1ON8A

Crystal structure of mouse alpha-1,4-n-acetylhexosaminyltransferase (extl2) with udp and glcuab(1-3)galb(1-o)-naphthalenelmethanol an acceptor substrate analog
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
265
structure length
265
Chain Sequence
ALDSFTLIMQTYNRTDLLLRLLNHYQAVPSLHKVIVVWNNVGEKGPEELWNSLGPHPIPVIFKPQTANKMRNRLQVFPEVETNAVLMVDDDTLISAQDLVFAFSIWQQFPDQIIGFVPRKHVSTSSGIYSYGGFELQTPGPGNGDQYSMVLIGASFFNSKYLELFQKQPAAVHALIDETQNCDDIAMNFLVTRHTGKPSGIFVKPINMVNLEKETNGYSGMWHRAEHFLQRSYCINKLVNIYDGMPLKYSNIMISQFGFPYANHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-1,4-N-acetylhexosaminyltransferase EXTL2
publication title Crystal structure of an alpha-1,4-N-acetylhexosaminyltransferase (EXTL2), a member of the exostosin gene family involved in heparan sulfate biosynthesis
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 89
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 2.4.1.223: Glucuronosyl-galactosyl-proteoglycan 4-alpha-N-
pdb deposition date 2003-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09258 Glyco_transf_64 Glycosyl transferase family 64 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1on8A00
1LZ0A 4Y62A 2Q4JA 1W55A 4HO3A 2AESA 4AC3A 4KXOA 4HO5A 1VGTA 5EJ1A 1R7UA 5CQMX 2AGDA 4CJ8A 2WEEA 2I5EA 4D11C 2BO4A 2VSIA 5IDTA 4D0ZA 2QKXA 3LW6A 5CMGX 4KQLA 1SS9A 1LVWA 3DUVA 4FCUA 4CJCA 4MYBA 5C1LA 1JVGA 2RJ1A 4AYJA 3RMWA 4E1KA 1TW5A 3I0FA 4FRQA 3I0JA 2V0LA 4JD0A 3ST8A 2YQHA 1H5SA 1TW1A 3RMVA 2Y4MA 1R81A 3HL3A 4DDZA 3OH4A 4B4BA 3QVBA 1H7GA 2XMEA 2MZBA 4M4KA 4HO6A 3SX8A 1ZJ1A 2I5KA 5C36A 3CKQA 3D98A 1VH1A 3OGZA 4R7PA 2XWMA 2RJ0A 4ASYA 1WT3A 1R80A 1H5RB 2WAWA 1QWJA 1HM0A 3CGXA 4XWIA 1FRWA 4Y6UA 3U0YA 1FOAA 1ZIZA 4P02A 1INJA 4B4GA 2X65A 5FTVA 2ZU7A 3U2UA 4EVWA 1H7QA 3I0EA 1NWGB 5C3BA 2RIZA 4EE4A 2D7RA 1OMZA 4FRDA 2Z87A 4P00A 1O7QA 1H3MA 2FYBA 2OEGA 1YP2A 2RITA 3CKNA 3OC9A 1FGXA 4KRVA 4KNRA 1JYLA 2OI7A 1NF5B 1H5RA 4FRMA 1ZCVA 3NGWA 5HS2A 2V0IA 3DJ4A 4L41C 4K6RA 2RJ7A 2RJ8A 4AYLA 2JCOA 3T7MA 2JCJA 2RJ5A 4HO2A 2WE9A 1VICA 1GX4A 1NQIB 5CQPA 1G23A 1S4OA 1S4PA 2VXLA 2XMHA 3ZF8A 1QG8A 2D7IA 5CQNX 1PZTA 4D48A 3PNNA 1JV3A 3V0QA 5C4BA 2V0JA 4HO9A 1ZCUA 4KPZA 3I0CA 2BO6A 4GBPA 1G95A 4Y64A 1H7TA 4M2AA 2JCKA 5AJNA 3ZLKA 5C4EA 3SXEA 3O3PA 1H7LA 1VH3A 1JYKA 1OQMB 2OI6A 2A8UA 2RIXA 3Q4SA 5FV9A 4Y9XA 2V0KA 5FU0A 2RJ6A 3U2VA 4Y6NA 1W77A 3I0LA 4BMAA 5JQQA 1NHEB 2AM3A 2CU2A 1ZJOA 5IDSA 1OMXA 1G93A 3PKPA 3BCVA 1GQ9A 3OH2A 4HO8A 5L6SA 4FCEA 1GWVA 4ZDQA 2AECA 1V82A 5C1GA 3I0DA 2UX8A 2Y4LA 3Q80A 4CVHA 1YP3A 1VZUA 3JUKA 1S4NA 2VS3A 4D0TA 1KWSA 2D0JA 1HV9A 5CQLX 3CKOA 3T7NA 1VZTA 4Y63A 3K8EA 4FREA 5AJOA 2X5ZA 1I52A 1LL0A 3TZTA 4KC2A 1ZI4A 2Y4KA 2WVMA 5I1FA 3R2WA 5C4FA 1G2VA 1ON8A 4AAWA 1PZYB 4C2SA 1WSZA 5CMFX 2OEFA 1G97A 3POLA 2Y4JA 3U2XA 1GQCA 3SXBA 2Y7AA 4ARWA 4IRPA 4HO4A 4HG6A 3N9WA 1ZJPA 2PGVA 4B2XA 3D8VA 3R3IA 1ZHJA 1HM8A 3USRA 4MNDA 2JCLA 1WT1A 1E5KA 2RIYA 5CMHA 3RSBA 1MP3A 4M2BA 1G9RA 1H5TB 4G3SA 1TVYA 1FR8A 2P72A 3FOQA 3I0IX 4DE7A 2VD4A 3V90A 1R7TA 3SXAA 4ASJA 4EEOA 1ZDGA 1YP4A 4FRAA 2VS4A 3CKVA 3JUJA 2V0HA 1VGWA 4G3QA 3SPTA 2X5SA 2YESA 4M28A 2GGQA 4FQWA 3USQA 1ZCTA 1QGQA 4KC4A 2NXVA 1VGZA 3GUEA 1G0RA 1ZCYA 4D11A 2WGZA 4Y7UA 5C3AA 2W0WA 2RJ4A 1H5SC 4IRQA 1MC3A 5C38A 2YQJA 5C49A 1FO9A 3PKQA 4FRBA 3IOIA 2AM5A 1H5TA 1H4CA 1R7XA 4Y7VA 3SXGA 1LZIA 2PA4A 1QGSA 4J18A 1VGUA 4FRLA 4HCQA 5DDTA 1WT0A 1V84A 5FYEA 2E3DA 5DDVA 4HO0A 1EZIA 1H4EA 2AH9A 2DPWA 2I7BA 2BO8A 4B3UA 3BRKX 1H7HA 3V8YA 1HM9A 2W0VA 3IOHA 1ZJ0A 2APCA 3V0OA 4Y7GA 3FWWA 1LZJA 2XWNA 1NKHB 3OAMA 4UEGA 5C4DA 3SXCA 4KNXA 3DK5A 