1TVYA

Beta-1,4-galactosyltransferase mutant met344his (m344h-gal-t1) complex with udp-galactose and manganese
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
272
structure length
272
Chain Sequence
LTACPEESPLLVGPMLIEFNIPVDLKLVEQQNPKVKLGGRYTPMDCISPHKVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGESMFNRAKLLNVGFKEALKDYDYNCFVFSDVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLSINGFPNNYWGWGGEDDDIYNRLAFRGMSVSRPNAVIGKTRHIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYMVLEVQRYPLYTKITVDIGTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Beta-1,4-galactosyltransferase 1
publication title Effect of the Met344His mutation on the conformational dynamics of bovine beta-1,4-galactosyltransferase: crystal structure of the Met344His mutant in complex with chitobiose
pubmed doi rcsb
source organism Bos taurus
total genus 88
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.4.1.22: Lactose synthase.
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02709 Glyco_transf_7C N-terminal domain of galactosyltransferase
A PF13733 Glyco_transf_7N N-terminal region of glycosyl transferase group 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1tvyA00
1VZXA 2BO8A 4FCEA 3V90A 2OI7A 1JV3A 1O23B 1G23A 5FU8A 2BO7A 5C4EA 4HO2A 2VFZA 5FUHA 4B4MA 2RJ6A 2X60A 1IINA 1NF5B 4FRMA 2VD4A 1LZ0A 2XMHA 4FRAA 4B2WA 2WVMA 4ECMA 3E25A 1H7QA 1W77A 2AM4A 1HJJA 1LVWA 2ICYA 4B5BA 3JUKA 1ZDGA 2FYBA 2RJ0A 1HJLA 1H4EA 4XWIA 5C1LA 2D7IA 3FOQA 1G3LA 3QVBA 4KNRA 3D5NA 1LZJA 2OI6A 1LL3A 2RJ5A 2NXVA 3U2XA 4LW6A 3ZGFA 3PNNA 3V0LA 3RMWA 1GX0A 4KQLA 1ZDFA 2AM5A 4KC4A 4EVWA 4ASJA 2AGDA 2PGVA 3CKVA 4HO6A 3V91A 2DPWA 5IDTA 3K8DA 1LZIA 2FYAA 1H7FA 5CQMX 5C1HA 1ZJPA 5C4FA 4EEGA 5AJOA 3V0MA 4J18A 2P73A 5DDTA 1GA8A 1WT3A 5C38A 2AM3A 4UEGA 3OH1A 1G95A 4DE7A 4Y7GA 3Q4SA 2VSHA 5C8RA 3U2WA 5AJPA 1I52A 1K4VA 2Y6PA 1H4DA 1FXOA 4EE3A 1OQMB 2XWNA 2ZU7A 4KC2A 1W55A 1H3MA 4ARWA 4Y7VA 4D11C 3U2TA 5C3BA 2RIYA 1ZJ3A 1NWGB 4AAWA 3K8EA 4K6RA 3SXGA 1R7UA 4BQHA 1VICA 4EEOA 2V0LA 3U2UA 1ZCVA 3RSBA 5CMGX 2D7RA 1FGGA 3V0NA 1H5RB 4KRVA 1HV9A 2V0KA 4IRQA 2E8BA 1MC3A 4EE4A 3SX7A 1LL2A 4EEMA 1JVGA 2AH9A 4KNXA 3O3PA 3SXEA 1O7OA 3I0DA 5J49A 1R7YA 4L41C 1R80A 4D11A 3OH0A 4Y63A 2AE7A 1QG8A 3Q7UA 3CKQA 3ST8A 1H5SD 1SS9A 3U0XA 3SPTA 4FRDA 1H7LA 2Z86A 5CQOA 3V0PA 4FROA 3OH3A 3USQA 4CJCA 4C2SA 4NANA 4FRBA 3CKOA 1VGUA 1ZCYA 1OMZA 4JD0A 1VM8A 