1H7HA 1G9RA 1YP2A 5FU8A 1TZFA 2Q4JA 4AAWA 5EJ1A 1MC3A 2Y6PA 1VGUA 3D98A 3TQDA 4B3UA 5C49A 4G3PA 4AYJA 2YCMA 1FO9A 1Z90A 2A8UA 1H4CA 3V8ZA 2FYBA 1EYRA 1ZCTA 2P6WA 4KRVA 2VD4A 3E26A 1MP5A 2ICXA 2I5EA 2Y7AA 3FWWA 1LZ0A 2YESA 2OI5A 2BO4A 1YP3A 3OC9A 1S4OA 2RJ9A 1O0RA 4KPZA 4EEGA 3SX7A 3Q4SA 4FRBA 3I0CA 3T7OA 4B4BA 3Q7UA 1LZ7A 3IOIA 2E8BA 2YC3A 3ZLLA 2J0AA 1MP3A 1IIMA 1G23A 5AJNA 1HM0A 1EZIA 1H5SD 3SXCA 4HO3A 3USQA 4Y64A 4KPXA 2RIYA 1TW5A 5CQOA 1V83A 5C1LA 1JYLA 2XWMA 4KXOA 4KNXA 3I0EA 1JV3A 1OQMB 1ZCUA 3CKQA 1GA8A 2O1FA 4B5BA 2V0IA 4NALA 2Z86A 2P73A 4ASYA 5C3BA 2YC5A 2PGYA 2A8WA 3F1YA 4FIXA 4D11C 4FRMA 4Y63A 1H7GA 2P72A 4HO8A 1FGXA 1K4VA 5CQNX 1VICA 3RMWA 4HO0A 4Y7GA 4B4MA 5I1FA 2XMHA 1JVGA 1NQIB 4IRPA 4YS8A 1JV1A 1ZJPA 5C4EA 5C36A 2YQHA 1VH1A 2DPWA 3OAMA 1WT1A 5CQLX 1VPAA 2VK9A 4C2SA 2WAWA 1H5SA 2V0KA 1IINA 4Y7TA 1ZCYA 4KC1A 2PX7A 2OI7A 1ZJ3A 3ZLKA 1LL0A 2AE7A 2OEFA 1ZIZA 2VXMA 1LVWA 1V82A 1H7FA 4LW3A 5C4DA 1FR8A 3OKRA 1H3MA 2RJ1A 4MIXA 3ZF8A 1JVDA 3V91A 1ZI1A 2RJ8A 3BCVA 2JCOA 1ZJ0A 3U2VA 1G2VA 3V8YA 2VS5A 4CJCA 4Y6UA 2W0VA 1WT2A 1HM8A 1H5TA 1WSZA 2VXLA 1ZJ1A 1O23B 2VS4A 1H5SB 1H4EA 3U0YA 3I0GA 3EE5A 1VH3A 3OH1A 4D48A 4B2XA 3SXGA 4NAIA 1FOAA 1H4DA 2FYDB 4EEOA 2OEGA 3E25A 1QG8A 1GWWA 2Y4KA 3I0DA 5C8RA 4EEAA 3ZGGA 4KNRA 3RSBA 3OH2A 3SXAA 3ZGFA 1HJJA 2FYAA 4FRAA 5AJPA 4KT7A 4O6MA 5AJOA 3T7MA 4DE7A 4R7PA 4G87A 2PGVA 4G3QA 2AECA 1JYKA 1PZTA 1FG5N 1HV9A 1H5TB 2FY7A 1OMXA 2AGDA 1S4PA 1R82A 3SX8A 2JCLA 1VGZA 4AC3A 3V0PA 2V0JA 1FRWA 1H5SC 3CKNA 2I5KA 2ZU7A 4Y7FA 3LW6A 2BO7A 4D0TA 5C3AA 3CKJA 3N9WA 5EIYA 4HO5A 2JCKA 5C48A 3I0KA 3TZTA 1ON8A 2RJ6A 4HO4A 4D0ZA 2J0BA 5EJZA 3OH0A 3SPTA 2X5ZA 2RITA 1LL2A 1W57A 3V0QA 4J18A 1YROB 2RIXA 1LZIA 4MNDA 2D7IA 4FCUA 2E3DA 1O7QA 4MYBA 1INIA 3T7NA 1YP4A 1OMZA 3U2UA 1GWVA 2FYCB 1V84A 2VFZA 4L41C 4EVWA 1R7TA 1W55A 5DDVA 3U2WA 2MZBA 3D5NA 1R7YA 4HO9A 5J49A 1R7XA 3R2WA 1QGSA 1E5KA 1ZHJA 4K6RA 4IRQA 3NGWA 2QGIA 1SS9A 4Y7UA 3CU0A 5D92A 1G95A 3U0XA 3RMVA 4Y6NA 1NMMB 3SX5A 1I52A 4Y62A 5CMFX 4FQWA 3I0HA 4Q7CA 4Y7VA 1R7UA 3Q80A 4M2AA 2AM3A 1FXOA 4GBPA 1GQ9A 4B2WA 1NKHB 5C4FA 3U2TA 3R3IA 2FFVA 3USRA 5HS2A 1ZDGA 5C1HA 2GGQA 3V90A 4NAKA 2QH5A 1FZWA 3IOHA 2WE9A 4M28A 3SXDA 1H7EA 4M4KA 1TVYA 1ZI5A 2D0JA 2OI6A 3CKOA 4BQHA 5IFYA 1H5RA 4XWIA 1WVCA 2Y4LA 2JCJA 5IDSA 1H7TA 3PKQA 4B4GA 4CJBA 5FV9A 5C1GA 4EE4A 1GQCA 1VZUA 1G0RA 1QGQA 4DDZA 2I7BA 3CGXA 4P02A 5CMGX 3SXEA 3SX3A 3DK5A 2WVMA 2XWNA 1G97A 3I0FA 3JUKA 2O1GA 2WVLA 1VZTA 1FWYA 2RJ4A 1FXJA 1H5RB 3KIAA 2XWLA 1XHBA 4ECMA 5FTVA 1ZI4A 4DECA 1VGTA 3V0MA 4KC4A 5C47A 2APCA 4HO2A 5CQPA 1G8OA 3SXBA 5C4BA 1PZYB 2XMEA 1GX4A 1NWGB 1G93A 3D8VA 1GX0A 2RJ0A 2W0WA 2UX8A 1NHEB 1ZJOA 2ZU9A 4M2BA 5FYEA 3I0JA 1QWJA 1ZCVA 2AESA 4FROA 2Y4MA 1XZ6A 4FIYA 4G3SA 1INJA 3I0LA 5DDTA 2VSIA 4CVHA 2AM4A 1KWSA 2NXVA 2ICYA 3I0IX 2WGZA 3BRKX 5CMHA 4E1KA 3U2XA 1WT0A 1R7VA 4HOCA 3ST8A 2GGOA 5FTSA 1TW1A 3O3PA 3CKVA 4HCQA 5FUHA 4FRDA 4CJ8A 4FRHA 4KQLA 4AYLA 2VS3A 4FRLA 2V0LA 4HG6A 1H7QA 1R80A 1LZJA 3OH3A 4FREA 2D7RA 2Z87A 1NF5B 5IDTA 1W77A 2X60A 4JD0A 1LL3A
