3QVBA

Crystal structure of human glycogenin-1 (gyg1) complexed with manganese and udp
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
263
structure length
251
Chain Sequence
SMTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSILPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSTHPEFLILWWNIFTTNVLPLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycogenin-1
publication title Conformational plasticity of glycogenin and its maltosaccharide substrate during glycogen biogenesis.
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 251
sequence length 263
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2011-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3qvbA00
1VZXA 3CKOA 3IOHA 3U2XA 1FGXA 2YC5A 4Y9XA 1WT0A 2OI6A 4B2XA 2OI5A 1GX0A 1O7QA 1ZCTA 2YQHA 3OH3A 4FROA 1NMMB 5BXCA 2RJ6A 4DECA 2WE9A 5CQMX 3I0GA 2RIYA 2D7RA 3U0YA 1NQIB 2I7BA 5CMIA 1OMXA 2P73A 1IIMA 3OAMA 5C1HA 3QVBA 2GGQA 2AGDA 2Z87A 1S4PA 3JUJA 5C47A 1R80A 1R7UA 1V83A 2PA4A 1LL2A 2V0IA 3U2WA 4ECMA 4DDZA 2ZU9A 1G8OA 3SXGA 5CQLX 5FUHA 2WVLA 3K8EA 3USQA 2AE7A 4IRQA 2QH5A 4B42A 4HO2A 4M2BA 1VH3A 1FO9A 1QG8A 1V82A 4MYBA 2O1GA 5C1GA 4B4BA 2XWLA 1LL0A 4FRBA 5C4CA 3T7NA 3Q4SA 1INIA 3SX5A 3USRA 3K8DA 2P6WA 3SXDA 5AJNA 4D0ZA 1FO8A 2ICYA 2XMEA 4Y7VA 4AYLA 1XHBA 3I0CA 1TW5A 1H7HA 4FRQA 4EE3A 4Y7GA 1VGZA 3I0JA 1NF5B 2AM4A 1JYKA 1HJLA 3V8YA 5IDTA 1PZYB 1NHEB 1H4EA 4HO4A 1SS9A 4FRHA 1QWJA 4MNDA 3OKRA 1JV1A 3T7OA 4EEMA 5L6VA 2RIZA 2UX8A 2FYDB 3CKNA 1YP4A 4HO9A 4HO0A 3IOJA 4NAKA 3V90A 4EEGA 4HOCA 1K4VA 4B3UA 2QKXA 3V0LA 2APCA 2BO6A 4M4KA 2AESA 1S4OA 4KNXA 1H7GA 1VM8A 1O23B 1R7TA 1YP2A 1WSZA 3LW6A 2Y4JA 5FU8A 1FXOA 1ZI4A 2DPWA 1EZIA 1ZJ1A 2V0LA 3D5NA 1E5KA 3PKPA 4P02A 2A8UA 2VS4A 4LW6A 1V84A 4K6RA 4YS8A 1HM8A 5C3BA 1S4NA 2JCLA 3OGZA 2V0KA 4Y64A 3JTJA 1GWWA 3POLA 4FCUA 4Y6NA 4CJBA 1HV9A 1ZJPA 5C3DA 2NXVA 4KPXA 4ZDQA 5C38A 2Y4LA 2AM5A 2VSHA 4Y7UA 4B5BA 4NALA 2A8WA 2I5KA 1GQCA 4Y7TA 2JCOA 2RJ0A 3R3IA 3SXBA 5DDTA 3OH0A 4EE4A 1H7FA 3SX8A 2P72A 4KRVA 1G97A 1G93A 3V0MA 1H5TB 2JCJA 3U2UA 3TZTA 4AC3A 4G3QA 1W55A 1NWGB 1ZDFA 1MC3A 1LZ7A 3F1CA 1ZJ0A 5CQOA 2BO7A 4KPZA 4JD0A 2WVMA 1YP3A 2WAWA 1LL3A 2XMHA 4ARWA 1HM9A 3V0PA 1WVCA 3CGXA 1ZJOA 1TZFA 4KC2A 2YCMA 4B4GA 3PKQA 1H7TA 4IRPA 4EE5A 4UEGA 2YQSA 2VFZA 2ZU7A 4FQWA 5C4DA 4KXOA 1VH1A 2D0JA 1GX4A 2PGYA 3GUEA 4B4MA 2RJ5A 2YESA 3CU0A 2X5ZA 2VS5A 4M2AA 1ZDGA 4JISA 1QGQA 4FRAA 4KC1A 3ZLLA 1H5TA 1FGGA 4M28A 5CMGX 4GBPA 4HCQA 4B2WA 5CQPA 5JQQA 4FCEA 1H5SD 3CKQA 2W0WA 1ZCVA 4LW3A 3FWWA 1HM0A 1WT1A 3SXAA 2WGZA 1VPAA 4R7PA 3R2WA 3CKJA 5C4BA 1H7EA 2RITA 2YC3A 1VZUA 1R7YA 3JUKA 4FRMA 5FYEA 3BCVA 1WT3A 5EJ1A 1O7OA 2GGOA 3KIAA 3ZLKA 4EVWA 5C8RA 1GWVA 3ST8A 1LZIA 1FR8A 2WEEA 4KQLA 2JCKA 1PZTA 2O1FA 1H4DA 2E8BA 2XWNA 3RSBA 1I52A 1H3MA 1G1LA 2E3DA 1H7QA 2RJ4A 5C48A 1G9RA 1YROB 5IFYA 3Q80A 2VD4A 5C3AA 3T7MA 2Y6PA 4NAIA 1VGTA 1ZCYA 1LZ0A 2D7IA 1HJJA 1O0RA 1TW1A 2RJ8A 4G3PA 5DDVA 1GQ9A 3SPTA 5EIYA 4BMAA 3BRKX 2PGVA 3DK5A 3FOQA 5L6SA 5IDSA 1G3LA 1VZTA 2AM3A 4Y63A 1H7LA 1LVWA 2XWMA 1H4CA 5EJZA 3TQDA 1WT2A 4ASJA 2W0VA 1FOAA 1ZCUA 1H5RB 2YQJA 4HO8A 4DE7A 4J18A 3E26A 1R81A 3I0KA 4HO6A 1MP4A 3D98A 3V0NA 3SXCA 5CMJA 2FFUA 3IOIA 4HG6A 4CVHA 4D11C 2Q4JA 1FWYA 4EEOA 5C1LA 2RJ9A 4Y62A 3DJ4A 3I0LA 2Z86A 5CMHA 1OMZA 4D48A 2VSIA 3SX3A 2MZBA 4L41C 1W77A 2ZU8A 4FRDA 1FXJA 4EEAA 2OI7A 2OEGA 3HL3A 1JVDA 1W57A 1FZWA 2X5SA 3V91A 1H5SC 2V0HA 2YQCA 4FREA 3E25A 3SXEA 3I0FA 4Y6UA 4G87A 1KWSA 2OEFA 1OQMB 2FYCB 1IINA 1H5SB 1VICA 3DUVA 3I0DA 1EYRA 2VXMA 2FY7A 2RIXA 4CJCA 2PX7A 