2AECA 3D98A 1H7TA 2P6WA 2X5SA 3BCVA 4HO8A 3OGZA 3T7NA 3SX8A 1H5TB 4HOCA 4Y62A 5IFYA 4ZDQA 2FFVA 3T7MA 2O1HA 3SXBA 2Z87A 4HO3A 4D0ZA 4M2BA 2WAWA 5CQPA 1Z90A 5I1FA 3DUVA 3CU0A 1R7VA 1JYKA 5C48A 2Y4LA 4FCUA 1QGQA 4YS8A 3TZTA 1KWSA 2YQSA 4B4BA 2O1GA 1FO8A 2RJ4A 1MP4A 1WT1A 3HL3A 1ZCUA 5C4BA 1V82A 4R7PA 2W0WA 3F1CA 1R81A 3Q80A 4M2AA 2FYCB 1INJA 2VS5A 2JCLA 1ZJ1A 1ZIZA 2FYDB 2Y4KA 2Y4JA 3I0JA 1EZIA 2MZBA 4HO5A 5C1GA 3IOJA 3GUEA 1QGSA 5AJNA 2Y7AA 3KIAA 4AYJA 2RJ9A 4LW3A 2VS3A 3NGWA 2AESA 1JV1A 1FOAA 3V0OA 4Y64A 2XWLA 1G9RA 2QH5A 3I0KA 3POLA 4G3SA 2YCMA 1NHEB 2Y4MA 1IIMA 1E5KA 1VH1A 1O7QA 2JCOA 4EEAA 2PGYA 1FR9A 1XZ6A 2YESA 1ZCTA 4G87A 1LZ7A 1TW1A 1FZWA 1NKHB 2OI5A 1ZJ2A 4MNDA 1YROB 1R7TA 1S4NA 1V84A 1PZTA 1G2VA 1QWJA 2RIXA 4Y6NA 4CJ8A 2YC5A 1R82A 3IOIA 3SX5A 4AYLA 3OH4A 2YQJA 2RJ8A 4P00A 1MP3A 1GX4A 3DK5A 5L6VA 3E26A 4G3PA 5C4DA 5C47A 1O0RA 4FREA 4NAKA 1ZI3A 3U2VA 1TZFA 1LL0A 3U0YA 2FFUA 3OKRA 4D0TA 1ZHJA 3OC9A 1FR8A 2W0VA 3SXAA 4Y7FA 4KXOA 3ZGGA 2WE9A 3V0QA 3CGXA 2APCA 2V0IA 3RMVA 1YP4A 3F1YA 2RIZA 2D0JA 1YP2A 2OEFA 4MYBA 5CMIA 2X5ZA 1JVDA 2VXLA 1VH3A 1GWWA 1VGWA 4E1KA 1ZI1A 1ZJ0A 4CVHA 1VPAA 1VGZA 3N9WA 2ICXA 1FRWA 3USRA 2WEEA 2V0JA 4Y7TA 2VS4A 1ON6A 2YQCA 3PKPA 3I0IX 2XWMA 3JUJA 4FRQA 2OEGA 1GWVA 5FTVA 1FGXA 1G1LA 1H5RA 2YQHA 3R3IA 1H5SB 1W57A 5C49A 2X65A 5C3DA 2GGOA 3I0LA 4HG6A 2PX7A 5IDSA 4BMAA 1EYRA 2YC3A 4FQWA 4D48A 2BO4A 2QGIA 4M4KA 5HS2A 5FV9A 1MP5A 1TW5A 4HO4A 1H5SC 2P72A 3I0CA 4ASYA 4HCQA 3PKQA 2FY7A 3I0HA 2PA4A 1G93A 2QKXA 1HM8A 1NQIB 4Y6UA 3BRKX 4Y9XA 5CMFX 1FXJA 1V83A 4KT7A 2I5KA 4B3UA 3OAMA 5BXCA 2XMEA 4B2XA 3ZF8A 3ZLKA 1INIA 1ZI4A 4FRLA 3SXCA 4CJBA 1FO9A 4B42A 5EJZA 3CKNA 4M28A 5FTSA 2A8WA 3DJ4A 2E3DA 4HO0A 1FG5N 2ZU8A 3V8ZA 2RJ7A 4FRPA 2GGQA 5JQQA 1G0RA 1H5TA 1H5SA 3EE5A 4Y7UA 3JTJA 4P02A 1GQ9A 2UX8A 4NALA 5CQLX 2RITA 1VGTA 1NMMB 2I5EA 5C3AA 4DECA 5CQNX 4HO9A 4G3QA 2VSIA 3TQDA 1S4PA 4KPXA 5CMHA 1G8OA 1H7EA 1S4OA 4DDZA 5EIYA 2BO6A 2O1FA 5C4CA 3T7OA 1XHBA 5CMJA 2ZU9A 4EE5A 3FWWA 1HM0A 1PZYB 2WVLA 2CU2A 1VZUA 4KPZA 1ZI5A 2I7BA 3D8VA 3R2WA 1WVCA 4AC3A 3LW6A 2JCKA 5DDVA 1JYLA 3I0GA 4B4GA 1WT0A 4NAIA 3ZLLA 5C36A 3OH2A 3CKJA 1H7HA 1TVYA 1HM9A 1OMXA 5L6SA 3IOHA 1VZTA 1YP3A 3I0EA 1H7GA 2JCJA 4GBPA 2WGZA 1ON8A 2VXMA 1H4CA 2A8UA 5FYEA 4IRPA 3I0FA 1R7XA 2WVKA 5FU0A 1WSZA 3SX3A 3V8YA 4FRHA 2V0HA 1WT2A 5EJ1A 1G97A 4JISA 2RJ1A 1FWYA 1ZJOA 3SXDA 4KC1A 1GQCA 2Q4JA