chains in the Genus database with same CATH topology
2VSHA 1VZXA 5C3DA 2V0HA 2RJ5A 3PNNA 3JTJA 3K8DA 4LW6A 5FU0A 4O6NA 3JUJA 3IOJA 2BO8A 4KC2A 3OGZA 5C38A 4FRQA 5C4CA 5BXCA 2AH9A 4BMAA 4ZDQA 3V0OA 2WEEA 1ZI3A 1WT3A 2RIZA 3GUEA 5CMJA 2ZU8A 4EE5A 4ARWA 1VM8A 2FFUA 1G1LA 3DUVA 2X5SA 2X65A 3HL3A 3V0NA 2QKXA 3PKPA 4EE3A 2C0NA 2WVKA 3V0LA 3FOQA 2YQSA 4FCEA 4HO6A 4P00A 1VGWA 4NANA 5L6SA 1FO8A 5L6VA 1HM9A 2CU2A 4EEMA 1H7LA 4ASJA 2Y4JA 1G3LA 4FRPA 1R81A 2YQCA 3DJ4A 2BO6A 3F1CA 4UEGA 5JQQA 3QVBA 1FGGA 1ON6A 1O7OA 2YQJA 2RJ7A 4D11A 4Y9XA 5D91A 2AM5A 1ZDFA 2O1HA 2PA4A 1ZJ2A 4B42A 3POLA 1FR9A 5CMIA 1MP4A 5CQMX 1HJLA 3OH4A 3K8EA 1S4NA 4JISA 1H7HA 1G9RA 1YP2A 5FU8A 1TZFA 2Q4JA 4AAWA 5EJ1A 1MC3A 2Y6PA 1VGUA 3D98A 3TQDA 4B3UA 5C49A 4G3PA 4AYJA 2YCMA 1FO9A 1Z90A 2A8UA 1H4CA 3V8ZA 2FYBA 1EYRA 1ZCTA 2P6WA 4KRVA 2VD4A 3E26A 1MP5A 2ICXA 2I5EA 2Y7AA 3FWWA 1LZ0A 2YESA 2OI5A 2BO4A 1YP3A 3OC9A 1S4OA 2RJ9A 1O0RA 4KPZA 4EEGA 3SX7A 3Q4SA 4FRBA 3I0CA 3T7OA 4B4BA 3Q7UA 1LZ7A 3IOIA 2E8BA 2YC3A 3ZLLA 2J0AA 1MP3A 1IIMA 1G23A 5AJNA 1HM0A 1EZIA 1H5SD 3SXCA 4HO3A 3USQA 4Y64A 4KPXA 2RIYA 1TW5A 5CQOA 1V83A 5C1LA 1JYLA 2XWMA 4KXOA 4KNXA 3I0EA 1JV3A 1OQMB 1ZCUA 3CKQA 1GA8A 2O1FA 4B5BA 2V0IA 4NALA 2Z86A 2P73A 4ASYA 5C3BA 2YC5A 2PGYA 2A8WA 3F1YA 4FIXA 4D11C 4FRMA 4Y63A 1H7GA 2P72A 4HO8A 1FGXA 1K4VA 5CQNX 1VICA 3RMWA 4HO0A 4Y7GA 4B4MA 5I1FA 2XMHA 1JVGA 1NQIB 4IRPA 4YS8A 1JV1A 1ZJPA 5C4EA 5C36A 2YQHA 1VH1A 2DPWA 3OAMA 1WT1A 5CQLX 1VPAA 2VK9A 4C2SA 2WAWA 1H5SA 2V0KA 1IINA 4Y7TA 1ZCYA 4KC1A 2PX7A 2OI7A 1ZJ3A 3ZLKA 1LL0A 2AE7A 2OEFA 1ZIZA 2VXMA 1LVWA 1V82A 1H7FA 4LW3A 5C4DA 1FR8A 3OKRA 1H3MA 2RJ1A 4MIXA 3ZF8A 1JVDA 3V91A 1ZI1A 2RJ8A 3BCVA 2JCOA 1ZJ0A 3U2VA 1G2VA 3V8YA 2VS5A 4CJCA 4Y6UA 2W0VA 1WT2A 1HM8A 1H5TA 1WSZA 2VXLA 1ZJ1A 1O23B 2VS4A 1H5SB 1H4EA 3U0YA 3I0GA 3EE5A 1VH3A 3OH1A 4D48A 4B2XA 3SXGA 4NAIA 1FOAA 1H4DA 2FYDB 4EEOA 2OEGA 3E25A 1QG8A 1GWWA 2Y4KA 3I0DA 5C8RA 4EEAA 3ZGGA 4KNRA 3RSBA 3OH2A 3SXAA 3ZGFA 1HJJA 2FYAA 4FRAA 5AJPA 4KT7A 4O6MA 5AJOA 3T7MA 4DE7A 4R7PA 4G87A 2PGVA 4G3QA 2AECA 1JYKA 1PZTA 1FG5N 1HV9A 1H5TB 2FY7A 1OMXA 2AGDA 1S4PA 1R82A 3SX8A 2JCLA 1VGZA 4AC3A 3V0PA 2V0JA 1FRWA 1H5SC 3CKNA 2I5KA 2ZU7A 4Y7FA 3LW6A 2BO7A 4D0TA 5C3AA 3CKJA 3N9WA 5EIYA 4HO5A 2JCKA 5C48A 3I0KA 3TZTA 1ON8A 2RJ6A 4HO4A 4D0ZA 2J0BA 5EJZA 3OH0A 3SPTA 2X5ZA 2RITA 1LL2A 1W57A 3V0QA 4J18A 1YROB 2RIXA 1LZIA 4MNDA 2D7IA 4FCUA 2E3DA 1O7QA 4MYBA 1INIA 3T7NA 1YP4A 1OMZA 3U2UA 1GWVA 2FYCB 1V84A 2VFZA 4L41C 4EVWA 1R7TA 1W55A 5DDVA 3U2WA 2MZBA 3D5NA 1R7YA 4HO9A 5J49A 1R7XA 3R2WA 1QGSA 1E5KA 1ZHJA 4K6RA 4IRQA 3NGWA 2QGIA 1SS9A 4Y7UA 3CU0A 5D92A 1G95A 3U0XA 3RMVA 4Y6NA 1NMMB 3SX5A 1I52A 4Y62A 5CMFX 4FQWA 3I0HA 4Q7CA 4Y7VA 1R7UA 3Q80A 4M2AA 2AM3A 1FXOA 4GBPA 1GQ9A 4B2WA 1NKHB 5C4FA 3U2TA 3R3IA 