3V0QA 3OH2A 3SX7A 5J49A 3ZF8A 1ZI1A 4CJ8A 2Y4KA 1ZI5A 1R7XA 2QGIA 2WVKA 3U0XA 5C4FA 1QGSA 1H5RA 3ZGGA 1TVYA 5AJOA 4FRPA 1VGUA 3CKVA 2VXLA 3V0OA 1R7VA 3OH4A 1ZHJA 1FRWA 1G95A 3U2VA 1MP3A 5HS2A 4G3SA 3F1YA 2FFVA 1ON8A 1FG5N 4KNRA 3EE5A 4D11A 3Q7UA 2FYAA 5AJPA 3U2TA 3RMVA 1G0RA 1VGWA 2V0JA 4NANA 4AYJA 4FRLA 3V8ZA 3D8VA 2AH9A 3PNNA 3O3PA 4D0TA 4ASYA 3I0IX 1H5SA 3I0HA 3OC9A 5C49A 3N9WA 1Z90A 3NGWA 1JVGA 5I1FA 1G23A 4C2SA 5CMFX 1ZI3A 2ICXA 2Y4MA 1GA8A 4KC4A 1R82A 2VS3A 4Y7FA 1JV3A 2I5EA 4XWIA 5FTVA 2CU2A 2RJ1A 1ON6A 4AAWA 2BO4A 4KT7A 1INJA 2AECA 3RMWA 5C4EA 1ZIZA 1NKHB 1MP5A 3OH1A 1XZ6A 1G2VA 1ZJ2A 2RJ7A 5FU0A 1JYLA 1LZJA 4E1KA 2X60A 2X65A 5FV9A 2FYBA 3I0EA 4P00A 2O1HA 2Y7AA 4HO5A 5FTSA 5C36A 1ZJ3A 1FR9A 4BQHA 3ZGFA 4HO3A 5CQNX 2BO8A
chains in the Genus database with same CATH superfamily
1VZXA 3CKOA 3IOHA 3U2XA 1FGXA 2YC5A 4Y9XA 1WT0A 2OI6A 4B2XA 2OI5A 1GX0A 1O7QA 1ZCTA 2YQHA 3OH3A 4FROA 1NMMB 5BXCA 2RJ6A 4DECA 2WE9A 5CQMX 3I0GA 2RIYA 2D7RA 3U0YA 1NQIB 2I7BA 5CMIA 1OMXA 2P73A 1IIMA 3OAMA 5C1HA 3QVBA 2GGQA 2AGDA 2Z87A 1S4PA 3JUJA 5C47A 1R80A 1R7UA 1V83A 2PA4A 1LL2A 2V0IA 3U2WA 4ECMA 4DDZA 2ZU9A 4Q7CA 1G8OA 3SXGA 5CQLX 5FUHA 2WVLA 3K8EA 3USQA 2AE7A 4IRQA 2QH5A 4B42A 4HO2A 4M2BA 1VH3A 2VK9A 1FO9A 1QG8A 1V82A 4MYBA 2O1GA 5C1GA 4B4BA 2XWLA 1LL0A 4FRBA 5C4CA 3T7NA 3Q4SA 1INIA 3SX5A 3USRA 3K8DA 2P6WA 3SXDA 5AJNA 4D0ZA 1FO8A 2ICYA 2XMEA 4Y7VA 4AYLA 1XHBA 3I0CA 1TW5A 1H7HA 4FRQA 4EE3A 4Y7GA 1VGZA 3I0JA 1NF5B 5D92A 2AM4A 1JYKA 1HJLA 3V8YA 5IDTA 1PZYB 1NHEB 1H4EA 4HO4A 1SS9A 4FIYA 4FRHA 1QWJA 2C0NA 4MNDA 3OKRA 1JV1A 3T7OA 4EEMA 5L6VA 4MIXA 2RIZA 2UX8A 2FYDB 3CKNA 1YP4A 4O6MA 4HO9A 4HO0A 3IOJA 4NAKA 3V90A 4EEGA 4HOCA 1K4VA 4B3UA 2QKXA 3V0LA 2APCA 2BO6A 4M4KA 2AESA 1S4OA 4KNXA 1H7GA 1VM8A 1O23B 1R7TA 1YP2A 1WSZA 3LW6A 2Y4JA 5FU8A 1FXOA 1ZI4A 2DPWA 1EZIA 1ZJ1A 2V0LA 3D5NA 1E5KA 3PKPA 4P02A 2A8UA 2VS4A 4LW6A 4FIXA 1V84A 4K6RA 4YS8A 1HM8A 5C3BA 1S4NA 2JCLA 3OGZA 2V0KA 4Y64A 3JTJA 1GWWA 3POLA 4FCUA 4Y6NA 4CJBA 1HV9A 1ZJPA 5C3DA 2NXVA 4KPXA 4ZDQA 5C38A 2Y4LA 2AM5A 2VSHA 4Y7UA 4B5BA 4NALA 2A8WA 2I5KA 1GQCA 4Y7TA 2JCOA 2RJ0A 3R3IA 3SXBA 5DDTA 3OH0A 4EE4A 1H7FA 3SX8A 2P72A 4KRVA 1G97A 1G93A 3V0MA 1H5TB 2JCJA 3U2UA 3TZTA 4AC3A 4G3QA 1W55A 1NWGB 1ZDFA 1MC3A 1LZ7A 3F1CA 1ZJ0A 5CQOA 2BO7A 4KPZA 4JD0A 2WVMA 1YP3A 2WAWA 1LL3A 2XMHA 4ARWA 1HM9A 3V0PA 1WVCA 3CGXA 1ZJOA 1TZFA 4KC2A 2YCMA 4B4GA 3PKQA 1H7TA 4IRPA 4EE5A 4UEGA 2YQSA 2VFZA 2ZU7A 4FQWA 5C4DA 4KXOA 1VH1A 2D0JA 1GX4A 2PGYA 3GUEA 4B4MA 2RJ5A 2YESA 3CU0A 2X5ZA 2VS5A 4M2AA 1ZDGA 4JISA 1QGQA 4FRAA 4KC1A 3ZLLA 1H5TA 1FGGA 4M28A 5CMGX 4O6NA 4GBPA 4HCQA 4B2WA 5CQPA 5JQQA 4FCEA 1H5SD 3CKQA 2W0WA 1ZCVA 4LW3A 3FWWA 1HM0A 1WT1A 3SXAA 2WGZA 2J0AA 1VPAA 4R7PA 3R2WA 3CKJA 5C4BA 1H7EA 2RITA 2YC3A 1VZUA 1R7YA 3JUKA 4FRMA 5FYEA 3BCVA 1WT3A 5EJ1A 1O7OA 2GGOA 3KIAA 3ZLKA 4EVWA 5C8RA 1GWVA 3ST8A 1LZIA 1FR8A 2WEEA 4KQLA 2JCKA 1PZTA 2O1FA 1H4DA 2E8BA 2XWNA 3RSBA 1I52A 5D91A 1H3MA 1G1LA 2E3DA 1H7QA 2RJ4A 5C48A 1G9RA 1YROB 5IFYA 3Q80A 2VD4A 5C3AA 3T7MA 2J0BA 2Y6PA 4NAIA 1VGTA 1ZCYA 1LZ0A 2D7IA 1HJJA 1O0RA 1TW1A 2RJ8A 4G3PA 5DDVA 1GQ9A 3SPTA 5EIYA 4BMAA 3BRKX 2PGVA 3DK5A 3FOQA 5L6SA 5IDSA 1G3LA 1VZTA 2AM3A 4Y63A 1H7LA 1LVWA 2XWMA 1H4CA 5EJZA 3TQDA 1WT2A 4ASJA 2W0VA 1FOAA 1ZCUA 1H5RB 2YQJA 4HO8A 4DE7A 4J18A 3E26A 1R81A 3I0KA 4HO6A 1MP4A 3D98A 3V0NA 3SXCA 5CMJA 2FFUA 3IOIA 4HG6A 4CVHA 4D11C 2Q4JA 1FWYA 4EEOA 5C1LA 2RJ9A 4Y62A 3DJ4A 3I0LA 2Z86A 5CMHA 1OMZA 4D48A 2VSIA 3SX3A 2MZBA 4L41C 1W77A 2ZU8A 4FRDA 1FXJA 4EEAA 2OI7A 2OEGA 3HL3A 