2FYAA 5L6VA 3F1CA 2E8BA 3CKJA 1FO8A 1INIA 4Y7FA 4EE5A 4EEMA 3OKRA 2ICYA 3SX7A 1FZWA 5FUHA 1XHBA 1R7VA 5AJPA 2YCMA 3D5NA 5BXCA 5EJZA 2WVKA 4EEGA 5C47A 1O23B 3U2WA 1JVDA 2AE7A 1ON6A 4LW3A 2X60A 3I0GA 2A8WA 1WT2A 2VS5A 2VXMA 3V8ZA 5FTSA 5CQOA 1H7FA 4B42A 3OH1A 4NALA 2GGOA 2YC5A 2ZU9A 4NANA 3V0PA 1LL3A 1MP4A 3U2TA 1TZFA 5J49A 2YQSA 4FROA 1IIMA 1H5SD 1IINA 2FYCB 1FG5N 4CJBA 1NMMB 3V0LA 4FRHA 4B4MA 4G87A 2WVLA 1EYRA 3V0NA 3OH3A 2Y6PA 1R7YA 3V0MA 2OI5A 5C1HA 3ZGGA 1MP5A 2QGIA 2RJ9A 1GWWA 2YC3A 4Y7TA 3Q7UA 3CU0A 2O1GA 1FXJA 4B2WA 1ZDFA 4EE3A 1GA8A 1VPAA 1ZI5A 1H7EA 2ZU8A 2O1FA 3SXDA 3OH0A 1V83A 1O0RA 2VSHA 1VM8A 3IOJA 5CMIA 2FY7A 1ZJ3A 2Z86A 1W57A 5C8RA 3EE5A 4EEAA 2PGYA 3TQDA 3F1YA 3ZGFA 4G3PA 4DECA 1HJJA 1H4DA 1G1LA 5C3DA 4KPXA 2P73A 1G8OA 4FRPA 2PX7A 3K8DA 1VZXA 1XZ6A 3T7OA 2FYDB 1JV1A 2ICXA 5C4CA 2P6WA 2FFUA 1WVCA 4B5BA 5IFYA 1FXOA 4JISA 1LL2A 3V91A 4YS8A 5C48A 1GX0A 5FU8A 1FWYA 1FR9A 5EIYA 3I0KA 3KIAA 1G3LA 1O7OA 4ECMA 1ZJ2A 2XWLA 2O1HA 3E26A 1R82A 3SX3A 1LZ7A 1K4VA 1YROB 3SX5A 1HJLA 4BQHA 3E25A 4KT7A 4NAKA 4KC1A 1ZI1A 2BO7A 4NAIA 1FGGA 2AM4A 2FFVA 1Z90A 2QH5A 2YQCA 3I0HA 4HOCA 3ZLLA 4LW6A 1ZI3A 3U0XA 2VFZA 5CMJA 3JTJA 1H5SB
chains in the Genus database with same CATH superfamily
1LZ0A 4Y62A 2Q4JA 1W55A 4HO3A 2AESA 4AC3A 4KXOA 4HO5A 1VGTA 5EJ1A 1R7UA 4Q7CA 5CQMX 2AGDA 4CJ8A 2WEEA 2I5EA 4D11C 2BO4A 2VSIA 5IDTA 2C0NA 4D0ZA 2QKXA 3LW6A 5CMGX 4KQLA 1SS9A 1LVWA 3DUVA 4FCUA 4CJCA 4MYBA 5C1LA 1JVGA 2RJ1A 4AYJA 3RMWA 4E1KA 1TW5A 3I0FA 4FRQA 3I0JA 2V0LA 4JD0A 3ST8A 2YQHA 1H5SA 1TW1A 3RMVA 2Y4MA 1R81A 3HL3A 4DDZA 3OH4A 4B4BA 3QVBA 1H7GA 2XMEA 2MZBA 4M4KA 4HO6A 3SX8A 1ZJ1A 2I5KA 5C36A 3CKQA 3D98A 1VH1A 3OGZA 4R7PA 2XWMA 2RJ0A 4ASYA 1WT3A 1R80A 1H5RB 2WAWA 1QWJA 1HM0A 3CGXA 4XWIA 1FRWA 4Y6UA 3U0YA 2J0BA 1FOAA 1ZIZA 4P02A 1INJA 4B4GA 2X65A 5FTVA 2ZU7A 3U2UA 4EVWA 1H7QA 3I0EA 1NWGB 5C3BA 2RIZA 4EE4A 2D7RA 1OMZA 4FRDA 2Z87A 4P00A 1O7QA 1H3MA 2FYBA 2OEGA 1YP2A 2RITA 3CKNA 3OC9A 1FGXA 4KRVA 4KNRA 1JYLA 2OI7A 1NF5B 1H5RA 4FRMA 1ZCVA 3NGWA 5HS2A 2V0IA 3DJ4A 4L41C 4K6RA 2RJ7A 2RJ8A 4AYLA 2JCOA 3T7MA 2JCJA 2RJ5A 4HO2A 2WE9A 1VICA 1GX4A 1NQIB 5CQPA 1G23A 1S4OA 1S4PA 2VXLA 2XMHA 5D91A 3ZF8A 1QG8A 2D7IA 5CQNX 1PZTA 4D48A 3PNNA 1JV3A 3V0QA 5C4BA 2V0JA 4HO9A 1ZCUA 4KPZA 3I0CA 2BO6A 4GBPA 1G95A 4Y64A 1H7TA 4M2AA 2JCKA 5AJNA 3ZLKA 5C4EA 3SXEA 3O3PA 1H7LA 1VH3A 1JYKA 1OQMB 2OI6A 2A8UA 2RIXA 3Q4SA 5FV9A 4Y9XA 2V0KA 5FU0A 2RJ6A 3U2VA 4Y6NA 1W77A 3I0LA 4BMAA 5JQQA 1NHEB 2AM3A 2CU2A 1ZJOA 5IDSA 1OMXA 1G93A 3PKPA 3BCVA 1GQ9A 3OH2A 4HO8A 5L6SA 4FCEA 1GWVA 4ZDQA 2AECA 1V82A 5C1GA 3I0DA 2UX8A 2Y4LA 3Q80A 4CVHA 1YP3A 1VZUA 3JUKA 1S4NA 2VS3A 4D0TA 1KWSA 2D0JA 1HV9A 5CQLX 3CKOA 3T7NA 1VZTA 4Y63A 3K8EA 4FREA 5AJOA 2X5ZA 1I52A 1LL0A 3TZTA 4KC2A 1ZI4A 2Y4KA 2WVMA 5I1FA 3R2WA 5C4FA 1G2VA 1ON8A 4AAWA 1PZYB 4C2SA 1WSZA 5CMFX 2OEFA 4MIXA 1G97A 3POLA 2J0AA 2Y4JA 3U2XA 1GQCA 3SXBA 2Y7AA 4ARWA 4IRPA 4HO4A 4HG6A 3N9WA 1ZJPA 2PGVA 4B2XA 3D8VA 3R3IA 1ZHJA 1HM8A 3USRA 4MNDA 2JCLA 1WT1A 1E5KA 2RIYA 5CMHA 3RSBA 1MP3A 4M2BA 1G9RA 1H5TB 4G3SA 1TVYA 1FR8A 2P72A 3FOQA 3I0IX 4DE7A 2VD4A 3V90A 1R7TA 3SXAA 4ASJA 4EEOA 1ZDGA 1YP4A 4FRAA 2VS4A 3CKVA 3JUJA 2V0HA 1VGWA 4G3QA 3SPTA 2X5SA 2YESA 4M28A 2GGQA 4FQWA 3USQA 1ZCTA 1QGQA 4KC4A 2NXVA 1VGZA 3GUEA 1G0RA 1ZCYA 4D11A 2WGZA 4Y7UA 5C3AA 2W0WA 2RJ4A 1H5SC 4IRQA 1MC3A 5C38A 2YQJA 5C49A 1FO9A 3PKQA 4FRBA 3IOIA 2AM5A 1H5TA 1H4CA 1R7XA 4Y7VA 3SXGA 4FIYA 1LZIA 2PA4A 1QGSA 4J18A 1VGUA 4FRLA 4HCQA 5DDTA 1WT0A 1V84A 5FYEA 2E3DA 5DDVA 4HO0A 1EZIA 1H4EA 2AH9A 2DPWA 2I7BA 2BO8A 4B3UA 3BRKX 1H7HA 3V8YA 1HM9A 2W0VA 3IOHA 