chains in the Genus database with same CATH superfamily
1VZXA 2BO8A 4FCEA 3V90A 2OI7A 1JV3A 1O23B 1G23A 5FU8A 2BO7A 5C4EA 4HO2A 2VFZA 5FUHA 4B4MA 2RJ6A 2X60A 1IINA 1NF5B 4FRMA 2VD4A 1LZ0A 2XMHA 4FRAA 4B2WA 2WVMA 4ECMA 3E25A 1H7QA 1W77A 2AM4A 1HJJA 1LVWA 2ICYA 4B5BA 3JUKA 1ZDGA 2FYBA 2RJ0A 1HJLA 1H4EA 4XWIA 5C1LA 2D7IA 3FOQA 4O6MA 1G3LA 3QVBA 4KNRA 3D5NA 1LZJA 2OI6A 1LL3A 2RJ5A 2NXVA 3U2XA 4LW6A 3ZGFA 3PNNA 3V0LA 3RMWA 1GX0A 4KQLA 1ZDFA 2AM5A 4KC4A 4EVWA 4ASJA 2AGDA 2PGVA 3CKVA 4HO6A 3V91A 2DPWA 5IDTA 3K8DA 1LZIA 2FYAA 1H7FA 5CQMX 5C1HA 1ZJPA 5C4FA 4EEGA 5AJOA 3V0MA 4J18A 2P73A 5DDTA 1GA8A 1WT3A 5C38A 2AM3A 4UEGA 3OH1A 1G95A 4DE7A 4Y7GA 3Q4SA 2VSHA 5C8RA 3U2WA 5AJPA 1I52A 1K4VA 2Y6PA 1H4DA 1FXOA 4EE3A 1OQMB 2XWNA 2ZU7A 4KC2A 1W55A 1H3MA 2C0NA 4ARWA 4Y7VA 4D11C 3U2TA 5C3BA 2RIYA 1ZJ3A 1NWGB 4AAWA 3K8EA 4K6RA 3SXGA 1R7UA 4BQHA 1VICA 4EEOA 2V0LA 3U2UA 1ZCVA 3RSBA 5CMGX 2D7RA 1FGGA 3V0NA 1H5RB 4KRVA 1HV9A 2V0KA 4IRQA 2E8BA 1MC3A 4EE4A 3SX7A 1LL2A 4EEMA 1JVGA 2AH9A 4KNXA 3O3PA 3SXEA 1O7OA 3I0DA 5J49A 1R7YA 4L41C 1R80A 4D11A 3OH0A 4Y63A 2AE7A 1QG8A 3Q7UA 3CKQA 3ST8A 1H5SD 1SS9A 3U0XA 3SPTA 4FRDA 1H7LA 2VK9A 2Z86A 5CQOA 3V0PA 4FROA 3OH3A 3USQA 4CJCA 4C2SA 4NANA 4FRBA 3CKOA 1VGUA 1ZCYA 1OMZA 4JD0A 1VM8A 2AECA 3D98A 1H7TA 2P6WA 2X5SA 3BCVA 4HO8A 3OGZA 3T7NA 3SX8A 1H5TB 4HOCA 4Y62A 5IFYA 4ZDQA 2FFVA 3T7MA 2O1HA 3SXBA 2Z87A 4HO3A 4D0ZA 4M2BA 2WAWA 5CQPA 1Z90A 5I1FA 3DUVA 3CU0A 1R7VA 1JYKA 5C48A 2Y4LA 4FCUA 1QGQA 4YS8A 3TZTA 2J0BA 1KWSA 2YQSA 4B4BA 2O1GA 1FO8A 2RJ4A 1MP4A 1WT1A 4O6NA 3HL3A 1ZCUA 5C4BA 1V82A 4R7PA 2W0WA 3F1CA 1R81A 3Q80A 4M2AA 2FYCB 1INJA 2VS5A 2JCLA 1ZJ1A 1ZIZA 2FYDB 2Y4KA 2Y4JA 3I0JA 1EZIA 2MZBA 4HO5A 5C1GA 3IOJA 3GUEA 1QGSA 5AJNA 2Y7AA 3KIAA 5D92A 4AYJA 2RJ9A 4LW3A 2VS3A 3NGWA 2AESA 1JV1A 1FOAA 3V0OA 4Y64A 2XWLA 1G9RA 2QH5A 3I0KA 3POLA 4G3SA 2YCMA 1NHEB 2Y4MA 1IIMA 1E5KA 1VH1A 1O7QA 2JCOA 4EEAA 2PGYA 1FR9A 1XZ6A 2YESA 1ZCTA 4G87A 1LZ7A 1TW1A 1FZWA 1NKHB 2OI5A 1ZJ2A 4MNDA 1YROB 1R7TA 1S4NA 1V84A 4FIXA 1PZTA 1G2VA 1QWJA 2RIXA 4Y6NA 4CJ8A 2YC5A 1R82A 3IOIA 3SX5A 4AYLA 3OH4A 2YQJA 2RJ8A 4P00A 1MP3A 1GX4A 3DK5A 5L6VA 3E26A 4G3PA 5C4DA 5C47A 4FIYA 1O0RA 4FREA 4NAKA 1ZI3A 3U2VA 1TZFA 1LL0A 3U0YA 2FFUA 3OKRA 4D0TA 1ZHJA 3OC9A 1FR8A 2W0VA 3SXAA 4Y7FA 4KXOA 3ZGGA 2WE9A 3V0QA 3CGXA 2APCA 2V0IA 3RMVA 1YP4A 3F1YA 2RIZA 2D0JA 4MIXA 1YP2A 2OEFA 4MYBA 5CMIA 2X5ZA 1JVDA 2VXLA 1VH3A 1GWWA 1VGWA 4E1KA 1ZI1A 1ZJ0A 4CVHA 