1JVDA 1W57A 1FZWA 2X5SA 3V91A 1H5SC 2V0HA 2YQCA 4FREA 3E25A 3SXEA 3I0FA 4Y6UA 4G87A 1KWSA 2OEFA 1OQMB 2FYCB 1IINA 1H5SB 1VICA 3DUVA 3I0DA 1EYRA 2VXMA 2FY7A 2RIXA 4CJCA 2PX7A 3V0QA 3OH2A 3SX7A 5J49A 3ZF8A 1ZI1A 4CJ8A 2Y4KA 1ZI5A 1R7XA 2QGIA 2WVKA 3U0XA 5C4FA 1QGSA 1H5RA 3ZGGA 1TVYA 5AJOA 4FRPA 1VGUA 3CKVA 2VXLA 3V0OA 1R7VA 3OH4A 1ZHJA 1FRWA 1G95A 3U2VA 1MP3A 5HS2A 4G3SA 3F1YA 2FFVA 1ON8A 1FG5N 4KNRA 3EE5A 4D11A 3Q7UA 2FYAA 5AJPA 3U2TA 3RMVA 1G0RA 1VGWA 2V0JA 4NANA 4AYJA 4FRLA 3V8ZA 3D8VA 2AH9A 3PNNA 3O3PA 4D0TA 4ASYA 3I0IX 1H5SA 3I0HA 3OC9A 5C49A 3N9WA 1Z90A 3NGWA 1JVGA 5I1FA 1G23A 4C2SA 5CMFX 1ZI3A 2ICXA 2Y4MA 1GA8A 4KC4A 1R82A 2VS3A 4Y7FA 1JV3A 2I5EA 4XWIA 5FTVA 2CU2A 2RJ1A 1ON6A 4AAWA 2BO4A 4KT7A 1INJA 2AECA 3RMWA 5C4EA 1ZIZA 1NKHB 1MP5A 3OH1A 1XZ6A 1G2VA 1ZJ2A 2RJ7A 5FU0A 1JYLA 1LZJA 4E1KA 2X60A 2X65A 5FV9A 2FYBA 3I0EA 4P00A 2O1HA 2Y7AA 4HO5A 5FTSA 5C36A 1ZJ3A 1FR9A 4BQHA 3ZGFA 4HO3A 5CQNX 2BO8A
chains in the Genus database with same CATH topology
1VZXA 3CKOA 3IOHA 3U2XA 1FGXA 2YC5A 4Y9XA 1WT0A 2OI6A 4B2XA 2OI5A 1GX0A 1O7QA 1ZCTA 2YQHA 3OH3A 4FROA 1NMMB 5BXCA 2RJ6A 4DECA 2WE9A 5CQMX 3I0GA 2RIYA 2D7RA 3U0YA 1NQIB 2I7BA 5CMIA 1OMXA 2P73A 1IIMA 3OAMA 5C1HA 3QVBA 2GGQA 2AGDA 2Z87A 1S4PA 3JUJA 5C47A 1R80A 1R7UA 1V83A 2PA4A 1LL2A 2V0IA 3U2WA 4ECMA 4DDZA 2ZU9A 4Q7CA 1G8OA 3SXGA 5CQLX 5FUHA 2WVLA 3K8EA 3USQA 2AE7A 4IRQA 2QH5A 4B42A 4HO2A 4M2BA 1VH3A 2VK9A 1FO9A 1QG8A 1V82A 4MYBA 2O1GA 5C1GA 4B4BA 2XWLA 1LL0A 4FRBA 5C4CA 3T7NA 3Q4SA 1INIA 3SX5A 3USRA 3K8DA 2P6WA 3SXDA 5AJNA 4D0ZA 1FO8A 2ICYA 2XMEA 4Y7VA 4AYLA 1XHBA 3I0CA 1TW5A 1H7HA 4FRQA 4EE3A 4Y7GA 1VGZA 3I0JA 1NF5B 5D92A 2AM4A 1JYKA 1HJLA 3V8YA 5IDTA 1PZYB 1NHEB 1H4EA 4HO4A 1SS9A 4FIYA 4FRHA 1QWJA 2C0NA 4MNDA 3OKRA 1JV1A 3T7OA 4EEMA 5L6VA 4MIXA 2RIZA 2UX8A 2FYDB 3CKNA 1YP4A 4O6MA 4HO9A 4HO0A 3IOJA 4NAKA 3V90A 4EEGA 4HOCA 1K4VA 4B3UA 2QKXA 3V0LA 2APCA 2BO6A 4M4KA 2AESA 1S4OA 4KNXA 1H7GA 1VM8A 1O23B 1R7TA 1YP2A 1WSZA 3LW6A 2Y4JA 5FU8A 1FXOA 1ZI4A 2DPWA 1EZIA 1ZJ1A 2V0LA 3D5NA 1E5KA 3PKPA 4P02A 2A8UA 2VS4A 4LW6A 4FIXA 1V84A 4K6RA 4YS8A 1HM8A 5C3BA 1S4NA 2JCLA 3OGZA 2V0KA 4Y64A 3JTJA 1GWWA 3POLA 4FCUA 4Y6NA 4CJBA 1HV9A 1ZJPA 5C3DA 2NXVA 4KPXA 4ZDQA 5C38A 2Y4LA 2AM5A 2VSHA 4Y7UA 4B5BA 4NALA 2A8WA 2I5KA 1GQCA 4Y7TA 2JCOA 2RJ0A 3R3IA 3SXBA 5DDTA 3OH0A 4EE4A 1H7FA 3SX8A 2P72A 4KRVA 1G97A 1G93A 3V0MA 1H5TB 2JCJA 3U2UA 3TZTA 4AC3A 4G3QA 1W55A 1NWGB 1ZDFA 1MC3A 1LZ7A 3F1CA 1ZJ0A 5CQOA 2BO7A 4KPZA 4JD0A 2WVMA 1YP3A 2WAWA 1LL3A 2XMHA 4ARWA 1HM9A 3V0PA 1WVCA 3CGXA 1ZJOA 1TZFA 4KC2A 2YCMA 4B4GA 3PKQA 1H7TA 4IRPA 4EE5A 4UEGA 2YQSA 2VFZA 2ZU7A 4FQWA 5C4DA 4KXOA 1VH1A 2D0JA 1GX4A 2PGYA 3GUEA 4B4MA 2RJ5A 2YESA 3CU0A 2X5ZA 2VS5A 4M2AA 1ZDGA 4JISA 1QGQA 4FRAA 4KC1A 3ZLLA 1H5TA 1FGGA 4M28A 5CMGX 4O6NA 4GBPA 4HCQA 4B2WA 5CQPA 5JQQA 4FCEA 1H5SD 3CKQA 2W0WA 1ZCVA 4LW3A 3FWWA 1HM0A 1WT1A 3SXAA 2WGZA 2J0AA 1VPAA 4R7PA 3R2WA 3CKJA 5C4BA 1H7EA 2RITA 2YC3A 1VZUA 1R7YA 3JUKA 4FRMA 5FYEA 3BCVA 1WT3A 5EJ1A 1O7OA 2GGOA 3KIAA 3ZLKA 4EVWA 5C8RA 1GWVA 3ST8A 1LZIA 1FR8A 2WEEA 4KQLA 2JCKA 1PZTA 2O1FA 1H4DA 2E8BA 2XWNA 3RSBA 1I52A 5D91A 1H3MA 1G1LA 2E3DA 1H7QA 2RJ4A 5C48A 1G9RA 1YROB 5IFYA 3Q80A 2VD4A 5C3AA 3T7MA 2J0BA 2Y6PA 4NAIA 1VGTA 1ZCYA 1LZ0A 2D7IA 1HJJA 1O0RA 1TW1A 2RJ8A 4G3PA 5DDVA 1GQ9A 3SPTA 5EIYA 4BMAA 3BRKX 2PGVA 3DK5A 3FOQA 5L6SA 5IDSA 1G3LA 1VZTA 2AM3A 4Y63A 1H7LA 1LVWA 2XWMA 1H4CA 5EJZA 3TQDA 1WT2A 4ASJA 2W0VA 1FOAA 1ZCUA 1H5RB 2YQJA 4HO8A 4DE7A 4J18A 3E26A 1R81A 3I0KA 4HO6A 1MP4A 3D98A 3V0NA 3SXCA 5CMJA 2FFUA 