1ZJ0A 2APCA 3V0OA 4Y7GA 3FWWA 1LZJA 2XWNA 1NKHB 3OAMA 4UEGA 5C4DA 3SXCA 4KNXA 3DK5A 2FYAA 5L6VA 3F1CA 2E8BA 4O6NA 3CKJA 1FO8A 1INIA 4Y7FA 4EE5A 4EEMA 3OKRA 2ICYA 3SX7A 1FZWA 5FUHA 1XHBA 1R7VA 5AJPA 2YCMA 5D92A 3D5NA 5BXCA 5EJZA 2WVKA 4EEGA 5C47A 1O23B 3U2WA 1JVDA 2AE7A 1ON6A 4LW3A 2X60A 3I0GA 2A8WA 1WT2A 2VS5A 2VXMA 3V8ZA 5FTSA 5CQOA 1H7FA 4B42A 3OH1A 4NALA 2GGOA 2YC5A 2ZU9A 4NANA 3V0PA 1LL3A 1MP4A 3U2TA 1TZFA 5J49A 2YQSA 4FROA 1IIMA 1H5SD 1IINA 2FYCB 1FG5N 4CJBA 1NMMB 3V0LA 4FRHA 4B4MA 4G87A 2WVLA 1EYRA 3V0NA 3OH3A 2Y6PA 1R7YA 3V0MA 2OI5A 4FIXA 5C1HA 3ZGGA 1MP5A 2QGIA 2RJ9A 1GWWA 2YC3A 4Y7TA 3Q7UA 3CU0A 2O1GA 1FXJA 4B2WA 1ZDFA 4EE3A 1GA8A 1VPAA 1ZI5A 1H7EA 2ZU8A 2O1FA 3SXDA 3OH0A 1V83A 1O0RA 2VSHA 1VM8A 3IOJA 5CMIA 2FY7A 1ZJ3A 2Z86A 1W57A 5C8RA 3EE5A 4EEAA 2PGYA 3TQDA 3F1YA 3ZGFA 4G3PA 4DECA 1HJJA 1H4DA 1G1LA 5C3DA 4KPXA 2P73A 1G8OA 4FRPA 2PX7A 3K8DA 1VZXA 1XZ6A 3T7OA 2FYDB 1JV1A 2ICXA 5C4CA 2P6WA 2FFUA 1WVCA 4B5BA 5IFYA 1FXOA 4JISA 1LL2A 3V91A 4YS8A 5C48A 1GX0A 5FU8A 2VK9A 1FWYA 1FR9A 5EIYA 3I0KA 3KIAA 1G3LA 1O7OA 4ECMA 4O6MA 1ZJ2A 2XWLA 2O1HA 3E26A 1R82A 3SX3A 1LZ7A 1K4VA 1YROB 3SX5A 1HJLA 4BQHA 3E25A 4KT7A 4NAKA 4KC1A 1ZI1A 2BO7A 4NAIA 1FGGA 2AM4A 2FFVA 1Z90A 2QH5A 2YQCA 3I0HA 4HOCA 3ZLLA 4LW6A 1ZI3A 3U0XA 2VFZA 5CMJA 3JTJA 1H5SB
chains in the Genus database with same CATH topology
1LZ0A 4Y62A 2Q4JA 1W55A 4HO3A 2AESA 4AC3A 4KXOA 4HO5A 1VGTA 5EJ1A 1R7UA 4Q7CA 5CQMX 2AGDA 4CJ8A 2WEEA 2I5EA 4D11C 2BO4A 2VSIA 5IDTA 2C0NA 4D0ZA 2QKXA 3LW6A 5CMGX 4KQLA 1SS9A 1LVWA 3DUVA 4FCUA 4CJCA 4MYBA 5C1LA 1JVGA 2RJ1A 4AYJA 3RMWA 4E1KA 1TW5A 3I0FA 4FRQA 3I0JA 2V0LA 4JD0A 3ST8A 2YQHA 1H5SA 1TW1A 3RMVA 2Y4MA 1R81A 3HL3A 4DDZA 3OH4A 4B4BA 3QVBA 1H7GA 2XMEA 2MZBA 4M4KA 4HO6A 3SX8A 1ZJ1A 2I5KA 5C36A 3CKQA 3D98A 1VH1A 3OGZA 4R7PA 2XWMA 2RJ0A 4ASYA 1WT3A 1R80A 1H5RB 2WAWA 1QWJA 1HM0A 3CGXA 4XWIA 1FRWA 4Y6UA 3U0YA 2J0BA 1FOAA 1ZIZA 4P02A 1INJA 4B4GA 2X65A 5FTVA 2ZU7A 3U2UA 4EVWA 1H7QA 3I0EA 1NWGB 5C3BA 2RIZA 4EE4A 2D7RA 1OMZA 4FRDA 2Z87A 4P00A 1O7QA 1H3MA 2FYBA 2OEGA 1YP2A 2RITA 3CKNA 3OC9A 1FGXA 4KRVA 4KNRA 1JYLA 2OI7A 1NF5B 1H5RA 4FRMA 1ZCVA 3NGWA 5HS2A 2V0IA 3DJ4A 4L41C 4K6RA 2RJ7A 2RJ8A 4AYLA 2JCOA 3T7MA 2JCJA 2RJ5A 4HO2A 2WE9A 1VICA 1GX4A 1NQIB 5CQPA 1G23A 1S4OA 1S4PA 2VXLA 2XMHA 5D91A 3ZF8A 1QG8A 2D7IA 5CQNX 1PZTA 4D48A 3PNNA 1JV3A 3V0QA 5C4BA 2V0JA 4HO9A 1ZCUA 4KPZA 3I0CA 2BO6A 4GBPA 1G95A 4Y64A 1H7TA 4M2AA 2JCKA 5AJNA 3ZLKA 5C4EA 3SXEA 3O3PA 1H7LA 1VH3A 1JYKA 1OQMB 2OI6A 2A8UA 2RIXA 3Q4SA 5FV9A 4Y9XA 2V0KA 5FU0A 2RJ6A 3U2VA 4Y6NA 1W77A 3I0LA 4BMAA 5JQQA 1NHEB 2AM3A 2CU2A 1ZJOA 5IDSA 1OMXA 1G93A 3PKPA 3BCVA 1GQ9A 3OH2A 4HO8A 5L6SA 4FCEA 1GWVA 4ZDQA 2AECA 1V82A 5C1GA 3I0DA 2UX8A 2Y4LA 3Q80A 4CVHA 1YP3A 1VZUA 3JUKA 1S4NA 2VS3A 4D0TA 1KWSA 2D0JA 1HV9A 5CQLX 3CKOA 3T7NA 1VZTA 4Y63A 3K8EA 4FREA 5AJOA 2X5ZA 1I52A 1LL0A 3TZTA 4KC2A 1ZI4A 2Y4KA 2WVMA 5I1FA 3R2WA 5C4FA 1G2VA 1ON8A 4AAWA 1PZYB 4C2SA 1WSZA 5CMFX 2OEFA 4MIXA 1G97A 3POLA 2J0AA 2Y4JA 3U2XA 1GQCA 3SXBA 2Y7AA 4ARWA 4IRPA 4HO4A 4HG6A 3N9WA 1ZJPA 2PGVA 4B2XA 3D8VA 3R3IA 1ZHJA 1HM8A 3USRA 4MNDA 2JCLA 1WT1A 1E5KA 2RIYA 5CMHA 3RSBA 1MP3A 4M2BA 1G9RA 1H5TB 4G3SA 1TVYA 1FR8A 2P72A 3FOQA 3I0IX 4DE7A 2VD4A 3V90A 1R7TA 3SXAA 4ASJA 4EEOA 1ZDGA 1YP4A 4FRAA 2VS4A 3CKVA 3JUJA 2V0HA 1VGWA 4G3QA 3SPTA 2X5SA 2YESA 4M28A 2GGQA 4FQWA 3USQA 1ZCTA 1QGQA 4KC4A 2NXVA 1VGZA 3GUEA 1G0RA 1ZCYA 4D11A 2WGZA 4Y7UA 5C3AA 2W0WA 2RJ4A 1H5SC 4IRQA 1MC3A 5C38A 2YQJA 5C49A 1FO9A 3PKQA 4FRBA 3IOIA 2AM5A 1H5TA 1H4CA 1R7XA 4Y7VA 3SXGA 4FIYA 1LZIA 2PA4A 1QGSA 4J18A 1VGUA 4FRLA 4HCQA 5DDTA 1WT0A 