1VPAA 1VGZA 3N9WA 2ICXA 1FRWA 3USRA 2WEEA 2V0JA 4Y7TA 2VS4A 2J0AA 1ON6A 2YQCA 3PKPA 3I0IX 2XWMA 3JUJA 4FRQA 2OEGA 1GWVA 5FTVA 1FGXA 1G1LA 1H5RA 2YQHA 3R3IA 1H5SB 1W57A 5C49A 2X65A 5C3DA 2GGOA 3I0LA 4HG6A 2PX7A 5IDSA 4BMAA 1EYRA 2YC3A 4FQWA 4D48A 2BO4A 2QGIA 4M4KA 5HS2A 5FV9A 1MP5A 1TW5A 4HO4A 1H5SC 2P72A 3I0CA 4ASYA 4HCQA 3PKQA 2FY7A 3I0HA 2PA4A 1G93A 2QKXA 1HM8A 1NQIB 4Y6UA 3BRKX 4Y9XA 5CMFX 1FXJA 1V83A 4KT7A 2I5KA 4B3UA 3OAMA 5BXCA 2XMEA 4B2XA 3ZF8A 3ZLKA 1INIA 1ZI4A 4FRLA 3SXCA 4CJBA 1FO9A 4B42A 5D91A 5EJZA 3CKNA 4M28A 5FTSA 2A8WA 3DJ4A 2E3DA 4HO0A 1FG5N 2ZU8A 3V8ZA 2RJ7A 4FRPA 2GGQA 5JQQA 1G0RA 1H5TA 1H5SA 3EE5A 4Y7UA 3JTJA 4P02A 1GQ9A 2UX8A 4NALA 5CQLX 2RITA 1VGTA 1NMMB 2I5EA 5C3AA 4DECA 5CQNX 4HO9A 4G3QA 2VSIA 3TQDA 1S4PA 4KPXA 5CMHA 1G8OA 1H7EA 1S4OA 4DDZA 5EIYA 2BO6A 2O1FA 5C4CA 3T7OA 1XHBA 5CMJA 2ZU9A 4EE5A 3FWWA 1HM0A 1PZYB 2WVLA 2CU2A 1VZUA 4KPZA 1ZI5A 2I7BA 3D8VA 3R2WA 1WVCA 4AC3A 3LW6A 2JCKA 5DDVA 1JYLA 3I0GA 4B4GA 1WT0A 4NAIA 3ZLLA 5C36A 3OH2A 3CKJA 1H7HA 1TVYA 1HM9A 1OMXA 5L6SA 3IOHA 1VZTA 1YP3A 3I0EA 1H7GA 2JCJA 4GBPA 2WGZA 1ON8A 2VXMA 1H4CA 2A8UA 5FYEA 4IRPA 3I0FA 1R7XA 2WVKA 5FU0A 1WSZA 3SX3A 3V8YA 4FRHA 2V0HA 1WT2A 5EJ1A 1G97A 4JISA 4Q7CA 2RJ1A 1FWYA 1ZJOA 3SXDA 4KC1A 1GQCA 2Q4JA
chains in the Genus database with same CATH topology
1VZXA 2BO8A 4FCEA 3V90A 2OI7A 1JV3A 1O23B 1G23A 5FU8A 2BO7A 5C4EA 4HO2A 2VFZA 5FUHA 4B4MA 2RJ6A 2X60A 1IINA 1NF5B 4FRMA 2VD4A 1LZ0A 2XMHA 4FRAA 4B2WA 2WVMA 4ECMA 3E25A 1H7QA 1W77A 2AM4A 1HJJA 1LVWA 2ICYA 4B5BA 3JUKA 1ZDGA 2FYBA 2RJ0A 1HJLA 1H4EA 4XWIA 5C1LA 2D7IA 3FOQA 4O6MA 1G3LA 3QVBA 4KNRA 3D5NA 1LZJA 2OI6A 1LL3A 2RJ5A 2NXVA 3U2XA 4LW6A 3ZGFA 3PNNA 3V0LA 3RMWA 1GX0A 4KQLA 1ZDFA 2AM5A 4KC4A 4EVWA 4ASJA 2AGDA 2PGVA 3CKVA 4HO6A 3V91A 2DPWA 5IDTA 3K8DA 1LZIA 2FYAA 1H7FA 5CQMX 5C1HA 1ZJPA 5C4FA 4EEGA 5AJOA 3V0MA 4J18A 2P73A 5DDTA 1GA8A 1WT3A 5C38A 2AM3A 4UEGA 3OH1A 1G95A 4DE7A 4Y7GA 3Q4SA 2VSHA 5C8RA 3U2WA 5AJPA 1I52A 1K4VA 2Y6PA 1H4DA 1FXOA 4EE3A 1OQMB 2XWNA 2ZU7A 4KC2A 1W55A 1H3MA 2C0NA 4ARWA 4Y7VA 4D11C 3U2TA 5C3BA 2RIYA 1ZJ3A 1NWGB 4AAWA 3K8EA 4K6RA 3SXGA 1R7UA 4BQHA 1VICA 4EEOA 2V0LA 3U2UA 1ZCVA 3RSBA 5CMGX 2D7RA 1FGGA 3V0NA 1H5RB 4KRVA 1HV9A 2V0KA 4IRQA 2E8BA 1MC3A 4EE4A 3SX7A 1LL2A 4EEMA 1JVGA 2AH9A 4KNXA 3O3PA 3SXEA 1O7OA 3I0DA 5J49A 1R7YA 4L41C 1R80A 4D11A 3OH0A 4Y63A 2AE7A 1QG8A 3Q7UA 3CKQA 3ST8A 1H5SD 1SS9A 3U0XA 3SPTA 4FRDA 