3IOIA 4HG6A 4CVHA 4D11C 2Q4JA 1FWYA 4EEOA 5C1LA 2RJ9A 4Y62A 3DJ4A 3I0LA 2Z86A 5CMHA 1OMZA 4D48A 2VSIA 3SX3A 2MZBA 4L41C 1W77A 2ZU8A 4FRDA 1FXJA 4EEAA 2OI7A 2OEGA 3HL3A 1JVDA 1W57A 1FZWA 2X5SA 3V91A 1H5SC 2V0HA 2YQCA 4FREA 3E25A 3SXEA 3I0FA 4Y6UA 4G87A 1KWSA 2OEFA 1OQMB 2FYCB 1IINA 1H5SB 1VICA 3DUVA 3I0DA 1EYRA 2VXMA 2FY7A 2RIXA 4CJCA 2PX7A 3V0QA 3OH2A 3SX7A 5J49A 3ZF8A 1ZI1A 4CJ8A 2Y4KA 1ZI5A 1R7XA 2QGIA 2WVKA 3U0XA 5C4FA 1QGSA 1H5RA 3ZGGA 1TVYA 5AJOA 4FRPA 1VGUA 3CKVA 2VXLA 3V0OA 1R7VA 3OH4A 1ZHJA 1FRWA 1G95A 3U2VA 1MP3A 5HS2A 4G3SA 3F1YA 2FFVA 1ON8A 1FG5N 4KNRA 3EE5A 4D11A 3Q7UA 2FYAA 5AJPA 3U2TA 3RMVA 1G0RA 1VGWA 2V0JA 4NANA 4AYJA 4FRLA 3V8ZA 3D8VA 2AH9A 3PNNA 3O3PA 4D0TA 4ASYA 3I0IX 1H5SA 3I0HA 3OC9A 5C49A 3N9WA 1Z90A 3NGWA 1JVGA 5I1FA 1G23A 4C2SA 5CMFX 1ZI3A 2ICXA 2Y4MA 1GA8A 4KC4A 1R82A 2VS3A 4Y7FA 1JV3A 2I5EA 4XWIA 5FTVA 2CU2A 2RJ1A 1ON6A 4AAWA 2BO4A 4KT7A 1INJA 2AECA 3RMWA 5C4EA 1ZIZA 1NKHB 1MP5A 3OH1A 1XZ6A 1G2VA 1ZJ2A 2RJ7A 5FU0A 1JYLA 1LZJA 4E1KA 2X60A 2X65A 5FV9A 2FYBA 3I0EA 4P00A 2O1HA 2Y7AA 4HO5A 5FTSA 5C36A 1ZJ3A 1FR9A 4BQHA 3ZGFA 4HO3A 5CQNX 2BO8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VZX A;  3CKO A;  3IOH A;  3U2X A;  1FGX A;  2YC5 A;  4Y9X A;  1WT0 A;  2OI6 A;  4B2X A;  2OI5 A;  1GX0 A;  1O7Q A;  1ZCT A;  2YQH A;  3OH3 A;  4FRO A;  1NMM B;  5BXC A;  2RJ6 A;  4DEC A;  2WE9 A;  5CQM X;  3I0G A;  2RIY A;  2D7R A;  3U0Y A;  1NQI B;  2I7B A;  5CMI A;  1OMX A;  2P73 A;  1IIM A;  3OAM A;  5C1H A;  3QVB A;  2GGQ A;  2AGD A;  2Z87 A;  1S4P A;  3JUJ A;  5C47 A;  1R80 A;  1R7U A;  1V83 A;  2PA4 A;  1LL2 A;  2V0I A;  3U2W A;  4ECM A;  4DDZ A;  2ZU9 A;  1G8O A;  3SXG A;  5CQL X;  5FUH A;  2WVL A;  3K8E A;  3USQ A;  2AE7 A;  4IRQ A;  2QH5 A;  4B42 A;  4HO2 A;  4M2B A;  1VH3 A;  1FO9 A;  1QG8 A;  1V82 A;  4MYB A;  2O1G A;  5C1G A;  4B4B A;  2XWL A;  1LL0 A;  4FRB A;  5C4C A;  3T7N A;  3Q4S A;  1INI A;  3SX5 A;  3USR A;  3K8D A;  2P6W A;  3SXD A;  5AJN A;  4D0Z A;  1FO8 A;  2ICY A;  2XME A;  4Y7V A;  4AYL A;  1XHB A;  3I0C A;  1TW5 A;  1H7H A;  4FRQ A;  4EE3 A;  4Y7G A;  1VGZ A;  3I0J A;  1NF5 B;  2AM4 A;  1JYK A;  1HJL A;  3V8Y A;  5IDT A;  1PZY B;  1NHE B;  1H4E A;  4HO4 A;  1SS9 A;  4FRH A;  1QWJ A;  4MND A;  3OKR A;  1JV1 A;  3T7O A;  4EEM A;  5L6V A;  2RIZ A;  2UX8 A;  2FYD B;  3CKN A;  1YP4 A;  4HO9 A;  4HO0 A;  3IOJ A;  4NAK A;  3V90 A;  4EEG A;  4HOC A;  1K4V A;  4B3U A;  2QKX A;  3V0L A;  2APC A;  2BO6 A;  4M4K A;  2AES A;  1S4O A;  4KNX A;  1H7G A;  1VM8 A;  1O23 B;  1R7T A;  1YP2 A;  1WSZ A;  3LW6 A;  2Y4J A;  5FU8 A;  1FXO A;  1ZI4 A;  2DPW A;  1EZI A;  1ZJ1 A;  2V0L A;  3D5N A;  1E5K A;  3PKP A;  4P02 A;  2A8U A;  2VS4 A;  4LW6 A;  1V84 A;  4K6R A;  4YS8 A;  1HM8 A;  5C3B A;  1S4N A;  2JCL A;  3OGZ A;  2V0K A;  4Y64 A;  3JTJ A;  1GWW A;  3POL A;  4FCU A;  4Y6N A;  4CJB A;  1HV9 A;  1ZJP A;  5C3D A;  2NXV A;  4KPX A;  4ZDQ A;  5C38 A;  2Y4L A;  2AM5 A;  2VSH A;  4Y7U A;  4B5B A;  4NAL A;  2A8W A;  2I5K A;  1GQC A;  4Y7T A;  2JCO A;  2RJ0 A;  3R3I A;  3SXB A;  5DDT A;  3OH0 A;  4EE4 A;  1H7F A;  3SX8 A;  2P72 A;  4KRV A;  1G97 A;  1G93 A;  3V0M A;  1H5T B;  2JCJ A;  3U2U A;  3TZT A;  4AC3 A;  4G3Q A;  1W55 A;  1NWG B;  1ZDF A;  1MC3 A;  1LZ7 A;  3F1C A;  1ZJ0 A;  5CQO A;  2BO7 A;  4KPZ A;  4JD0 A;  2WVM A;  1YP3 A;  2WAW A;  1LL3 A;  2XMH A;  4ARW A;  1HM9 A;  3V0P A;  1WVC A;  3CGX A;  1ZJO A;  1TZF A;  4KC2 A;  2YCM A;  4B4G A;  3PKQ A;  1H7T A;  4IRP A;  4EE5 A;  4UEG A;  2YQS A;  2VFZ A;  2ZU7 A;  4FQW A;  