1V84A 5FYEA 2E3DA 5DDVA 4HO0A 1EZIA 1H4EA 2AH9A 2DPWA 2I7BA 2BO8A 4B3UA 3BRKX 1H7HA 3V8YA 1HM9A 2W0VA 3IOHA 1ZJ0A 2APCA 3V0OA 4Y7GA 3FWWA 1LZJA 2XWNA 1NKHB 3OAMA 4UEGA 5C4DA 3SXCA 4KNXA 3DK5A 2FYAA 5L6VA 3F1CA 2E8BA 4O6NA 3CKJA 1FO8A 1INIA 4Y7FA 4EE5A 4EEMA 3OKRA 2ICYA 3SX7A 1FZWA 5FUHA 1XHBA 1R7VA 5AJPA 2YCMA 5D92A 3D5NA 5BXCA 5EJZA 2WVKA 4EEGA 5C47A 1O23B 3U2WA 1JVDA 2AE7A 1ON6A 4LW3A 2X60A 3I0GA 2A8WA 1WT2A 2VS5A 2VXMA 3V8ZA 5FTSA 5CQOA 1H7FA 4B42A 3OH1A 4NALA 2GGOA 2YC5A 2ZU9A 4NANA 3V0PA 1LL3A 1MP4A 3U2TA 1TZFA 5J49A 2YQSA 4FROA 1IIMA 1H5SD 1IINA 2FYCB 1FG5N 4CJBA 1NMMB 3V0LA 4FRHA 4B4MA 4G87A 2WVLA 1EYRA 3V0NA 3OH3A 2Y6PA 1R7YA 3V0MA 2OI5A 4FIXA 5C1HA 3ZGGA 1MP5A 2QGIA 2RJ9A 1GWWA 2YC3A 4Y7TA 3Q7UA 3CU0A 2O1GA 1FXJA 4B2WA 1ZDFA 4EE3A 1GA8A 1VPAA 1ZI5A 1H7EA 2ZU8A 2O1FA 3SXDA 3OH0A 1V83A 1O0RA 2VSHA 1VM8A 3IOJA 5CMIA 2FY7A 1ZJ3A 2Z86A 1W57A 5C8RA 3EE5A 4EEAA 2PGYA 3TQDA 3F1YA 3ZGFA 4G3PA 4DECA 1HJJA 1H4DA 1G1LA 5C3DA 4KPXA 2P73A 1G8OA 4FRPA 2PX7A 3K8DA 1VZXA 1XZ6A 3T7OA 2FYDB 1JV1A 2ICXA 5C4CA 2P6WA 2FFUA 1WVCA 4B5BA 5IFYA 1FXOA 4JISA 1LL2A 3V91A 4YS8A 5C48A 1GX0A 5FU8A 2VK9A 1FWYA 1FR9A 5EIYA 3I0KA 3KIAA 1G3LA 1O7OA 4ECMA 4O6MA 1ZJ2A 2XWLA 2O1HA 3E26A 1R82A 3SX3A 1LZ7A 1K4VA 1YROB 3SX5A 1HJLA 4BQHA 3E25A 4KT7A 4NAKA 4KC1A 1ZI1A 2BO7A 4NAIA 1FGGA 2AM4A 2FFVA 1Z90A 2QH5A 2YQCA 3I0HA 4HOCA 3ZLLA 4LW6A 1ZI3A 3U0XA 2VFZA 5CMJA 3JTJA 1H5SB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LZ0 A;  4Y62 A;  2Q4J A;  1W55 A;  4HO3 A;  2AES A;  4AC3 A;  4KXO A;  4HO5 A;  1VGT A;  5EJ1 A;  1R7U A;  5CQM X;  2AGD A;  4CJ8 A;  2WEE A;  2I5E A;  4D11 C;  2BO4 A;  2VSI A;  5IDT A;  4D0Z A;  2QKX A;  3LW6 A;  5CMG X;  4KQL A;  1SS9 A;  1LVW A;  3DUV A;  4FCU A;  4CJC A;  4MYB A;  5C1L A;  1JVG A;  2RJ1 A;  4AYJ A;  3RMW A;  4E1K A;  1TW5 A;  3I0F A;  4FRQ A;  3I0J A;  2V0L A;  4JD0 A;  3ST8 A;  2YQH A;  1H5S A;  1TW1 A;  3RMV A;  2Y4M A;  1R81 A;  3HL3 A;  4DDZ A;  3OH4 A;  4B4B A;  3QVB A;  1H7G A;  2XME A;  2MZB A;  4M4K A;  4HO6 A;  3SX8 A;  1ZJ1 A;  2I5K A;  5C36 A;  3CKQ A;  3D98 A;  1VH1 A;  3OGZ A;  4R7P A;  2XWM A;  2RJ0 A;  4ASY A;  1WT3 A;  1R80 A;  1H5R B;  2WAW A;  1QWJ A;  1HM0 A;  3CGX A;  4XWI A;  1FRW A;  4Y6U A;  3U0Y A;  1FOA A;  1ZIZ A;  4P02 A;  1INJ A;  4B4G A;  2X65 A;  5FTV A;  2ZU7 A;  3U2U A;  4EVW A;  1H7Q A;  3I0E A;  1NWG B;  5C3B A;  2RIZ A;  4EE4 A;  2D7R A;  1OMZ A;  4FRD A;  2Z87 A;  4P00 A;  1O7Q A;  1H3M A;  2FYB A;  2OEG A;  1YP2 A;  2RIT A;  3CKN A;  3OC9 A;  1FGX A;  4KRV A;  4KNR A;  1JYL A;  2OI7 A;  1NF5 B;  1H5R A;  4FRM A;  1ZCV A;  3NGW A;  5HS2 A;  2V0I A;  3DJ4 A;  4L41 C;  4K6R A;  2RJ7 A;  2RJ8 A;  4AYL A;  2JCO A;  3T7M A;  2JCJ A;  2RJ5 A;  4HO2 A;  2WE9 A;  1VIC A;  1GX4 A;  1NQI B;  5CQP A;  1G23 A;  1S4O A;  1S4P A;  2VXL A;  2XMH A;  3ZF8 A;  1QG8 A;  2D7I A;  5CQN X;  1PZT A;  4D48 A;  3PNN A;  1JV3 A;  3V0Q A;  5C4B A;  2V0J A;  4HO9 A;  1ZCU A;  4KPZ A;  3I0C A;  2BO6 A;  4GBP A;  1G95 A;  4Y64 A;  1H7T A;  4M2A A;  2JCK A;  5AJN A;  3ZLK A;  5C4E A;  3SXE A;  3O3P A;  1H7L A;  1VH3 A;  1JYK A;  1OQM B;  2OI6 A;  2A8U A;  2RIX A;  3Q4S A;  5FV9 A;  4Y9X A;  2V0K A;  5FU0 A;  2RJ6 A;  3U2V A;  4Y6N A;  1W77 A;  3I0L A;  4BMA A;  5JQQ A;  1NHE B;  2AM3 A;  2CU2 A;  1ZJO A;  5IDS A;  1OMX A;  1G93 A;  3PKP A;  3BCV A;  1GQ9 A;  3OH2 A;  4HO8 A;  5L6S A;  4FCE A;  1GWV A;  4ZDQ A;  2AEC A;  1V82 A;  5C1G A;  3I0D A;  2UX8 A;  2Y4L A;  3Q80 A;  4CVH A;  1YP3 A;  1VZU A;  3JUK A;  1S4N A;  2VS3 A;  4D0T A;  1KWS A;  2D0J A;  1HV9 A;  5CQL X;  3CKO