2FFVA 3USRA 5HS2A 1ZDGA 5C1HA 2GGQA 3V90A 4NAKA 2QH5A 1FZWA 3IOHA 2WE9A 4M28A 3SXDA 1H7EA 4M4KA 1TVYA 1ZI5A 2D0JA 2OI6A 3CKOA 4BQHA 5IFYA 1H5RA 4XWIA 1WVCA 2Y4LA 2JCJA 5IDSA 1H7TA 3PKQA 4B4GA 4CJBA 5FV9A 5C1GA 4EE4A 1GQCA 1VZUA 1G0RA 1QGQA 4DDZA 2I7BA 3CGXA 4P02A 5CMGX 3SXEA 3SX3A 3DK5A 2WVMA 2XWNA 1G97A 3I0FA 3JUKA 2O1GA 2WVLA 1VZTA 1FWYA 2RJ4A 1FXJA 1H5RB 3KIAA 2XWLA 1XHBA 4ECMA 5FTVA 1ZI4A 4DECA 1VGTA 3V0MA 4KC4A 5C47A 2APCA 4HO2A 5CQPA 1G8OA 3SXBA 5C4BA 1PZYB 2XMEA 1GX4A 1NWGB 1G93A 3D8VA 1GX0A 2RJ0A 2W0WA 2UX8A 1NHEB 1ZJOA 2ZU9A 4M2BA 5FYEA 3I0JA 1QWJA 1ZCVA 2AESA 4FROA 2Y4MA 1XZ6A 4FIYA 4G3SA 1INJA 3I0LA 5DDTA 2VSIA 4CVHA 2AM4A 1KWSA 2NXVA 2ICYA 3I0IX 2WGZA 3BRKX 5CMHA 4E1KA 3U2XA 1WT0A 1R7VA 4HOCA 3ST8A 2GGOA 5FTSA 1TW1A 3O3PA 3CKVA 4HCQA 5FUHA 4FRDA 4CJ8A 4FRHA 4KQLA 4AYLA 2VS3A 4FRLA 2V0LA 4HG6A 1H7QA 1R80A 1LZJA 3OH3A 4FREA 2D7RA 2Z87A 1NF5B 5IDTA 1W77A 2X60A 4JD0A 1LL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VSH A;  1VZX A;  5C3D A;  2V0H A;  2RJ5 A;  3PNN A;  3JTJ A;  3K8D A;  4LW6 A;  5FU0 A;  3JUJ A;  3IOJ A;  2BO8 A;  4KC2 A;  3OGZ A;  5C38 A;  4FRQ A;  5C4C A;  5BXC A;  2AH9 A;  4BMA A;  4ZDQ A;  3V0O A;  2WEE A;  1ZI3 A;  1WT3 A;  2RIZ A;  3GUE A;  5CMJ A;  2ZU8 A;  4EE5 A;  4ARW A;  1VM8 A;  2FFU A;  1G1L A;  3DUV A;  2X5S A;  2X65 A;  3HL3 A;  3V0N A;  2QKX A;  3PKP A;  4EE3 A;  2WVK A;  3V0L A;  3FOQ A;  2YQS A;  4FCE A;  4HO6 A;  4P00 A;  1VGW A;  4NAN A;  5L6S A;  1FO8 A;  5L6V A;  1HM9 A;  2CU2 A;  4EEM A;  1H7L A;  4ASJ A;  2Y4J A;  1G3L A;  4FRP A;  1R81 A;  2YQC A;  3DJ4 A;  2BO6 A;  3F1C A;  4UEG A;  5JQQ A;  3QVB A;  1FGG A;  1ON6 A;  1O7O A;  2YQJ A;  2RJ7 A;  4D11 A;  4Y9X A;  2AM5 A;  1ZDF A;  2O1H A;  2PA4 A;  1ZJ2 A;  4B42 A;  3POL A;  1FR9 A;  5CMI A;  1MP4 A;  5CQM X;  1HJL A;  3OH4 A;  3K8E A;  1S4N A;  4JIS A;  1H7H A;  1G9R A;  1YP2 A;  5FU8 A;  1TZF A;  2Q4J A;  4AAW A;  5EJ1 A;  1MC3 A;  2Y6P A;  1VGU A;  3D98 A;  3TQD A;  4B3U A;  5C49 A;  4G3P A;  4AYJ A;  2YCM A;  1FO9 A;  1Z90 A;  2A8U A;  1H4C A;  3V8Z A;  2FYB A;  1EYR A;  1ZCT A;  2P6W A;  4KRV A;  2VD4 A;  3E26 A;  1MP5 A;  2ICX A;  2I5E A;  2Y7A A;  3FWW A;  1LZ0 A;  2YES A;  2OI5 A;  2BO4 A;  1YP3 A;  3OC9 A;  1S4O A;  2RJ9 A;  1O0R A;  4KPZ A;  4EEG A;  3SX7 A;  3Q4S A;  4FRB A;  3I0C A;  3T7O A;  4B4B A;  3Q7U A;  1LZ7 A;  3IOI A;  2E8B A;  2YC3 A;  3ZLL A;  1MP3 A;  1IIM A;  1G23 A;  5AJN A;  1HM0 A;  1EZI A;  1H5S D;  3SXC A;  4HO3 A;  3USQ A;  4Y64 A;  4KPX A;  2RIY A;  1TW5 A;  5CQO A;  1V83 A;  5C1L A;  1JYL A;  2XWM A;  4KXO A;  4KNX A;  3I0E A;  1JV3 A;  1OQM B;  1ZCU A;  3CKQ A;  1GA8 A;  2O1F A;  4B5B A;  2V0I A;  4NAL A;  2Z86 A;  2P73 A;  4ASY A;  5C3B A;  2YC5 A;  2PGY A;  2A8W A;  3F1Y A;  4D11 C;  4FRM A;  4Y63 A;  1H7G A;  2P72 A;  4HO8 A;  1FGX A;  1K4V A;  5CQN X;  1VIC A;  3RMW A;  4HO0 A;  4Y7G A;  4B4M A;  5I1F A;  