1H7LA 2VK9A 2Z86A 5CQOA 3V0PA 4FROA 3OH3A 3USQA 4CJCA 4C2SA 4NANA 4FRBA 3CKOA 1VGUA 1ZCYA 1OMZA 4JD0A 1VM8A 2AECA 3D98A 1H7TA 2P6WA 2X5SA 3BCVA 4HO8A 3OGZA 3T7NA 3SX8A 1H5TB 4HOCA 4Y62A 5IFYA 4ZDQA 2FFVA 3T7MA 2O1HA 3SXBA 2Z87A 4HO3A 4D0ZA 4M2BA 2WAWA 5CQPA 1Z90A 5I1FA 3DUVA 3CU0A 1R7VA 1JYKA 5C48A 2Y4LA 4FCUA 1QGQA 4YS8A 3TZTA 2J0BA 1KWSA 2YQSA 4B4BA 2O1GA 1FO8A 2RJ4A 1MP4A 1WT1A 4O6NA 3HL3A 1ZCUA 5C4BA 1V82A 4R7PA 2W0WA 3F1CA 1R81A 3Q80A 4M2AA 2FYCB 1INJA 2VS5A 2JCLA 1ZJ1A 1ZIZA 2FYDB 2Y4KA 2Y4JA 3I0JA 1EZIA 2MZBA 4HO5A 5C1GA 3IOJA 3GUEA 1QGSA 5AJNA 2Y7AA 3KIAA 5D92A 4AYJA 2RJ9A 4LW3A 2VS3A 3NGWA 2AESA 1JV1A 1FOAA 3V0OA 4Y64A 2XWLA 1G9RA 2QH5A 3I0KA 3POLA 4G3SA 2YCMA 1NHEB 2Y4MA 1IIMA 1E5KA 1VH1A 1O7QA 2JCOA 4EEAA 2PGYA 1FR9A 1XZ6A 2YESA 1ZCTA 4G87A 1LZ7A 1TW1A 1FZWA 1NKHB 2OI5A 1ZJ2A 4MNDA 1YROB 1R7TA 1S4NA 1V84A 4FIXA 1PZTA 1G2VA 1QWJA 2RIXA 4Y6NA 4CJ8A 2YC5A 1R82A 3IOIA 3SX5A 4AYLA 3OH4A 2YQJA 2RJ8A 4P00A 1MP3A 1GX4A 3DK5A 5L6VA 3E26A 4G3PA 5C4DA 5C47A 4FIYA 1O0RA 4FREA 4NAKA 1ZI3A 3U2VA 1TZFA 1LL0A 3U0YA 2FFUA 3OKRA 4D0TA 1ZHJA 3OC9A 1FR8A 2W0VA 3SXAA 4Y7FA 4KXOA 3ZGGA 2WE9A 3V0QA 3CGXA 2APCA 2V0IA 3RMVA 1YP4A 3F1YA 2RIZA 2D0JA 4MIXA 1YP2A 2OEFA 4MYBA 5CMIA 2X5ZA 1JVDA 2VXLA 1VH3A 1GWWA 1VGWA 4E1KA 1ZI1A 1ZJ0A 4CVHA 1VPAA 1VGZA 3N9WA 2ICXA 1FRWA 3USRA 2WEEA 2V0JA 4Y7TA 2VS4A 2J0AA 1ON6A 2YQCA 3PKPA 3I0IX 2XWMA 3JUJA 4FRQA 2OEGA 1GWVA 5FTVA 1FGXA 1G1LA 1H5RA 2YQHA 3R3IA 1H5SB 1W57A 5C49A 2X65A 5C3DA 2GGOA 3I0LA 4HG6A 2PX7A 5IDSA 4BMAA 1EYRA 2YC3A 4FQWA 4D48A 2BO4A 2QGIA 4M4KA 5HS2A 5FV9A 1MP5A 1TW5A 4HO4A 1H5SC 2P72A 3I0CA 4ASYA 4HCQA 3PKQA 2FY7A 3I0HA 2PA4A 1G93A 2QKXA 1HM8A 1NQIB 4Y6UA 3BRKX 4Y9XA 5CMFX 1FXJA 1V83A 4KT7A 2I5KA 4B3UA 3OAMA 5BXCA 2XMEA 4B2XA 3ZF8A 3ZLKA 1INIA 1ZI4A 4FRLA 3SXCA 4CJBA 1FO9A 4B42A 5D91A 5EJZA 3CKNA 4M28A 5FTSA 2A8WA 3DJ4A 2E3DA 4HO0A 1FG5N 2ZU8A 3V8ZA 2RJ7A 4FRPA 2GGQA 5JQQA 1G0RA 1H5TA 1H5SA 3EE5A 4Y7UA 3JTJA 4P02A 1GQ9A 2UX8A 4NALA 5CQLX 2RITA 1VGTA 1NMMB 2I5EA 5C3AA 4DECA 5CQNX 4HO9A 4G3QA 2VSIA 3TQDA 1S4PA 4KPXA 5CMHA 1G8OA 1H7EA 1S4OA 4DDZA 5EIYA 2BO6A 2O1FA 5C4CA 3T7OA 1XHBA 5CMJA 2ZU9A 4EE5A 3FWWA 1HM0A 1PZYB 2WVLA 2CU2A 1VZUA 4KPZA 1ZI5A 2I7BA 3D8VA 3R2WA 1WVCA 4AC3A 3LW6A 2JCKA 5DDVA 1JYLA 3I0GA 4B4GA 1WT0A 4NAIA 3ZLLA 5C36A 3OH2A 3CKJA 1H7HA 1TVYA 1HM9A 1OMXA 5L6SA 3IOHA 1VZTA 1YP3A 3I0EA 1H7GA 2JCJA 4GBPA 2WGZA 1ON8A 2VXMA 1H4CA 2A8UA 5FYEA 