A;  3T7N A;  1VZT A;  4Y63 A;  3K8E A;  4FRE A;  5AJO A;  2X5Z A;  1I52 A;  1LL0 A;  3TZT A;  4KC2 A;  1ZI4 A;  2Y4K A;  2WVM A;  5I1F A;  3R2W A;  5C4F A;  1G2V A;  1ON8 A;  4AAW A;  1PZY B;  4C2S A;  1WSZ A;  5CMF X;  2OEF A;  1G97 A;  3POL A;  2Y4J A;  3U2X A;  1GQC A;  3SXB A;  2Y7A A;  4ARW A;  4IRP A;  4HO4 A;  4HG6 A;  3N9W A;  1ZJP A;  2PGV A;  4B2X A;  3D8V A;  3R3I A;  1ZHJ A;  1HM8 A;  3USR A;  4MND A;  2JCL A;  1WT1 A;  1E5K A;  2RIY A;  5CMH A;  3RSB A;  1MP3 A;  4M2B A;  1G9R A;  1H5T B;  4G3S A;  1TVY A;  1FR8 A;  2P72 A;  3FOQ A;  3I0I X;  4DE7 A;  2VD4 A;  3V90 A;  1R7T A;  3SXA A;  4ASJ A;  4EEO A;  1ZDG A;  1YP4 A;  4FRA A;  2VS4 A;  3CKV A;  3JUJ A;  2V0H A;  1VGW A;  4G3Q A;  3SPT A;  2X5S A;  2YES A;  4M28 A;  2GGQ A;  4FQW A;  3USQ A;  1ZCT A;  1QGQ A;  4KC4 A;  2NXV A;  1VGZ A;  3GUE A;  1G0R A;  1ZCY A;  4D11 A;  2WGZ A;  4Y7U A;  5C3A A;  2W0W A;  2RJ4 A;  1H5S C;  4IRQ A;  1MC3 A;  5C38 A;  2YQJ A;  5C49 A;  1FO9 A;  3PKQ A;  4FRB A;  3IOI A;  2AM5 A;  1H5T A;  1H4C A;  1R7X A;  4Y7V A;  3SXG A;  1LZI A;  2PA4 A;  1QGS A;  4J18 A;  1VGU A;  4FRL A;  4HCQ A;  5DDT A;  1WT0 A;  1V84 A;  5FYE A;  2E3D A;  5DDV A;  4HO0 A;  1EZI A;  1H4E A;  2AH9 A;  2DPW A;  2I7B A;  2BO8 A;  4B3U A;  3BRK X;  1H7H A;  3V8Y A;  1HM9 A;  2W0V A;  3IOH A;  1ZJ0 A;  2APC A;  3V0O A;  4Y7G A;  3FWW A;  1LZJ A;  2XWN A;  1NKH B;  3OAM A;  4UEG A;  5C4D A;  3SXC A;  4KNX A;  3DK5 A;  2FYA A;  5L6V A;  3F1C A;  2E8B A;  3CKJ A;  1FO8 A;  1INI A;  4Y7F A;  4EE5 A;  4EEM A;  3OKR A;  2ICY A;  3SX7 A;  1FZW A;  5FUH A;  1XHB A;  1R7V A;  5AJP A;  2YCM A;  3D5N A;  5BXC A;  5EJZ A;  2WVK A;  4EEG A;  5C47 A;  1O23 B;  3U2W A;  1JVD A;  2AE7 A;  1ON6 A;  4LW3 A;  2X60 A;  3I0G A;  2A8W A;  1WT2 A;  2VS5 A;  2VXM A;  3V8Z A;  5FTS A;  5CQO A;  1H7F A;  4B42 A;  3OH1 A;  4NAL A;  2GGO A;  2YC5 A;  2ZU9 A;  4NAN A;  3V0P A;  1LL3 A;  1MP4 A;  3U2T A;  1TZF A;  5J49 A;  2YQS A;  4FRO A;  1IIM A;  1H5S D;  1IIN A;  2FYC B;  1FG5 N;  4CJB A;  1NMM B;  3V0L A;  4FRH A;  4B4M A;  4G87 A;  2WVL A;  1EYR A;  3V0N A;  3OH3 A;  2Y6P A;  1R7Y A;  3V0M A;  2OI5 A;  5C1H A;  3ZGG A;  1MP5 A;  2QGI A;  2RJ9 A;  1GWW A;  2YC3 A;  4Y7T A;  3Q7U A;  3CU0 A;  2O1G A;  1FXJ A;  4B2W A;  1ZDF A;  4EE3 A;  1GA8 A;  1VPA A;  1ZI5 A;  1H7E A;  2ZU8 A;  2O1F A;  3SXD A;  3OH0 A;  1V83 A;  1O0R A;  2VSH A;  1VM8 A;  3IOJ A;  5CMI A;  2FY7 A;  1ZJ3 A;  2Z86 A;  1W57 A;  5C8R A;  3EE5 A;  4EEA A;  2PGY A;  3TQD A;  3F1Y A;  3ZGF A;  4G3P A;  4DEC A;  1HJJ A;  1H4D A;  1G1L A;  5C3D A;  4KPX A;  2P73 A;  1G8O A;  4FRP A;  2PX7 A;  3K8D A;  1VZX A;  1XZ6 A;  3T7O A;  2FYD B;  1JV1 A;  2ICX A;  5C4C A;  2P6W A;  2FFU A;  1WVC A;  4B5B A;  5IFY A;  1FXO A;  4JIS A;  1LL2 A;  3V91 A;  4YS8 A;  5C48 A;  1GX0 A;  5FU8 A;  1FWY A;  1FR9 A;  5EIY A;  3I0K A;  3KIA A;  1G3L A;  1O7O A;  4ECM A;  1ZJ2 A;  2XWL A;  2O1H A;  3E26 A;  1R82 A;  3SX3 A;  1LZ7 A;  1K4V A;  1YRO B;  3SX5 A;  1HJL A;  4BQH A;  3E25 A;  4KT7 A;  4NAK A;  4KC1 A;  1ZI1 A;  2BO7 A;  4NAI A;  1FGG A;  2AM4 A;  2FFV A;  1Z90 A;  2QH5 A;  2YQC A;  3I0H A;  4HOC A;  3ZLL A;  4LW6 A;  1ZI3 A;  3U0X A;  2VFZ A;  5CMJ A;  3JTJ A;  1H5S B; 
#chains in the Genus database with same CATH topology