2XMH A;  1JVG A;  1NQI B;  4IRP A;  4YS8 A;  1JV1 A;  1ZJP A;  5C4E A;  5C36 A;  2YQH A;  1VH1 A;  2DPW A;  3OAM A;  1WT1 A;  5CQL X;  1VPA A;  4C2S A;  2WAW A;  1H5S A;  2V0K A;  1IIN A;  4Y7T A;  1ZCY A;  4KC1 A;  2PX7 A;  2OI7 A;  1ZJ3 A;  3ZLK A;  1LL0 A;  2AE7 A;  2OEF A;  1ZIZ A;  2VXM A;  1LVW A;  1V82 A;  1H7F A;  4LW3 A;  5C4D A;  1FR8 A;  3OKR A;  1H3M A;  2RJ1 A;  3ZF8 A;  1JVD A;  3V91 A;  1ZI1 A;  2RJ8 A;  3BCV A;  2JCO A;  1ZJ0 A;  3U2V A;  1G2V A;  3V8Y A;  2VS5 A;  4CJC A;  4Y6U A;  2W0V A;  1WT2 A;  1HM8 A;  1H5T A;  1WSZ A;  2VXL A;  1ZJ1 A;  1O23 B;  2VS4 A;  1H5S B;  1H4E A;  3U0Y A;  3I0G A;  3EE5 A;  1VH3 A;  3OH1 A;  4D48 A;  4B2X A;  3SXG A;  4NAI A;  1FOA A;  1H4D A;  2FYD B;  4EEO A;  2OEG A;  3E25 A;  1QG8 A;  1GWW A;  2Y4K A;  3I0D A;  5C8R A;  4EEA A;  3ZGG A;  4KNR A;  3RSB A;  3OH2 A;  3SXA A;  3ZGF A;  1HJJ A;  2FYA A;  4FRA A;  5AJP A;  4KT7 A;  5AJO A;  3T7M A;  4DE7 A;  4R7P A;  4G87 A;  2PGV A;  4G3Q A;  2AEC A;  1JYK A;  1PZT A;  1FG5 N;  1HV9 A;  1H5T B;  2FY7 A;  1OMX A;  2AGD A;  1S4P A;  1R82 A;  3SX8 A;  2JCL A;  1VGZ A;  4AC3 A;  3V0P A;  2V0J A;  1FRW A;  1H5S C;  3CKN A;  2I5K A;  2ZU7 A;  4Y7F A;  3LW6 A;  2BO7 A;  4D0T A;  5C3A A;  3CKJ A;  3N9W A;  5EIY A;  4HO5 A;  2JCK A;  5C48 A;  3I0K A;  3TZT A;  1ON8 A;  2RJ6 A;  4HO4 A;  4D0Z A;  5EJZ A;  3OH0 A;  3SPT A;  2X5Z A;  2RIT A;  1LL2 A;  1W57 A;  3V0Q A;  4J18 A;  1YRO B;  2RIX A;  1LZI A;  4MND A;  2D7I A;  4FCU A;  2E3D A;  1O7Q A;  4MYB A;  1INI A;  3T7N A;  1YP4 A;  1OMZ A;  3U2U A;  1GWV A;  2FYC B;  1V84 A;  2VFZ A;  4L41 C;  4EVW A;  1R7T A;  1W55 A;  5DDV A;  3U2W A;  2MZB A;  3D5N A;  1R7Y A;  4HO9 A;  5J49 A;  1R7X A;  3R2W A;  1QGS A;  1E5K A;  1ZHJ A;  4K6R A;  4IRQ A;  3NGW A;  2QGI A;  1SS9 A;  4Y7U A;  3CU0 A;  1G95 A;  3U0X A;  3RMV A;  4Y6N A;  1NMM B;  3SX5 A;  1I52 A;  4Y62 A;  5CMF X;  4FQW A;  3I0H A;  4Y7V A;  1R7U A;  3Q80 A;  4M2A A;  2AM3 A;  1FXO A;  4GBP A;  1GQ9 A;  4B2W A;  1NKH B;  5C4F A;  3U2T A;  3R3I A;  2FFV A;  3USR A;  5HS2 A;  1ZDG A;  5C1H A;  2GGQ A;  3V90 A;  4NAK A;  2QH5 A;  1FZW A;  3IOH A;  2WE9 A;  4M28 A;  3SXD A;  1H7E A;  4M4K A;  1TVY A;  1ZI5 A;  2D0J A;  2OI6 A;  3CKO A;  4BQH A;  5IFY A;  1H5R A;  4XWI A;  1WVC A;  2Y4L A;  2JCJ A;  5IDS A;  1H7T A;  3PKQ A;  4B4G A;  4CJB A;  5FV9 A;  5C1G A;  4EE4 A;  1GQC A;  1VZU A;  1G0R A;  1QGQ A;  4DDZ A;  2I7B A;  3CGX A;  4P02 A;  5CMG X;  3SXE A;  3SX3 A;  3DK5 A;  2WVM A;  2XWN A;  1G97 A;  3I0F A;  3JUK A;  2O1G A;  2WVL A;  1VZT A;  1FWY A;  2RJ4 A;  1FXJ A;  1H5R B;  3KIA A;  2XWL A;  1XHB A;  4ECM A;  5FTV A;  1ZI4 A;  4DEC A;  1VGT A;  3V0M A;  4KC4 A;  5C47 A;  2APC A;  4HO2 A;  5CQP A;  1G8O A;  3SXB A;  5C4B A;  1PZY B;  2XME A;  1GX4 A;  1NWG B;  1G93 A;  3D8V A;  1GX0 A;  2RJ0 A;  2W0W A;  2UX8 A;  1NHE B;  1ZJO A;  2ZU9 A;  4M2B A;  5FYE A;  