5C4D A;  4KXO A;  1VH1 A;  2D0J A;  1GX4 A;  2PGY A;  3GUE A;  4B4M A;  2RJ5 A;  2YES A;  3CU0 A;  2X5Z A;  2VS5 A;  4M2A A;  1ZDG A;  4JIS A;  1QGQ A;  4FRA A;  4KC1 A;  3ZLL A;  1H5T A;  1FGG A;  4M28 A;  5CMG X;  4GBP A;  4HCQ A;  4B2W A;  5CQP A;  5JQQ A;  4FCE A;  1H5S D;  3CKQ A;  2W0W A;  1ZCV A;  4LW3 A;  3FWW A;  1HM0 A;  1WT1 A;  3SXA A;  2WGZ A;  1VPA A;  4R7P A;  3R2W A;  3CKJ A;  5C4B A;  1H7E A;  2RIT A;  2YC3 A;  1VZU A;  1R7Y A;  3JUK A;  4FRM A;  5FYE A;  3BCV A;  1WT3 A;  5EJ1 A;  1O7O A;  2GGO A;  3KIA A;  3ZLK A;  4EVW A;  5C8R A;  1GWV A;  3ST8 A;  1LZI A;  1FR8 A;  2WEE A;  4KQL A;  2JCK A;  1PZT A;  2O1F A;  1H4D A;  2E8B A;  2XWN A;  3RSB A;  1I52 A;  1H3M A;  1G1L A;  2E3D A;  1H7Q A;  2RJ4 A;  5C48 A;  1G9R A;  1YRO B;  5IFY A;  3Q80 A;  2VD4 A;  5C3A A;  3T7M A;  2Y6P A;  4NAI A;  1VGT A;  1ZCY A;  1LZ0 A;  2D7I A;  1HJJ A;  1O0R A;  1TW1 A;  2RJ8 A;  4G3P A;  5DDV A;  1GQ9 A;  3SPT A;  5EIY A;  4BMA A;  3BRK X;  2PGV A;  3DK5 A;  3FOQ A;  5L6S A;  5IDS A;  1G3L A;  1VZT A;  2AM3 A;  4Y63 A;  1H7L A;  1LVW A;  2XWM A;  1H4C A;  5EJZ A;  3TQD A;  1WT2 A;  4ASJ A;  2W0V A;  1FOA A;  1ZCU A;  1H5R B;  2YQJ A;  4HO8 A;  4DE7 A;  4J18 A;  3E26 A;  1R81 A;  3I0K A;  4HO6 A;  1MP4 A;  3D98 A;  3V0N A;  3SXC A;  5CMJ A;  2FFU A;  3IOI A;  4HG6 A;  4CVH A;  4D11 C;  2Q4J A;  1FWY A;  4EEO A;  5C1L A;  2RJ9 A;  4Y62 A;  3DJ4 A;  3I0L A;  2Z86 A;  5CMH A;  1OMZ A;  4D48 A;  2VSI A;  3SX3 A;  2MZB A;  4L41 C;  1W77 A;  2ZU8 A;  4FRD A;  1FXJ A;  4EEA A;  2OI7 A;  2OEG A;  3HL3 A;  1JVD A;  1W57 A;  1FZW A;  2X5S A;  3V91 A;  1H5S C;  2V0H A;  2YQC A;  4FRE A;  3E25 A;  3SXE A;  3I0F A;  4Y6U A;  4G87 A;  1KWS A;  2OEF A;  1OQM B;  2FYC B;  1IIN A;  1H5S B;  1VIC A;  3DUV A;  3I0D A;  1EYR A;  2VXM A;  2FY7 A;  2RIX A;  4CJC A;  2PX7 A;  3V0Q A;  3OH2 A;  3SX7 A;  5J49 A;  3ZF8 A;  1ZI1 A;  4CJ8 A;  2Y4K A;  1ZI5 A;  1R7X A;  2QGI A;  2WVK A;  3U0X A;  5C4F A;  1QGS A;  1H5R A;  3ZGG A;  1TVY A;  5AJO A;  4FRP A;  1VGU A;  3CKV A;  2VXL A;  3V0O A;  1R7V A;  3OH4 A;  1ZHJ A;  1FRW A;  1G95 A;  3U2V A;  1MP3 A;  5HS2 A;  4G3S A;  3F1Y A;  2FFV A;  1ON8 A;  1FG5 N;  4KNR A;  3EE5 A;  4D11 A;  3Q7U A;  2FYA A;  5AJP A;  3U2T A;  3RMV A;  1G0R A;  1VGW A;  2V0J A;  4NAN A;  4AYJ A;  4FRL A;  3V8Z A;  3D8V A;  2AH9 A;  3PNN A;  3O3P A;  4D0T A;  4ASY A;  3I0I X;  1H5S A;  3I0H A;  3OC9 A;  5C49 A;  3N9W A;  1Z90 A;  3NGW A;  1JVG A;  5I1F A;  1G23 A;  4C2S A;  5CMF X;  1ZI3 A;  2ICX A;  2Y4M A;  1GA8 A;  4KC4 A;  1R82 A;  2VS3 A;  4Y7F A;  1JV3 A;  2I5E A;  4XWI A;  5FTV A;  2CU2 A;  2RJ1 A;  1ON6 A;  4AAW A;  2BO4 A;  4KT7 A;  1INJ A;  2AEC A;  3RMW A;  5C4E A;  1ZIZ A;  1NKH B;  1MP5 A;  3OH1 A;  1XZ6 A;  1G2V A;  1ZJ2 A;  2RJ7 A;  5FU0 A;  1JYL A;  1LZJ A;  4E1K A;  2X60 A;  2X65 A;  5FV9 A;  2FYB A;  3I0E A;  4P00 A;  2O1H A;  2Y7A A;  4HO5 A;  5FTS A;  5C36 A;  1ZJ3 A;  1FR9 A;  4BQH A;  3ZGF A;  4HO3 A;  5CQN X;  2BO8 A; 
#chains in the Genus database with same CATH topology