4IRPA 3I0FA 1R7XA 2WVKA 5FU0A 1WSZA 3SX3A 3V8YA 4FRHA 2V0HA 1WT2A 5EJ1A 1G97A 4JISA 4Q7CA 2RJ1A 1FWYA 1ZJOA 3SXDA 4KC1A 1GQCA 2Q4JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VZX A;  2BO8 A;  4FCE A;  3V90 A;  2OI7 A;  1JV3 A;  1O23 B;  1G23 A;  5FU8 A;  2BO7 A;  5C4E A;  4HO2 A;  2VFZ A;  5FUH A;  4B4M A;  2RJ6 A;  2X60 A;  1IIN A;  1NF5 B;  4FRM A;  2VD4 A;  1LZ0 A;  2XMH A;  4FRA A;  4B2W A;  2WVM A;  4ECM A;  3E25 A;  1H7Q A;  1W77 A;  2AM4 A;  1HJJ A;  1LVW A;  2ICY A;  4B5B A;  3JUK A;  1ZDG A;  2FYB A;  2RJ0 A;  1HJL A;  1H4E A;  4XWI A;  5C1L A;  2D7I A;  3FOQ A;  1G3L A;  3QVB A;  4KNR A;  3D5N A;  1LZJ A;  2OI6 A;  1LL3 A;  2RJ5 A;  2NXV A;  3U2X A;  4LW6 A;  3ZGF A;  3PNN A;  3V0L A;  3RMW A;  1GX0 A;  4KQL A;  1ZDF A;  2AM5 A;  4KC4 A;  4EVW A;  4ASJ A;  2AGD A;  2PGV A;  3CKV A;  4HO6 A;  3V91 A;  2DPW A;  5IDT A;  3K8D A;  1LZI A;  2FYA A;  1H7F A;  5CQM X;  5C1H A;  1ZJP A;  5C4F A;  4EEG A;  5AJO A;  3V0M A;  4J18 A;  2P73 A;  5DDT A;  1GA8 A;  1WT3 A;  5C38 A;  2AM3 A;  4UEG A;  3OH1 A;  1G95 A;  4DE7 A;  4Y7G A;  3Q4S A;  2VSH A;  5C8R A;  3U2W A;  5AJP A;  1I52 A;  1K4V A;  2Y6P A;  1H4D A;  1FXO A;  4EE3 A;  1OQM B;  2XWN A;  2ZU7 A;  4KC2 A;  1W55 A;  1H3M A;  4ARW A;  4Y7V A;  4D11 C;  3U2T A;  5C3B A;  2RIY A;  1ZJ3 A;  1NWG B;  4AAW A;  3K8E A;  4K6R A;  3SXG A;  1R7U A;  4BQH A;  1VIC A;  4EEO A;  2V0L A;  3U2U A;  1ZCV A;  3RSB A;  5CMG X;  2D7R A;  1FGG A;  3V0N A;  1H5R B;  4KRV A;  1HV9 A;  2V0K A;  4IRQ A;  2E8B A;  1MC3 A;  4EE4 A;  3SX7 A;  1LL2 A;  4EEM A;  1JVG A;  2AH9 A;  4KNX A;  3O3P A;  3SXE A;  1O7O A;  3I0D A;  5J49 A;  1R7Y A;  4L41 C;  1R80 A;  4D11 A;  3OH0 A;  4Y63 A;  2AE7 A;  1QG8 A;  3Q7U A;  3CKQ A;  3ST8 A;  1H5S D;  1SS9 A;  3U0X A;  3SPT A;  4FRD A;  1H7L A;  2Z86 A;  5CQO A;  3V0P A;  4FRO A;  3OH3 A;  3USQ A;  4CJC A;  4C2S A;  4NAN A;  4FRB A;  3CKO A;  1VGU A;  1ZCY A;  1OMZ A;  4JD0 A;  1VM8 A;  2AEC A;  3D98 A;  1H7T A;  2P6W A;  2X5S A;  3BCV A;  4HO8 A;  3OGZ A;  3T7N A;  3SX8 A;  1H5T B;  4HOC A;  4Y62 A;  5IFY A;  4ZDQ A;  2FFV A;  3T7M A;  2O1H A;  3SXB A;  2Z87 A;  4HO3 A;  4D0Z A;  4M2B A;  2WAW A;  5CQP A;  1Z90 A;  5I1F A;  3DUV A;  3CU0 A;  1R7V A;  1JYK A;  5C48 A;  2Y4L A;  4FCU A;  1QGQ A;  4YS8 A;  3TZT A;  1KWS A;  2YQS A;  4B4B A;  2O1G A;  1FO8 A;  2RJ4 A;  1MP4 A;  1WT1 A;  3HL3 A;  1ZCU A;  5C4B