3I0J A;  1QWJ A;  1ZCV A;  2AES A;  4FRO A;  2Y4M A;  1XZ6 A;  4G3S A;  1INJ A;  3I0L A;  5DDT A;  2VSI A;  4CVH A;  2AM4 A;  1KWS A;  2NXV A;  2ICY A;  3I0I X;  2WGZ A;  3BRK X;  5CMH A;  4E1K A;  3U2X A;  1WT0 A;  1R7V A;  4HOC A;  3ST8 A;  2GGO A;  5FTS A;  1TW1 A;  3O3P A;  3CKV A;  4HCQ A;  5FUH A;  4FRD A;  4CJ8 A;  4FRH A;  4KQL A;  4AYL A;  2VS3 A;  4FRL A;  2V0L A;  4HG6 A;  1H7Q A;  1R80 A;  1LZJ A;  3OH3 A;  4FRE A;  2D7R A;  2Z87 A;  1NF5 B;  5IDT A;  1W77 A;  2X60 A;  4JD0 A;  1LL3 A; 
#chains in the Genus database with same CATH topology
 2VSH A;  1VZX A;  5C3D A;  2V0H A;  2RJ5 A;  3PNN A;  3JTJ A;  3K8D A;  4LW6 A;  5FU0 A;  4O6N A;  3JUJ A;  3IOJ A;  2BO8 A;  4KC2 A;  3OGZ A;  5C38 A;  4FRQ A;  5C4C A;  5BXC A;  2AH9 A;  4BMA A;  4ZDQ A;  3V0O A;  2WEE A;  1ZI3 A;  1WT3 A;  2RIZ A;  3GUE A;  5CMJ A;  2ZU8 A;  4EE5 A;  4ARW A;  1VM8 A;  2FFU A;  1G1L A;  3DUV A;  2X5S A;  2X65 A;  3HL3 A;  3V0N A;  2QKX A;  3PKP A;  4EE3 A;  2C0N A;  2WVK A;  3V0L A;  3FOQ A;  2YQS A;  4FCE A;  4HO6 A;  4P00 A;  1VGW A;  4NAN A;  5L6S A;  1FO8 A;  5L6V A;  1HM9 A;  2CU2 A;  4EEM A;  1H7L A;  4ASJ A;  2Y4J A;  1G3L A;  4FRP A;  1R81 A;  2YQC A;  3DJ4 A;  2BO6 A;  3F1C A;  4UEG A;  5JQQ A;  3QVB A;  1FGG A;  1ON6 A;  1O7O A;  2YQJ A;  2RJ7 A;  4D11 A;  4Y9X A;  5D91 A;  2AM5 A;  1ZDF A;  2O1H A;  2PA4 A;  1ZJ2 A;  4B42 A;  3POL A;  1FR9 A;  5CMI A;  1MP4 A;  5CQM X;  1HJL A;  3OH4 A;  3K8E A;  1S4N A;  4JIS A;  1H7H A;  1G9R A;  1YP2 A;  5FU8 A;  1TZF A;  2Q4J A;  4AAW A;  5EJ1 A;  1MC3 A;  2Y6P A;  1VGU A;  3D98 A;  3TQD A;  4B3U A;  5C49 A;  4G3P A;  4AYJ A;  2YCM A;  1FO9 A;  1Z90 A;  2A8U A;  1H4C A;  3V8Z A;  2FYB A;  1EYR A;  1ZCT A;  2P6W A;  4KRV A;  2VD4 A;  3E26 A;  1MP5 A;  2ICX A;  2I5E A;  2Y7A A;  3FWW A;  1LZ0 A;  2YES A;  2OI5 A;  2BO4 A;  1YP3 A;  3OC9 A;  1S4O A;  2RJ9 A;  1O0R A;  4KPZ A;  4EEG A;  3SX7 A;  3Q4S A;  4FRB A;  3I0C A;  3T7O A;  4B4B A;  3Q7U A;  1LZ7 A;  3IOI A;  2E8B A;  2YC3 A;  3ZLL A;  2J0A A;  1MP3 A;  1IIM A;  1G23 A;  5AJN A;  1HM0 A;  1EZI A;  1H5S D;  3SXC A;  4HO3 A;  3USQ A;  4Y64 A;  4KPX A;  2RIY A;  1TW5 A;  5CQO A;  1V83 A;  5C1L A;  1JYL A;  2XWM A;  4KXO A;  4KNX A;  3I0E A;  1JV3 A;  1OQM B;  1ZCU A;  3CKQ A;  1GA8 A;  2O1F A;  4B5B A;  2V0I A;  4NAL A;  2Z86 A;  2P73 A;  4ASY A;  5C3B A;  2YC5 A;  2PGY A;  2A8W A;  3F1Y A;  4FIX A;  4D11 C;  4FRM A;  4Y63 A;  1H7G A;  2P72 A;  4HO8 A;  1FGX A;  1K4V A;  5CQN X;  1VIC A;  3RMW A;  4HO0 A;  4Y7G A;  4B4M A;  5I1F A;  2XMH A;  1JVG A;  1NQI B;  4IRP A;  4YS8 A;  1JV1 A;  1ZJP A;  5C4E A;  5C36 A;  2YQH A;  1VH1 A;  2DPW A;  3OAM A;  1WT1 A;  5CQL X;  1VPA A;  2VK9 A;  4C2S A;  2WAW A;  1H5S A;  2V0K A;  1IIN A;  4Y7T A;  1ZCY A;  4KC1 A;  2PX7 A;  2OI7 A;  1ZJ3 A;  3ZLK A;  1LL0 A;  2AE7 A;  2OEF A;  1ZIZ A;  2VXM A;  1LVW A;  1V82 A;  1H7F A;  4LW3 A;  