 1VZX A;  3CKO A;  3IOH A;  3U2X A;  1FGX A;  2YC5 A;  4Y9X A;  1WT0 A;  2OI6 A;  4B2X A;  2OI5 A;  1GX0 A;  1O7Q A;  1ZCT A;  2YQH A;  3OH3 A;  4FRO A;  1NMM B;  5BXC A;  2RJ6 A;  4DEC A;  2WE9 A;  5CQM X;  3I0G A;  2RIY A;  2D7R A;  3U0Y A;  1NQI B;  2I7B A;  5CMI A;  1OMX A;  2P73 A;  1IIM A;  3OAM A;  5C1H A;  3QVB A;  2GGQ A;  2AGD A;  2Z87 A;  1S4P A;  3JUJ A;  5C47 A;  1R80 A;  1R7U A;  1V83 A;  2PA4 A;  1LL2 A;  2V0I A;  3U2W A;  4ECM A;  4DDZ A;  2ZU9 A;  4Q7C A;  1G8O A;  3SXG A;  5CQL X;  5FUH A;  2WVL A;  3K8E A;  3USQ A;  2AE7 A;  4IRQ A;  2QH5 A;  4B42 A;  4HO2 A;  4M2B A;  1VH3 A;  2VK9 A;  1FO9 A;  1QG8 A;  1V82 A;  4MYB A;  2O1G A;  5C1G A;  4B4B A;  2XWL A;  1LL0 A;  4FRB A;  5C4C A;  3T7N A;  3Q4S A;  1INI A;  3SX5 A;  3USR A;  3K8D A;  2P6W A;  3SXD A;  5AJN A;  4D0Z A;  1FO8 A;  2ICY A;  2XME A;  4Y7V A;  4AYL A;  1XHB A;  3I0C A;  1TW5 A;  1H7H A;  4FRQ A;  4EE3 A;  4Y7G A;  1VGZ A;  3I0J A;  1NF5 B;  5D92 A;  2AM4 A;  1JYK A;  1HJL A;  3V8Y A;  5IDT A;  1PZY B;  1NHE B;  1H4E A;  4HO4 A;  1SS9 A;  4FIY A;  4FRH A;  1QWJ A;  2C0N A;  4MND A;  3OKR A;  1JV1 A;  3T7O A;  4EEM A;  5L6V A;  4MIX A;  2RIZ A;  2UX8 A;  2FYD B;  3CKN A;  1YP4 A;  4O6M A;  4HO9 A;  4HO0 A;  3IOJ A;  4NAK A;  3V90 A;  4EEG A;  4HOC A;  1K4V A;  4B3U A;  2QKX A;  3V0L A;  2APC A;  2BO6 A;  4M4K A;  2AES A;  1S4O A;  4KNX A;  1H7G A;  1VM8 A;  1O23 B;  1R7T A;  1YP2 A;  1WSZ A;  3LW6 A;  2Y4J A;  5FU8 A;  1FXO A;  1ZI4 A;  2DPW A;  1EZI A;  1ZJ1 A;  2V0L A;  3D5N A;  1E5K A;  3PKP A;  4P02 A;  2A8U A;  2VS4 A;  4LW6 A;  4FIX A;  1V84 A;  4K6R A;  4YS8 A;  1HM8 A;  5C3B A;  1S4N A;  2JCL A;  3OGZ A;  2V0K A;  4Y64 A;  3JTJ A;  1GWW A;  3POL A;  4FCU A;  4Y6N A;  4CJB A;  1HV9 A;  1ZJP A;  5C3D A;  2NXV A;  4KPX A;  4ZDQ A;  5C38 A;  2Y4L A;  2AM5 A;  2VSH A;  4Y7U A;  4B5B A;  4NAL A;  2A8W A;  2I5K A;  1GQC A;  4Y7T A;  2JCO A;  2RJ0 A;  3R3I A;  3SXB A;  5DDT A;  3OH0 A;  4EE4 A;  1H7F A;  3SX8 A;  2P72 A;  4KRV A;  1G97 A;  1G93 A;  3V0M A;  1H5T B;  2JCJ A;  3U2U A;  3TZT A;  4AC3 A;  4G3Q A;  1W55 A;  1NWG B;  1ZDF A;  1MC3 A;  1LZ7 A;  3F1C A;  1ZJ0 A;  5CQO A;  2BO7 A;  4KPZ A;  4JD0 A;  2WVM A;  1YP3 A;  2WAW A;  1LL3 A;  2XMH A;  4ARW A;  1HM9 A;  3V0P A;  1WVC A;  3CGX A;  1ZJO A;  1TZF A;  4KC2 A;  2YCM A;  4B4G A;  3PKQ A;  1H7T A;  4IRP A;  4EE5 A;  4UEG A;  2YQS A;  2VFZ A;  2ZU7 A;  4FQW A;  5C4D A;  4KXO A;  1VH1 A;  2D0J A;  1GX4 A;  2PGY A;  3GUE A;  4B4M A;  2RJ5 A;  2YES A;  3CU0 A;  2X5Z A;  2VS5 A;  4M2A A;  1ZDG A;  4JIS A;  1QGQ A;  4FRA A;  4KC1 A;  3ZLL A;  1H5T A;  1FGG A;  4M28 A;  5CMG X;  4O6N A;  4GBP A;  4HCQ A;  4B2W A;  5CQP A;  5JQQ A;  4FCE A;  1H5S D;  3CKQ A;  2W0W A;  1ZCV A;  4LW3 A;  3FWW A;  1HM0 A;  1WT1 A;  3SXA A;  2WGZ A;  2J0A A;  1VPA A;  4R7P A;  3R2W A;  3CKJ A;  5C4B A;  1H7E A;  2RIT A;  2YC3 A;  1VZU A;  1R7Y A;  3JUK A;  4FRM A;  5FYE A;  3BCV A;  1WT3 A;  5EJ1 A;  1O7O A;  2GGO A;  3KIA A;  3ZLK A;  4EVW A;  5C8R A;  1GWV A;  3ST8 A;  1LZI A;  1FR8 A;  2WEE A;  4KQL A;  2JCK A;  1PZT A;  2O1F A;  1H4D A;  2E8B A;  2XWN A;  3RSB A;  1I52 A;  5D91 A;  1H3M A;  1G1L A;  2E3D A;  1H7Q A;  2RJ4 A;  5C48 A;  1G9R A;  1YRO B;  5IFY A;  3Q80 A;  2VD4 A;  5C3A A;  3T7M A;  2J0B A;  2Y6P A;  4NAI A;  1VGT A;  1ZCY A;  1LZ0 A;  2D7I A;  1HJJ A;  1O0R A;  1TW1 A;  2RJ8 A;  4G3P A;  5DDV A;  1GQ9 A;  3SPT A;  5EIY A;  4BMA A;  3BRK X;  2PGV A;  3DK5 A;  3FOQ A;  5L6S A;  5IDS A;  1G3L A;  1VZT A;  2AM3 A;  4Y63 A;  1H7L A;  1LVW A;  2XWM A;  1H4C A;  5EJZ A;  3TQD A;  1WT2 A;  4ASJ A;  2W0V A;  1FOA A;  1ZCU A;  1H5R B;  2YQJ A;  4HO8 A;  4DE7 A;  4J18 A;  3E26 A;  1R81 A;  3I0K A;  4HO6 A;  1MP4 A;  3D98 A;  3V0N A;  3SXC A;  5CMJ A;  2FFU A;  3IOI A;  4HG6 A;  4CVH A;  4D11 C;  2Q4J A;  1FWY A;  4EEO A;  5C1L A;  2RJ9 A;  4Y62 A;  3DJ4 A;  3I0L A;  2Z86 A;  5CMH A;  1OMZ A;  4D48 A;  2VSI A;  3SX3 A;  2MZB A;  4L41 C;  1W77 A;  2ZU8 A;  4FRD