 1LZ0 A;  4Y62 A;  2Q4J A;  1W55 A;  4HO3 A;  2AES A;  4AC3 A;  4KXO A;  4HO5 A;  1VGT A;  5EJ1 A;  1R7U A;  4Q7C A;  5CQM X;  2AGD A;  4CJ8 A;  2WEE A;  2I5E A;  4D11 C;  2BO4 A;  2VSI A;  5IDT A;  2C0N A;  4D0Z A;  2QKX A;  3LW6 A;  5CMG X;  4KQL A;  1SS9 A;  1LVW A;  3DUV A;  4FCU A;  4CJC A;  4MYB A;  5C1L A;  1JVG A;  2RJ1 A;  4AYJ A;  3RMW A;  4E1K A;  1TW5 A;  3I0F A;  4FRQ A;  3I0J A;  2V0L A;  4JD0 A;  3ST8 A;  2YQH A;  1H5S A;  1TW1 A;  3RMV A;  2Y4M A;  1R81 A;  3HL3 A;  4DDZ A;  3OH4 A;  4B4B A;  3QVB A;  1H7G A;  2XME A;  2MZB A;  4M4K A;  4HO6 A;  3SX8 A;  1ZJ1 A;  2I5K A;  5C36 A;  3CKQ A;  3D98 A;  1VH1 A;  3OGZ A;  4R7P A;  2XWM A;  2RJ0 A;  4ASY A;  1WT3 A;  1R80 A;  1H5R B;  2WAW A;  1QWJ A;  1HM0 A;  3CGX A;  4XWI A;  1FRW A;  4Y6U A;  3U0Y A;  2J0B A;  1FOA A;  1ZIZ A;  4P02 A;  1INJ A;  4B4G A;  2X65 A;  5FTV A;  2ZU7 A;  3U2U A;  4EVW A;  1H7Q A;  3I0E A;  1NWG B;  5C3B A;  2RIZ A;  4EE4 A;  2D7R A;  1OMZ A;  4FRD A;  2Z87 A;  4P00 A;  1O7Q A;  1H3M A;  2FYB A;  2OEG A;  1YP2 A;  2RIT A;  3CKN A;  3OC9 A;  1FGX A;  4KRV A;  4KNR A;  1JYL A;  2OI7 A;  1NF5 B;  1H5R A;  4FRM A;  1ZCV A;  3NGW A;  5HS2 A;  2V0I A;  3DJ4 A;  4L41 C;  4K6R A;  2RJ7 A;  2RJ8 A;  4AYL A;  2JCO A;  3T7M A;  2JCJ A;  2RJ5 A;  4HO2 A;  2WE9 A;  1VIC A;  1GX4 A;  1NQI B;  5CQP A;  1G23 A;  1S4O A;  1S4P A;  2VXL A;  2XMH A;  5D91 A;  3ZF8 A;  1QG8 A;  2D7I A;  5CQN X;  1PZT A;  4D48 A;  3PNN A;  1JV3 A;  3V0Q A;  5C4B A;  2V0J A;  4HO9 A;  1ZCU A;  4KPZ A;  3I0C A;  2BO6 A;  4GBP A;  1G95 A;  4Y64 A;  1H7T A;  4M2A A;  2JCK A;  5AJN A;  3ZLK A;  5C4E A;  3SXE A;  3O3P A;  1H7L A;  1VH3 A;  1JYK A;  1OQM B;  2OI6 A;  2A8U A;  2RIX A;  3Q4S A;  5FV9 A;  4Y9X A;  2V0K A;  5FU0 A;  2RJ6 A;  3U2V A;  4Y6N A;  1W77 A;  3I0L A;  4BMA A;  5JQQ A;  1NHE B;  2AM3 A;  2CU2 A;  1ZJO A;  5IDS A;  1OMX A;  1G93 A;  3PKP A;  3BCV A;  1GQ9 A;  3OH2 A;  4HO8 A;  5L6S A;  4FCE A;  1GWV A;  4ZDQ A;  2AEC A;  1V82 A;  5C1G A;  3I0D A;  2UX8 A;  2Y4L A;  3Q80 A;  4CVH A;  1YP3 A;  1VZU A;  3JUK A;  1S4N A;  2VS3 A;  4D0T A;  1KWS A;  2D0J A;  1HV9 A;  5CQL X;  3CKO A;  3T7N A;  1VZT A;  4Y63 A;  3K8E A;  4FRE A;  5AJO A;  2X5Z A;  1I52 A;  1LL0 A;  3TZT A;  4KC2 A;  1ZI4 A;  2Y4K A;  2WVM A;  5I1F A;  3R2W A;  5C4F A;  1G2V A;  1ON8 A;  4AAW A;  1PZY B;  4C2S A;  1WSZ A;  5CMF X;  2OEF A;  4MIX A;  1G97 A;  3POL A;  2J0A A;  2Y4J A;  3U2X A;  1GQC A;  3SXB A;  2Y7A A;  4ARW A;  4IRP A;  4HO4 A;  4HG6 A;  3N9W A;  1ZJP A;  2PGV A;  4B2X A;  3D8V A;  3R3I A;  1ZHJ A;  1HM8 A;  3USR A;  4MND A;  2JCL A;  1WT1 A;  1E5K A;  2RIY A;  5CMH A;  3RSB A;  1MP3 A;  4M2B A;  1G9R A;  1H5T B;  4G3S A;  1TVY A;  1FR8 A;  2P72 A;  3FOQ A;  3I0I X;  4DE7 A;  2VD4 A;  3V90 A;  1R7T A;  3SXA A;  4ASJ A;  4EEO A;  1ZDG A;  1YP4 A;  4FRA A;  2VS4 A;  3CKV A;  3JUJ A;  2V0H A;  1VGW A;  4G3Q A;  3SPT A;  2X5S A;  2YES A;  4M28 A;  2GGQ A;  4FQW A;  3USQ A;  1ZCT A;  1QGQ A;  4KC4 A;  2NXV A;  1VGZ A;  3GUE A;  1G0R A;  1ZCY A;  4D11 A;  2WGZ A;  4Y7U A;  5C3A A;  2W0W A;  2RJ4 A;  1H5S C;  4IRQ A;  1MC3 A;  5C38 A;  2YQJ A;  5C49 A;  1FO9 A;  3PKQ A;  4FRB A;  3IOI A;  2AM5 A;  1H5T A;  1H4C A;  1R7X A;  4Y7V A;  3SXG A;  4FIY A;  1LZI A;  2PA4 A;  1QGS A;  4J18 A;  1VGU A;  4FRL A;  4HCQ A;  5DDT A;  1WT0 A;  1V84 A;  5FYE A;  2E3D A;  5DDV A;  4HO0 A;  1EZI A;  1H4E A;  2AH9 A;  2DPW A;  2I7B A;  2BO8 A;  4B3U A;  3BRK X;  1H7H A;  3V8Y A;  1HM9 A;  2W0V A;  3IOH A;  1ZJ0 A;  2APC A;  3V0O A;  4Y7G A;  3FWW A;  1LZJ A;  2XWN A;  1NKH B;  3OAM A;  4UEG A;  5C4D A;  3SXC A;  4KNX A;  3DK5 A;  2FYA A;  5L6V A;  3F1C A;  2E8B A;  4O6N A;  3CKJ A;  1FO8 A;  1INI A;  4Y7F A;  4EE5 A;  4EEM A;  3OKR A;  2ICY A;  3SX7 A;  1FZW A;  5FUH A;  1XHB A;  1R7V A;  5AJP A;  2YCM A;  5D92 A;  3D5N A;  5BXC A;  5EJZ A;  2WVK