5C4D A;  1FR8 A;  3OKR A;  1H3M A;  2RJ1 A;  4MIX A;  3ZF8 A;  1JVD A;  3V91 A;  1ZI1 A;  2RJ8 A;  3BCV A;  2JCO A;  1ZJ0 A;  3U2V A;  1G2V A;  3V8Y A;  2VS5 A;  4CJC A;  4Y6U A;  2W0V A;  1WT2 A;  1HM8 A;  1H5T A;  1WSZ A;  2VXL A;  1ZJ1 A;  1O23 B;  2VS4 A;  1H5S B;  1H4E A;  3U0Y A;  3I0G A;  3EE5 A;  1VH3 A;  3OH1 A;  4D48 A;  4B2X A;  3SXG A;  4NAI A;  1FOA A;  1H4D A;  2FYD B;  4EEO A;  2OEG A;  3E25 A;  1QG8 A;  1GWW A;  2Y4K A;  3I0D A;  5C8R A;  4EEA A;  3ZGG A;  4KNR A;  3RSB A;  3OH2 A;  3SXA A;  3ZGF A;  1HJJ A;  2FYA A;  4FRA A;  5AJP A;  4KT7 A;  4O6M A;  5AJO A;  3T7M A;  4DE7 A;  4R7P A;  4G87 A;  2PGV A;  4G3Q A;  2AEC A;  1JYK A;  1PZT A;  1FG5 N;  1HV9 A;  1H5T B;  2FY7 A;  1OMX A;  2AGD A;  1S4P A;  1R82 A;  3SX8 A;  2JCL A;  1VGZ A;  4AC3 A;  3V0P A;  2V0J A;  1FRW A;  1H5S C;  3CKN A;  2I5K A;  2ZU7 A;  4Y7F A;  3LW6 A;  2BO7 A;  4D0T A;  5C3A A;  3CKJ A;  3N9W A;  5EIY A;  4HO5 A;  2JCK A;  5C48 A;  3I0K A;  3TZT A;  1ON8 A;  2RJ6 A;  4HO4 A;  4D0Z A;  2J0B A;  5EJZ A;  3OH0 A;  3SPT A;  2X5Z A;  2RIT A;  1LL2 A;  1W57 A;  3V0Q A;  4J18 A;  1YRO B;  2RIX A;  1LZI A;  4MND A;  2D7I A;  4FCU A;  2E3D A;  1O7Q A;  4MYB A;  1INI A;  3T7N A;  1YP4 A;  1OMZ A;  3U2U A;  1GWV A;  2FYC B;  1V84 A;  2VFZ A;  4L41 C;  4EVW A;  1R7T A;  1W55 A;  5DDV A;  3U2W A;  2MZB A;  3D5N A;  1R7Y A;  4HO9 A;  5J49 A;  1R7X A;  3R2W A;  1QGS A;  1E5K A;  1ZHJ A;  4K6R A;  4IRQ A;  3NGW A;  2QGI A;  1SS9 A;  4Y7U A;  3CU0 A;  5D92 A;  1G95 A;  3U0X A;  3RMV A;  4Y6N A;  1NMM B;  3SX5 A;  1I52 A;  4Y62 A;  5CMF X;  4FQW A;  3I0H A;  4Q7C A;  4Y7V A;  1R7U A;  3Q80 A;  4M2A A;  2AM3 A;  1FXO A;  4GBP A;  1GQ9 A;  4B2W A;  1NKH B;  5C4F A;  3U2T A;  3R3I A;  2FFV A;  3USR A;  5HS2 A;  1ZDG A;  5C1H A;  2GGQ A;  3V90 A;  4NAK A;  2QH5 A;  1FZW A;  3IOH A;  2WE9 A;  4M28 A;  3SXD A;  1H7E A;  4M4K A;  1TVY A;  1ZI5 A;  2D0J A;  2OI6 A;  3CKO A;  4BQH A;  5IFY A;  1H5R A;  4XWI A;  1WVC A;  2Y4L A;  2JCJ A;  5IDS A;  1H7T A;  3PKQ A;  4B4G A;  4CJB A;  5FV9 A;  5C1G A;  4EE4 A;  1GQC A;  1VZU A;  1G0R A;  1QGQ A;  4DDZ A;  2I7B A;  3CGX A;  4P02 A;  5CMG X;  3SXE A;  3SX3 A;  3DK5 A;  2WVM A;  2XWN A;  1G97 A;  3I0F A;  3JUK A;  2O1G A;  2WVL A;  1VZT A;  1FWY A;  2RJ4 A;  1FXJ A;  1H5R B;  3KIA A;  2XWL A;  1XHB A;  4ECM A;  5FTV A;  1ZI4 A;  4DEC A;  1VGT A;  3V0M A;  4KC4 A;  5C47 A;  2APC A;  4HO2 A;  5CQP A;  1G8O A;  3SXB A;  5C4B A;  1PZY B;  2XME A;  1GX4 A;  1NWG B;  1G93 A;  3D8V A;  1GX0 A;  2RJ0 A;  2W0W A;  2UX8 A;  1NHE B;  1ZJO A;  2ZU9 A;  4M2B A;  5FYE A;  3I0J A;  1QWJ A;  1ZCV A;  2AES A;  4FRO A;  2Y4M A;  1XZ6 A;  4FIY A;  4G3S A;  1INJ A;  3I0L A;  5DDT A;  2VSI A;  4CVH A;  2AM4 A;  1KWS A;  2NXV A;  2ICY A;  3I0I X;  2WGZ A;  3BRK X;  5CMH A;  4E1K A;  3U2X A;  1WT0 A;  1R7V A;  4HOC A;  3ST8 A;  2GGO A;  5FTS A;  1TW1 A;  3O3P A;  3CKV A;  4HCQ A;  5FUH A;  4FRD A;  4CJ8 A;  4FRH A;  4KQL A;  4AYL A;  2VS3 A;  4FRL A;  2V0L A;  4HG6 A;  1H7Q A;  1R80 A;  1LZJ A;  3OH3 A;  4FRE A;  2D7R A;  2Z87 A;  1NF5 B;  5IDT A;  1W77 A;  2X60 A;  4JD0 A;  1LL3 A; 