A;  1FXJ A;  4EEA A;  2OI7 A;  2OEG A;  3HL3 A;  1JVD A;  1W57 A;  1FZW A;  2X5S A;  3V91 A;  1H5S C;  2V0H A;  2YQC A;  4FRE A;  3E25 A;  3SXE A;  3I0F A;  4Y6U A;  4G87 A;  1KWS A;  2OEF A;  1OQM B;  2FYC B;  1IIN A;  1H5S B;  1VIC A;  3DUV A;  3I0D A;  1EYR A;  2VXM A;  2FY7 A;  2RIX A;  4CJC A;  2PX7 A;  3V0Q A;  3OH2 A;  3SX7 A;  5J49 A;  3ZF8 A;  1ZI1 A;  4CJ8 A;  2Y4K A;  1ZI5 A;  1R7X A;  2QGI A;  2WVK A;  3U0X A;  5C4F A;  1QGS A;  1H5R A;  3ZGG A;  1TVY A;  5AJO A;  4FRP A;  1VGU A;  3CKV A;  2VXL A;  3V0O A;  1R7V A;  3OH4 A;  1ZHJ A;  1FRW A;  1G95 A;  3U2V A;  1MP3 A;  5HS2 A;  4G3S A;  3F1Y A;  2FFV A;  1ON8 A;  1FG5 N;  4KNR A;  3EE5 A;  4D11 A;  3Q7U A;  2FYA A;  5AJP A;  3U2T A;  3RMV A;  1G0R A;  1VGW A;  2V0J A;  4NAN A;  4AYJ A;  4FRL A;  3V8Z A;  3D8V A;  2AH9 A;  3PNN A;  3O3P A;  4D0T A;  4ASY A;  3I0I X;  1H5S A;  3I0H A;  3OC9 A;  5C49 A;  3N9W A;  1Z90 A;  3NGW A;  1JVG A;  5I1F A;  1G23 A;  4C2S A;  5CMF X;  1ZI3 A;  2ICX A;  2Y4M A;  1GA8 A;  4KC4 A;  1R82 A;  2VS3 A;  4Y7F A;  1JV3 A;  2I5E A;  4XWI A;  5FTV A;  2CU2 A;  2RJ1 A;  1ON6 A;  4AAW A;  2BO4 A;  4KT7 A;  1INJ A;  2AEC A;  3RMW A;  5C4E A;  1ZIZ A;  1NKH B;  1MP5 A;  3OH1 A;  1XZ6 A;  1G2V A;  1ZJ2 A;  2RJ7 A;  5FU0 A;  1JYL A;  1LZJ A;  4E1K A;  2X60 A;  2X65 A;  5FV9 A;  2FYB A;  3I0E A;  4P00 A;  2O1H A;  2Y7A A;  4HO5 A;  5FTS A;  5C36 A;  1ZJ3 A;  1FR9 A;  4BQH A;  3ZGF A;  4HO3 A;  5CQN X;  2BO8 A; 
#chains in the Genus database with same CATH homology
 1VZX A;  3CKO A;  3IOH A;  3U2X A;  1FGX A;  2YC5 A;  4Y9X A;  1WT0 A;  2OI6 A;  4B2X A;  2OI5 A;  1GX0 A;  1O7Q A;  1ZCT A;  2YQH A;  3OH3 A;  4FRO A;  1NMM B;  5BXC A;  2RJ6 A;  4DEC A;  2WE9 A;  5CQM X;  3I0G A;  2RIY A;  2D7R A;  3U0Y A;  1NQI B;  2I7B A;  5CMI A;  1OMX A;  2P73 A;  1IIM A;  3OAM A;  5C1H A;  3QVB A;  2GGQ A;  2AGD A;  2Z87 A;  1S4P A;  3JUJ A;  5C47 A;  1R80 A;  1R7U A;  1V83 A;  2PA4 A;  1LL2 A;  2V0I A;  3U2W A;  4ECM A;  4DDZ A;  2ZU9 A;  4Q7C A;  1G8O A;  3SXG A;  5CQL X;  5FUH A;  2WVL A;  3K8E A;  3USQ A;  2AE7 A;  4IRQ A;  2QH5 A;  4B42 A;  4HO2 A;  4M2B A;  1VH3 A;  2VK9 A;  1FO9 A;  1QG8 A;  1V82 A;  4MYB A;  2O1G A;  5C1G A;  4B4B A;  2XWL A;  1LL0 A;  4FRB A;  5C4C A;  3T7N A;  3Q4S A;  1INI A;  3SX5 A;  3USR A;  3K8D A;  2P6W A;  3SXD A;  5AJN A;  4D0Z A;  1FO8 A;  2ICY A;  2XME A;  4Y7V A;  4AYL A;  1XHB A;  3I0C A;  1TW5 A;  1H7H A;  4FRQ A;  4EE3 A;  4Y7G A;  1VGZ A;  3I0J A;  1NF5 B;  5D92 A;  2AM4 A;  1JYK A;  1HJL A;  3V8Y A;  5IDT A;  1PZY B;  1NHE B;  1H4E A;  4HO4 A;  1SS9 A;  4FIY A;  4FRH A;  1QWJ A;  2C0N A;  4MND A;  3OKR A;  1JV1 A;  3T7O A;  4EEM A;  5L6V A;  4MIX A;  2RIZ A;  2UX8 A;  2FYD B;  3CKN A;  1YP4 A;  4O6M A;  4HO9 A;  4HO0 A;  3IOJ A;  4NAK A;  3V90 A;  4EEG A;  4HOC A;  1K4V A;  4B3U A;  2QKX A;  3V0L A;  2APC A;  2BO6 A;  4M4K A;  2AES A;  1S4O A;  4KNX A;  1H7G A;  1VM8 A;  1O23 B;  1R7T A;  1YP2 A;  1WSZ A;  3LW6 A;  2Y4J A;  5FU8 A;  1FXO A;  1ZI4 A;  2DPW A;  1EZI A;  1ZJ1 A;  2V0L A;  3D5N A;  1E5K A;  3PKP A;  4P02 A;  2A8U A;  2VS4 A;  4LW6 A;  4FIX A;  1V84 A;  4K6R A;  4YS8 A;  1HM8 A;  5C3B A;  1S4N A;  2JCL A;  3OGZ A;  2V0K A;  4Y64 A;  3JTJ A;  1GWW A;  3POL A;  4FCU A;  4Y6N A;  4CJB A;  1HV9 A;  1ZJP A;  5C3D A;  2NXV A;  4KPX A;  4ZDQ A;  5C38 A;  2Y4L A;  2AM5 A;  2VSH A;  4Y7U A;  4B5B A;  4NAL A;  2A8W A;  2I5K A;  1GQC A;  4Y7T A;  2JCO A;  2RJ0 A;  3R3I A;  3SXB A;  5DDT A;  3OH0 A;  4EE4 A;  1H7F A;  3SX8 