A;  4EEG A;  5C47 A;  1O23 B;  3U2W A;  1JVD A;  2AE7 A;  1ON6 A;  4LW3 A;  2X60 A;  3I0G A;  2A8W A;  1WT2 A;  2VS5 A;  2VXM A;  3V8Z A;  5FTS A;  5CQO A;  1H7F A;  4B42 A;  3OH1 A;  4NAL A;  2GGO A;  2YC5 A;  2ZU9 A;  4NAN A;  3V0P A;  1LL3 A;  1MP4 A;  3U2T A;  1TZF A;  5J49 A;  2YQS A;  4FRO A;  1IIM A;  1H5S D;  1IIN A;  2FYC B;  1FG5 N;  4CJB A;  1NMM B;  3V0L A;  4FRH A;  4B4M A;  4G87 A;  2WVL A;  1EYR A;  3V0N A;  3OH3 A;  2Y6P A;  1R7Y A;  3V0M A;  2OI5 A;  4FIX A;  5C1H A;  3ZGG A;  1MP5 A;  2QGI A;  2RJ9 A;  1GWW A;  2YC3 A;  4Y7T A;  3Q7U A;  3CU0 A;  2O1G A;  1FXJ A;  4B2W A;  1ZDF A;  4EE3 A;  1GA8 A;  1VPA A;  1ZI5 A;  1H7E A;  2ZU8 A;  2O1F A;  3SXD A;  3OH0 A;  1V83 A;  1O0R A;  2VSH A;  1VM8 A;  3IOJ A;  5CMI A;  2FY7 A;  1ZJ3 A;  2Z86 A;  1W57 A;  5C8R A;  3EE5 A;  4EEA A;  2PGY A;  3TQD A;  3F1Y A;  3ZGF A;  4G3P A;  4DEC A;  1HJJ A;  1H4D A;  1G1L A;  5C3D A;  4KPX A;  2P73 A;  1G8O A;  4FRP A;  2PX7 A;  3K8D A;  1VZX A;  1XZ6 A;  3T7O A;  2FYD B;  1JV1 A;  2ICX A;  5C4C A;  2P6W A;  2FFU A;  1WVC A;  4B5B A;  5IFY A;  1FXO A;  4JIS A;  1LL2 A;  3V91 A;  4YS8 A;  5C48 A;  1GX0 A;  5FU8 A;  2VK9 A;  1FWY A;  1FR9 A;  5EIY A;  3I0K A;  3KIA A;  1G3L A;  1O7O A;  4ECM A;  4O6M A;  1ZJ2 A;  2XWL A;  2O1H A;  3E26 A;  1R82 A;  3SX3 A;  1LZ7 A;  1K4V A;  1YRO B;  3SX5 A;  1HJL A;  4BQH A;  3E25 A;  4KT7 A;  4NAK A;  4KC1 A;  1ZI1 A;  2BO7 A;  4NAI A;  1FGG A;  2AM4 A;  2FFV A;  1Z90 A;  2QH5 A;  2YQC A;  3I0H A;  4HOC A;  3ZLL A;  4LW6 A;  1ZI3 A;  3U0X A;  2VFZ A;  5CMJ A;  3JTJ A;  1H5S B; 
#chains in the Genus database with same CATH homology
 1LZ0 A;  4Y62 A;  2Q4J A;  1W55 A;  4HO3 A;  2AES A;  4AC3 A;  4KXO A;  4HO5 A;  1VGT A;  5EJ1 A;  1R7U A;  4Q7C A;  5CQM X;  2AGD A;  4CJ8 A;  2WEE A;  2I5E A;  4D11 C;  2BO4 A;  2VSI A;  5IDT A;  2C0N A;  4D0Z A;  2QKX A;  3LW6 A;  5CMG X;  4KQL A;  1SS9 A;  1LVW A;  3DUV A;  4FCU A;  4CJC A;  4MYB A;  5C1L A;  1JVG A;  2RJ1 A;  4AYJ A;  3RMW A;  4E1K A;  1TW5 A;  3I0F A;  4FRQ A;  3I0J A;  2V0L A;  4JD0 A;  3ST8 A;  2YQH A;  1H5S A;  1TW1 A;  3RMV A;  2Y4M A;  1R81 A;  3HL3 A;  4DDZ A;  3OH4 A;  4B4B A;  3QVB A;  1H7G A;  2XME A;  2MZB A;  4M4K A;  4HO6 A;  3SX8 A;  1ZJ1 A;  2I5K A;  5C36 A;  3CKQ A;  3D98 A;  1VH1 A;  3OGZ A;  4R7P A;  2XWM A;  2RJ0 A;  4ASY A;  1WT3 A;  1R80 A;  1H5R B;  2WAW A;  1QWJ A;  1HM0 A;  3CGX A;  4XWI A;  1FRW A;  4Y6U A;  3U0Y A;  2J0B A;  1FOA A;  1ZIZ A;  4P02 A;  1INJ A;  4B4G A;  2X65 A;  5FTV A;  2ZU7 A;  3U2U A;  4EVW A;  1H7Q A;  3I0E A;  1NWG B;  5C3B A;  2RIZ A;  4EE4 A;  2D7R A;  1OMZ A;  4FRD A;  2Z87 A;  4P00 A;  1O7Q A;  1H3M A;  2FYB A;  2OEG A;  1YP2 A;  2RIT A;  3CKN A;  3OC9 A;  1FGX A;  4KRV A;  4KNR A;  1JYL A;  2OI7 A;  1NF5 B;  1H5R A;  4FRM A;  1ZCV A;  3NGW A;  5HS2 A;  2V0I A;  3DJ4 A;  4L41 C;  4K6R A;  2RJ7 A;  2RJ8 A;  4AYL A;  2JCO A;  3T7M A;  2JCJ A;  2RJ5 A;  4HO2 A;  2WE9 A;  1VIC A;  1GX4 A;  1NQI B;  5CQP A;  1G23 A;  1S4O A;  1S4P A;  2VXL A;  2XMH A;  5D91 A;  3ZF8 A;  1QG8 A;  2D7I A;  5CQN X;  1PZT A;  4D48 A;  3PNN A;  1JV3 A;  3V0Q A;  5C4B A;  2V0J A;  4HO9 A;  1ZCU A;  4KPZ A;  3I0C A;  2BO6 A;  4GBP A;  1G95 A;  4Y64 A;  1H7T A;  4M2A A;  2JCK A;  5AJN A;  3ZLK A;  5C4E A;  3SXE A;  3O3P A;  1H7L A;  1VH3 A;  1JYK A;  1OQM B;  2OI6 A;  2A8U A;  2RIX A;  3Q4S A;  5FV9 A;  4Y9X A;  2V0K A;  5FU0 A;  2RJ6 A;  3U2V A;  4Y6N A;  1W77 A;  3I0L A;  4BMA A;  5JQQ A;  1NHE B;  2AM3 A;  2CU2 A;  1ZJO A;  5IDS A;  1OMX A;  1G93 A;  3PKP A;  3BCV A;  1GQ9 A;  3OH2 A;  