#chains in the Genus database with same CATH homology
 2VSH A;  1VZX A;  5C3D A;  2V0H A;  2RJ5 A;  3PNN A;  3JTJ A;  3K8D A;  4LW6 A;  5FU0 A;  4O6N A;  3JUJ A;  3IOJ A;  2BO8 A;  4KC2 A;  3OGZ A;  5C38 A;  4FRQ A;  5C4C A;  5BXC A;  2AH9 A;  4BMA A;  4ZDQ A;  3V0O A;  2WEE A;  1ZI3 A;  1WT3 A;  2RIZ A;  3GUE A;  5CMJ A;  2ZU8 A;  4EE5 A;  4ARW A;  1VM8 A;  2FFU A;  1G1L A;  3DUV A;  2X5S A;  2X65 A;  3HL3 A;  3V0N A;  2QKX A;  3PKP A;  4EE3 A;  2C0N A;  2WVK A;  3V0L A;  3FOQ A;  2YQS A;  4FCE A;  4HO6 A;  4P00 A;  1VGW A;  4NAN A;  5L6S A;  1FO8 A;  5L6V A;  1HM9 A;  2CU2 A;  4EEM A;  1H7L A;  4ASJ A;  2Y4J A;  1G3L A;  4FRP A;  1R81 A;  2YQC A;  3DJ4 A;  2BO6 A;  3F1C A;  4UEG A;  5JQQ A;  3QVB A;  1FGG A;  1ON6 A;  1O7O A;  2YQJ A;  2RJ7 A;  4D11 A;  4Y9X A;  5D91 A;  2AM5 A;  1ZDF A;  2O1H A;  2PA4 A;  1ZJ2 A;  4B42 A;  3POL A;  1FR9 A;  5CMI A;  1MP4 A;  5CQM X;  1HJL A;  3OH4 A;  3K8E A;  1S4N A;  4JIS A;  1H7H A;  1G9R A;  1YP2 A;  5FU8 A;  1TZF A;  2Q4J A;  4AAW A;  5EJ1 A;  1MC3 A;  2Y6P A;  1VGU A;  3D98 A;  3TQD A;  4B3U A;  5C49 A;  4G3P A;  4AYJ A;  2YCM A;  1FO9 A;  1Z90 A;  2A8U A;  1H4C A;  3V8Z A;  2FYB A;  1EYR A;  1ZCT A;  2P6W A;  4KRV A;  2VD4 A;  3E26 A;  1MP5 A;  2ICX A;  2I5E A;  2Y7A A;  3FWW A;  1LZ0 A;  2YES A;  2OI5 A;  2BO4 A;  1YP3 A;  3OC9 A;  1S4O A;  2RJ9 A;  1O0R A;  4KPZ A;  4EEG A;  3SX7 A;  3Q4S A;  4FRB A;  3I0C A;  3T7O A;  4B4B A;  3Q7U A;  1LZ7 A;  3IOI A;  2E8B A;  2YC3 A;  3ZLL A;  2J0A A;  1MP3 A;  1IIM A;  1G23 A;  5AJN A;  1HM0 A;  1EZI A;  1H5S D;  3SXC A;  4HO3 A;  3USQ A;  4Y64 A;  4KPX A;  2RIY A;  1TW5 A;  5CQO A;  1V83 A;  5C1L A;  1JYL A;  2XWM A;  4KXO A;  4KNX A;  3I0E A;  1JV3 A;  1OQM B;  1ZCU A;  3CKQ A;  1GA8 A;  2O1F A;  4B5B A;  2V0I A;  4NAL A;  2Z86 A;  2P73 A;  4ASY A;  5C3B A;  2YC5 A;  2PGY A;  2A8W A;  3F1Y A;  4FIX A;  4D11 C;  4FRM A;  4Y63 A;  1H7G A;  2P72 A;  4HO8 A;  1FGX A;  1K4V A;  5CQN X;  1VIC A;  3RMW A;  4HO0 A;  4Y7G A;  4B4M A;  5I1F A;  2XMH A;  1JVG A;  1NQI B;  4IRP A;  4YS8 A;  1JV1 A;  1ZJP A;  5C4E A;  5C36 A;  2YQH A;  1VH1 A;  2DPW A;  3OAM A;  1WT1 A;  5CQL X;  1VPA A;  2VK9 A;  4C2S A;  2WAW A;  1H5S A;  2V0K A;  1IIN A;  4Y7T A;  1ZCY A;  4KC1 A;  2PX7 A;  2OI7 A;  1ZJ3 A;  3ZLK A;  1LL0 A;  2AE7 A;  2OEF A;  1ZIZ A;  2VXM A;  1LVW A;  1V82 A;  1H7F A;  4LW3 A;  5C4D A;  1FR8 A;  3OKR A;  1H3M A;  2RJ1 A;  4MIX A;  3ZF8 A;  1JVD A;  3V91 A;  1ZI1 A;  2RJ8 A;  3BCV A;  2JCO A;  1ZJ0 A;  3U2V A;  1G2V A;  3V8Y A;  2VS5 A;  4CJC A;  4Y6U A;  2W0V A;  1WT2 A;  1HM8 A;  1H5T A;  1WSZ A;  2VXL A;  1ZJ1 A;  1O23 B;  2VS4 A;  1H5S B;  1H4E