A;  2P72 A;  4KRV A;  1G97 A;  1G93 A;  3V0M A;  1H5T B;  2JCJ A;  3U2U A;  3TZT A;  4AC3 A;  4G3Q A;  1W55 A;  1NWG B;  1ZDF A;  1MC3 A;  1LZ7 A;  3F1C A;  1ZJ0 A;  5CQO A;  2BO7 A;  4KPZ A;  4JD0 A;  2WVM A;  1YP3 A;  2WAW A;  1LL3 A;  2XMH A;  4ARW A;  1HM9 A;  3V0P A;  1WVC A;  3CGX A;  1ZJO A;  1TZF A;  4KC2 A;  2YCM A;  4B4G A;  3PKQ A;  1H7T A;  4IRP A;  4EE5 A;  4UEG A;  2YQS A;  2VFZ A;  2ZU7 A;  4FQW A;  5C4D A;  4KXO A;  1VH1 A;  2D0J A;  1GX4 A;  2PGY A;  3GUE A;  4B4M A;  2RJ5 A;  2YES A;  3CU0 A;  2X5Z A;  2VS5 A;  4M2A A;  1ZDG A;  4JIS A;  1QGQ A;  4FRA A;  4KC1 A;  3ZLL A;  1H5T A;  1FGG A;  4M28 A;  5CMG X;  4O6N A;  4GBP A;  4HCQ A;  4B2W A;  5CQP A;  5JQQ A;  4FCE A;  1H5S D;  3CKQ A;  2W0W A;  1ZCV A;  4LW3 A;  3FWW A;  1HM0 A;  1WT1 A;  3SXA A;  2WGZ A;  2J0A A;  1VPA A;  4R7P A;  3R2W A;  3CKJ A;  5C4B A;  1H7E A;  2RIT A;  2YC3 A;  1VZU A;  1R7Y A;  3JUK A;  4FRM A;  5FYE A;  3BCV A;  1WT3 A;  5EJ1 A;  1O7O A;  2GGO A;  3KIA A;  3ZLK A;  4EVW A;  5C8R A;  1GWV A;  3ST8 A;  1LZI A;  1FR8 A;  2WEE A;  4KQL A;  2JCK A;  1PZT A;  2O1F A;  1H4D A;  2E8B A;  2XWN A;  3RSB A;  1I52 A;  5D91 A;  1H3M A;  1G1L A;  2E3D A;  1H7Q A;  2RJ4 A;  5C48 A;  1G9R A;  1YRO B;  5IFY A;  3Q80 A;  2VD4 A;  5C3A A;  3T7M A;  2J0B A;  2Y6P A;  4NAI A;  1VGT A;  1ZCY A;  1LZ0 A;  2D7I A;  1HJJ A;  1O0R A;  1TW1 A;  2RJ8 A;  4G3P A;  5DDV A;  1GQ9 A;  3SPT A;  5EIY A;  4BMA A;  3BRK X;  2PGV A;  3DK5 A;  3FOQ A;  5L6S A;  5IDS A;  1G3L A;  1VZT A;  2AM3 A;  4Y63 A;  1H7L A;  1LVW A;  2XWM A;  1H4C A;  5EJZ A;  3TQD A;  1WT2 A;  4ASJ A;  2W0V A;  1FOA A;  1ZCU A;  1H5R B;  2YQJ A;  4HO8 A;  4DE7 A;  4J18 A;  3E26 A;  1R81 A;  3I0K A;  4HO6 A;  1MP4 A;  3D98 A;  3V0N A;  3SXC A;  5CMJ A;  2FFU A;  3IOI A;  4HG6 A;  4CVH A;  4D11 C;  2Q4J A;  1FWY A;  4EEO A;  5C1L A;  2RJ9 A;  4Y62 A;  3DJ4 A;  3I0L A;  2Z86 A;  5CMH A;  1OMZ A;  4D48 A;  2VSI A;  3SX3 A;  2MZB A;  4L41 C;  1W77 A;  2ZU8 A;  4FRD A;  1FXJ A;  4EEA A;  2OI7 A;  2OEG A;  3HL3 A;  1JVD A;  1W57 A;  1FZW A;  2X5S A;  3V91 A;  1H5S C;  2V0H A;  2YQC A;  4FRE A;  3E25 A;  3SXE A;  3I0F A;  4Y6U A;  4G87 A;  1KWS A;  2OEF A;  1OQM B;  2FYC B;  1IIN A;  1H5S B;  1VIC A;  3DUV A;  3I0D A;  1EYR A;  2VXM A;  2FY7 A;  2RIX A;  4CJC A;  2PX7 A;  3V0Q A;  3OH2 A;  3SX7 A;  5J49 A;  3ZF8 A;  1ZI1 A;  4CJ8 A;  2Y4K A;  1ZI5 A;  1R7X A;  2QGI A;  2WVK A;  3U0X A;  5C4F A;  1QGS A;  1H5R A;  3ZGG A;  1TVY A;  5AJO A;  4FRP A;  1VGU A;  3CKV A;  2VXL A;  3V0O A;  1R7V A;  3OH4 A;  1ZHJ A;  1FRW A;  1G95 A;  3U2V A;  1MP3 A;  5HS2 A;  4G3S A;  3F1Y A;  2FFV A;  1ON8 A;  1FG5 N;  4KNR A;  3EE5 A;  4D11 A;  3Q7U A;  2FYA A;  5AJP A;  3U2T A;  3RMV A;  1G0R A;  1VGW A;  2V0J A;  4NAN A;  4AYJ A;  4FRL A;  3V8Z A;  3D8V A;  2AH9 A;  3PNN A;  3O3P A;  4D0T A;  4ASY A;  3I0I X;  1H5S A;  3I0H A;  3OC9 A;  5C49 A;  3N9W A;  1Z90 A;  3NGW A;  1JVG A;  5I1F A;  1G23 A;  4C2S A;  5CMF X;  1ZI3 A;  2ICX A;  2Y4M A;  1GA8 A;  4KC4 A;  1R82 A;  2VS3 A;  4Y7F A;  1JV3 A;  2I5E A;  4XWI A;  5FTV A;  2CU2 A;  2RJ1 A;  1ON6 A;  4AAW A;  2BO4 A;  4KT7 A;  1INJ A;  2AEC A;  3RMW A;  5C4E A;  1ZIZ A;  1NKH B;  1MP5 A;  3OH1 A;  1XZ6 A;  1G2V A;  1ZJ2 A;  2RJ7 A;  5FU0 A;  1JYL A;  1LZJ A;  4E1K A;  2X60 A;  2X65 A;  5FV9 A;  2FYB A;  3I0E A;  4P00 A;  2O1H A;  2Y7A A;  4HO5 A;  5FTS A;  5C36 A;  1ZJ3 A;  1FR9 A;  4BQH A;  3ZGF A;  4HO3 A;  5CQN X;  2BO8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...