4HO8 A;  5L6S A;  4FCE A;  1GWV A;  4ZDQ A;  2AEC A;  1V82 A;  5C1G A;  3I0D A;  2UX8 A;  2Y4L A;  3Q80 A;  4CVH A;  1YP3 A;  1VZU A;  3JUK A;  1S4N A;  2VS3 A;  4D0T A;  1KWS A;  2D0J A;  1HV9 A;  5CQL X;  3CKO A;  3T7N A;  1VZT A;  4Y63 A;  3K8E A;  4FRE A;  5AJO A;  2X5Z A;  1I52 A;  1LL0 A;  3TZT A;  4KC2 A;  1ZI4 A;  2Y4K A;  2WVM A;  5I1F A;  3R2W A;  5C4F A;  1G2V A;  1ON8 A;  4AAW A;  1PZY B;  4C2S A;  1WSZ A;  5CMF X;  2OEF A;  4MIX A;  1G97 A;  3POL A;  2J0A A;  2Y4J A;  3U2X A;  1GQC A;  3SXB A;  2Y7A A;  4ARW A;  4IRP A;  4HO4 A;  4HG6 A;  3N9W A;  1ZJP A;  2PGV A;  4B2X A;  3D8V A;  3R3I A;  1ZHJ A;  1HM8 A;  3USR A;  4MND A;  2JCL A;  1WT1 A;  1E5K A;  2RIY A;  5CMH A;  3RSB A;  1MP3 A;  4M2B A;  1G9R A;  1H5T B;  4G3S A;  1TVY A;  1FR8 A;  2P72 A;  3FOQ A;  3I0I X;  4DE7 A;  2VD4 A;  3V90 A;  1R7T A;  3SXA A;  4ASJ A;  4EEO A;  1ZDG A;  1YP4 A;  4FRA A;  2VS4 A;  3CKV A;  3JUJ A;  2V0H A;  1VGW A;  4G3Q A;  3SPT A;  2X5S A;  2YES A;  4M28 A;  2GGQ A;  4FQW A;  3USQ A;  1ZCT A;  1QGQ A;  4KC4 A;  2NXV A;  1VGZ A;  3GUE A;  1G0R A;  1ZCY A;  4D11 A;  2WGZ A;  4Y7U A;  5C3A A;  2W0W A;  2RJ4 A;  1H5S C;  4IRQ A;  1MC3 A;  5C38 A;  2YQJ A;  5C49 A;  1FO9 A;  3PKQ A;  4FRB A;  3IOI A;  2AM5 A;  1H5T A;  1H4C A;  1R7X A;  4Y7V A;  3SXG A;  4FIY A;  1LZI A;  2PA4 A;  1QGS A;  4J18 A;  1VGU A;  4FRL A;  4HCQ A;  5DDT A;  1WT0 A;  1V84 A;  5FYE A;  2E3D A;  5DDV A;  4HO0 A;  1EZI A;  1H4E A;  2AH9 A;  2DPW A;  2I7B A;  2BO8 A;  4B3U A;  3BRK X;  1H7H A;  3V8Y A;  1HM9 A;  2W0V A;  3IOH A;  1ZJ0 A;  2APC A;  3V0O A;  4Y7G A;  3FWW A;  1LZJ A;  2XWN A;  1NKH B;  3OAM A;  4UEG A;  5C4D A;  3SXC A;  4KNX A;  3DK5 A;  2FYA A;  5L6V A;  3F1C A;  2E8B A;  4O6N A;  3CKJ A;  1FO8 A;  1INI A;  4Y7F A;  4EE5 A;  4EEM A;  3OKR A;  2ICY A;  3SX7 A;  1FZW A;  5FUH A;  1XHB A;  1R7V A;  5AJP A;  2YCM A;  5D92 A;  3D5N A;  5BXC A;  5EJZ A;  2WVK A;  4EEG A;  5C47 A;  1O23 B;  3U2W A;  1JVD A;  2AE7 A;  1ON6 A;  4LW3 A;  2X60 A;  3I0G A;  2A8W A;  1WT2 A;  2VS5 A;  2VXM A;  3V8Z A;  5FTS A;  5CQO A;  1H7F A;  4B42 A;  3OH1 A;  4NAL A;  2GGO A;  2YC5 A;  2ZU9 A;  4NAN A;  3V0P A;  1LL3 A;  1MP4 A;  3U2T A;  1TZF A;  5J49 A;  2YQS A;  4FRO A;  1IIM A;  1H5S D;  1IIN A;  2FYC B;  1FG5 N;  4CJB A;  1NMM B;  3V0L A;  4FRH A;  4B4M A;  4G87 A;  2WVL A;  1EYR A;  3V0N A;  3OH3 A;  2Y6P A;  1R7Y A;  3V0M A;  2OI5 A;  4FIX A;  5C1H A;  3ZGG A;  1MP5 A;  2QGI A;  2RJ9 A;  1GWW A;  2YC3 A;  4Y7T A;  3Q7U A;  3CU0 A;  2O1G A;  1FXJ A;  4B2W A;  1ZDF A;  4EE3 A;  1GA8 A;  1VPA A;  1ZI5 A;  1H7E A;  2ZU8 A;  2O1F A;  3SXD A;  3OH0 A;  1V83 A;  1O0R A;  2VSH A;  1VM8 A;  3IOJ A;  5CMI A;  2FY7 A;  1ZJ3 A;  2Z86 A;  1W57 A;  5C8R A;  3EE5 A;  4EEA A;  2PGY A;  3TQD A;  3F1Y A;  3ZGF A;  4G3P A;  4DEC A;  1HJJ A;  1H4D A;  1G1L A;  5C3D A;  4KPX A;  2P73 A;  1G8O A;  4FRP A;  2PX7 A;  3K8D A;  1VZX A;  1XZ6 A;  3T7O A;  2FYD B;  1JV1 A;  2ICX A;  5C4C A;  2P6W A;  2FFU A;  1WVC A;  4B5B A;  5IFY A;  1FXO A;  4JIS A;  1LL2 A;  3V91 A;  4YS8 A;  5C48 A;  1GX0 A;  5FU8 A;  2VK9 A;  1FWY A;  1FR9 A;  5EIY A;  3I0K A;  3KIA A;  1G3L A;  1O7O A;  4ECM A;  4O6M A;  1ZJ2 A;  2XWL A;  2O1H A;  3E26 A;  1R82 A;  3SX3 A;  1LZ7 A;  1K4V A;  1YRO B;  3SX5 A;  1HJL A;  4BQH A;  3E25 A;  4KT7 A;  4NAK A;  4KC1 A;  1ZI1 A;  2BO7 A;  4NAI A;  1FGG A;  2AM4 A;  2FFV A;  1Z90 A;  2QH5 A;  2YQC A;  3I0H A;  4HOC A;  3ZLL A;  4LW6 A;  1ZI3 A;  3U0X A;  2VFZ A;  5CMJ A;  3JTJ A;  1H5S B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...