A;  1V82 A;  4R7P A;  2W0W A;  3F1C A;  1R81 A;  3Q80 A;  4M2A A;  2FYC B;  1INJ A;  2VS5 A;  2JCL A;  1ZJ1 A;  1ZIZ A;  2FYD B;  2Y4K A;  2Y4J A;  3I0J A;  1EZI A;  2MZB A;  4HO5 A;  5C1G A;  3IOJ A;  3GUE A;  1QGS A;  5AJN A;  2Y7A A;  3KIA A;  4AYJ A;  2RJ9 A;  4LW3 A;  2VS3 A;  3NGW A;  2AES A;  1JV1 A;  1FOA A;  3V0O A;  4Y64 A;  2XWL A;  1G9R A;  2QH5 A;  3I0K A;  3POL A;  4G3S A;  2YCM A;  1NHE B;  2Y4M A;  1IIM A;  1E5K A;  1VH1 A;  1O7Q A;  2JCO A;  4EEA A;  2PGY A;  1FR9 A;  1XZ6 A;  2YES A;  1ZCT A;  4G87 A;  1LZ7 A;  1TW1 A;  1FZW A;  1NKH B;  2OI5 A;  1ZJ2 A;  4MND A;  1YRO B;  1R7T A;  1S4N A;  1V84 A;  1PZT A;  1G2V A;  1QWJ A;  2RIX A;  4Y6N A;  4CJ8 A;  2YC5 A;  1R82 A;  3IOI A;  3SX5 A;  4AYL A;  3OH4 A;  2YQJ A;  2RJ8 A;  4P00 A;  1MP3 A;  1GX4 A;  3DK5 A;  5L6V A;  3E26 A;  4G3P A;  5C4D A;  5C47 A;  1O0R A;  4FRE A;  4NAK A;  1ZI3 A;  3U2V A;  1TZF A;  1LL0 A;  3U0Y A;  2FFU A;  3OKR A;  4D0T A;  1ZHJ A;  3OC9 A;  1FR8 A;  2W0V A;  3SXA A;  4Y7F A;  4KXO A;  3ZGG A;  2WE9 A;  3V0Q A;  3CGX A;  2APC A;  2V0I A;  3RMV A;  1YP4 A;  3F1Y A;  2RIZ A;  2D0J A;  1YP2 A;  2OEF A;  4MYB A;  5CMI A;  2X5Z A;  1JVD A;  2VXL A;  1VH3 A;  1GWW A;  1VGW A;  4E1K A;  1ZI1 A;  1ZJ0 A;  4CVH A;  1VPA A;  1VGZ A;  3N9W A;  2ICX A;  1FRW A;  3USR A;  2WEE A;  2V0J A;  4Y7T A;  2VS4 A;  1ON6 A;  2YQC A;  3PKP A;  3I0I X;  2XWM A;  3JUJ A;  4FRQ A;  2OEG A;  1GWV A;  5FTV A;  1FGX A;  1G1L A;  1H5R A;  2YQH A;  3R3I A;  1H5S B;  1W57 A;  5C49 A;  2X65 A;  5C3D A;  2GGO A;  3I0L A;  4HG6 A;  2PX7 A;  5IDS A;  4BMA A;  1EYR A;  2YC3 A;  4FQW A;  4D48 A;  2BO4 A;  2QGI A;  4M4K A;  5HS2 A;  5FV9 A;  1MP5 A;  1TW5 A;  4HO4 A;  1H5S C;  2P72 A;  3I0C A;  4ASY A;  4HCQ A;  3PKQ A;  2FY7 A;  3I0H A;  2PA4 A;  1G93 A;  2QKX A;  1HM8 A;  1NQI B;  4Y6U A;  3BRK X;  4Y9X A;  5CMF X;  1FXJ A;  1V83 A;  4KT7 A;  2I5K A;  4B3U A;  3OAM A;  5BXC A;  2XME A;  4B2X A;  3ZF8 A;  3ZLK A;  1INI A;  1ZI4 A;  4FRL A;  3SXC A;  4CJB A;  1FO9 A;  4B42 A;  5EJZ A;  3CKN A;  4M28 A;  5FTS A;  2A8W A;  3DJ4 A;  2E3D A;  4HO0 A;  1FG5 N;  2ZU8 A;  3V8Z A;  2RJ7 A;  4FRP A;  2GGQ A;  5JQQ A;  1G0R A;  1H5T A;  1H5S A;  3EE5 A;  4Y7U A;  3JTJ A;  4P02 A;  1GQ9 A;  2UX8 A;  4NAL A;  5CQL X;  2RIT A;  1VGT A;  1NMM B;  2I5E A;  5C3A A;  4DEC A;  5CQN X;  4HO9 A;  4G3Q A;  2VSI A;  3TQD A;  1S4P A;  4KPX A;  5CMH