A;  3U0Y A;  3I0G A;  3EE5 A;  1VH3 A;  3OH1 A;  4D48 A;  4B2X A;  3SXG A;  4NAI A;  1FOA A;  1H4D A;  2FYD B;  4EEO A;  2OEG A;  3E25 A;  1QG8 A;  1GWW A;  2Y4K A;  3I0D A;  5C8R A;  4EEA A;  3ZGG A;  4KNR A;  3RSB A;  3OH2 A;  3SXA A;  3ZGF A;  1HJJ A;  2FYA A;  4FRA A;  5AJP A;  4KT7 A;  4O6M A;  5AJO A;  3T7M A;  4DE7 A;  4R7P A;  4G87 A;  2PGV A;  4G3Q A;  2AEC A;  1JYK A;  1PZT A;  1FG5 N;  1HV9 A;  1H5T B;  2FY7 A;  1OMX A;  2AGD A;  1S4P A;  1R82 A;  3SX8 A;  2JCL A;  1VGZ A;  4AC3 A;  3V0P A;  2V0J A;  1FRW A;  1H5S C;  3CKN A;  2I5K A;  2ZU7 A;  4Y7F A;  3LW6 A;  2BO7 A;  4D0T A;  5C3A A;  3CKJ A;  3N9W A;  5EIY A;  4HO5 A;  2JCK A;  5C48 A;  3I0K A;  3TZT A;  1ON8 A;  2RJ6 A;  4HO4 A;  4D0Z A;  2J0B A;  5EJZ A;  3OH0 A;  3SPT A;  2X5Z A;  2RIT A;  1LL2 A;  1W57 A;  3V0Q A;  4J18 A;  1YRO B;  2RIX A;  1LZI A;  4MND A;  2D7I A;  4FCU A;  2E3D A;  1O7Q A;  4MYB A;  1INI A;  3T7N A;  1YP4 A;  1OMZ A;  3U2U A;  1GWV A;  2FYC B;  1V84 A;  2VFZ A;  4L41 C;  4EVW A;  1R7T A;  1W55 A;  5DDV A;  3U2W A;  2MZB A;  3D5N A;  1R7Y A;  4HO9 A;  5J49 A;  1R7X A;  3R2W A;  1QGS A;  1E5K A;  1ZHJ A;  4K6R A;  4IRQ A;  3NGW A;  2QGI A;  1SS9 A;  4Y7U A;  3CU0 A;  5D92 A;  1G95 A;  3U0X A;  3RMV A;  4Y6N A;  1NMM B;  3SX5 A;  1I52 A;  4Y62 A;  5CMF X;  4FQW A;  3I0H A;  4Q7C A;  4Y7V A;  1R7U A;  3Q80 A;  4M2A A;  2AM3 A;  1FXO A;  4GBP A;  1GQ9 A;  4B2W A;  1NKH B;  5C4F A;  3U2T A;  3R3I A;  2FFV A;  3USR A;  5HS2 A;  1ZDG A;  5C1H A;  2GGQ A;  3V90 A;  4NAK A;  2QH5 A;  1FZW A;  3IOH A;  2WE9 A;  4M28 A;  3SXD A;  1H7E A;  4M4K A;  1TVY A;  1ZI5 A;  2D0J A;  2OI6 A;  3CKO A;  4BQH A;  5IFY A;  1H5R A;  4XWI A;  1WVC A;  2Y4L A;  2JCJ A;  5IDS A;  1H7T A;  3PKQ A;  4B4G A;  4CJB A;  5FV9 A;  5C1G A;  4EE4 A;  1GQC A;  1VZU A;  1G0R A;  1QGQ A;  4DDZ A;  2I7B A;  3CGX A;  4P02 A;  5CMG X;  3SXE A;  3SX3 A;  3DK5 A;  2WVM A;  2XWN A;  1G97 A;  3I0F A;  3JUK A;  2O1G A;  2WVL A;  1VZT A;  1FWY A;  2RJ4 A;  1FXJ A;  1H5R B;  3KIA A;  2XWL A;  1XHB A;  4ECM A;  5FTV A;  1ZI4 A;  4DEC A;  1VGT A;  3V0M A;  4KC4 A;  5C47 A;  2APC A;  4HO2 A;  5CQP A;  1G8O A;  3SXB A;  5C4B A;  1PZY B;  2XME A;  1GX4 A;  1NWG B;  1G93 A;  3D8V A;  1GX0 A;  2RJ0 A;  2W0W A;  2UX8 A;  1NHE B;  1ZJO A;  2ZU9 A;  4M2B A;  5FYE A;  3I0J A;  1QWJ A;  1ZCV A;  2AES A;  4FRO A;  2Y4M A;  1XZ6 A;  4FIY A;  4G3S A;  1INJ A;  3I0L A;  5DDT A;  2VSI A;  4CVH A;  2AM4 A;  1KWS A;  2NXV A;  2ICY A;  3I0I X;  2WGZ A;  3BRK X;  5CMH A;  4E1K A;  3U2X A;  1WT0 A;  1R7V A;  4HOC A;  3ST8 A;  2GGO A;  5FTS A;  1TW1 A;  3O3P A;  3CKV A;  4HCQ A;  5FUH A;  4FRD A;  4CJ8 A;  4FRH A;  4KQL A;  4AYL A;  2VS3 A;  4FRL A;  2V0L A;  4HG6 A;  1H7Q A;  1R80 A;  1LZJ A;  3OH3 A;  4FRE A;  2D7R A;  2Z87 A;  1NF5 B;  5IDT A;  1W77 A;  2X60 A;  4JD0 A;  1LL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...