A;  1G8O A;  1H7E A;  1S4O A;  4DDZ A;  5EIY A;  2BO6 A;  2O1F A;  5C4C A;  3T7O A;  1XHB A;  5CMJ A;  2ZU9 A;  4EE5 A;  3FWW A;  1HM0 A;  1PZY B;  2WVL A;  2CU2 A;  1VZU A;  4KPZ A;  1ZI5 A;  2I7B A;  3D8V A;  3R2W A;  1WVC A;  4AC3 A;  3LW6 A;  2JCK A;  5DDV A;  1JYL A;  3I0G A;  4B4G A;  1WT0 A;  4NAI A;  3ZLL A;  5C36 A;  3OH2 A;  3CKJ A;  1H7H A;  1TVY A;  1HM9 A;  1OMX A;  5L6S A;  3IOH A;  1VZT A;  1YP3 A;  3I0E A;  1H7G A;  2JCJ A;  4GBP A;  2WGZ A;  1ON8 A;  2VXM A;  1H4C A;  2A8U A;  5FYE A;  4IRP A;  3I0F A;  1R7X A;  2WVK A;  5FU0 A;  1WSZ A;  3SX3 A;  3V8Y A;  4FRH A;  2V0H A;  1WT2 A;  5EJ1 A;  1G97 A;  4JIS A;  2RJ1 A;  1FWY A;  1ZJO A;  3SXD A;  4KC1 A;  1GQC A;  2Q4J A; 
#chains in the Genus database with same CATH topology
 1VZX A;  2BO8 A;  4FCE A;  3V90 A;  2OI7 A;  1JV3 A;  1O23 B;  1G23 A;  5FU8 A;  2BO7 A;  5C4E A;  4HO2 A;  2VFZ A;  5FUH A;  4B4M A;  2RJ6 A;  2X60 A;  1IIN A;  1NF5 B;  4FRM A;  2VD4 A;  1LZ0 A;  2XMH A;  4FRA A;  4B2W A;  2WVM A;  4ECM A;  3E25 A;  1H7Q A;  1W77 A;  2AM4 A;  1HJJ A;  1LVW A;  2ICY A;  4B5B A;  3JUK A;  1ZDG A;  2FYB A;  2RJ0 A;  1HJL A;  1H4E A;  4XWI A;  5C1L A;  2D7I A;  3FOQ A;  4O6M A;  1G3L A;  3QVB A;  4KNR A;  3D5N A;  1LZJ A;  2OI6 A;  1LL3 A;  2RJ5 A;  2NXV A;  3U2X A;  4LW6 A;  3ZGF A;  3PNN A;  3V0L A;  3RMW A;  1GX0 A;  4KQL A;  1ZDF A;  2AM5 A;  4KC4 A;  4EVW A;  4ASJ A;  2AGD A;  2PGV A;  3CKV A;  4HO6 A;  3V91 A;  2DPW A;  5IDT A;  3K8D A;  1LZI A;  2FYA A;  1H7F A;  5CQM X;  5C1H A;  1ZJP A;  5C4F A;  4EEG A;  5AJO A;  3V0M A;  4J18 A;  2P73 A;  5DDT A;  1GA8 A;  1WT3 A;  5C38 A;  2AM3 A;  4UEG A;  3OH1 A;  1G95 A;  4DE7 A;  4Y7G A;  3Q4S A;  2VSH A;  5C8R A;  3U2W A;  5AJP A;  1I52 A;  1K4V A;  2Y6P A;  1H4D A;  1FXO A;  4EE3 A;  1OQM B;  2XWN A;  2ZU7 A;  4KC2 A;  1W55 A;  1H3M A;  2C0N A;  4ARW A;  4Y7V A;  4D11 C;  3U2T A;  5C3B A;  2RIY A;  1ZJ3 A;  1NWG B;  4AAW A;  3K8E A;  4K6R A;  3SXG A;  1R7U A;  4BQH A;  1VIC A;  4EEO A;  2V0L A;  3U2U A;  1ZCV A;  3RSB A;  5CMG X;  2D7R A;  1FGG A;  3V0N A;  1H5R B;  4KRV A;  1HV9 A;  2V0K A;  4IRQ A;  2E8B A;  1MC3 A;  4EE4 A;  3SX7 A;  1LL2 A;  4EEM A;  1JVG A;  2AH9 A;  4KNX A;  3O3P A;  3SXE A;  1O7O A;  3I0D A;  5J49 A;  1R7Y A;  4L41 C;  1R80 A;  4D11 A;  3OH0 A;  4Y63 A;  2AE7 A;  1QG8 A;  3Q7U A;  3CKQ A;  3ST8 A;  1H5S D;  1SS9 A;  3U0X A;  3SPT A;  4FRD A;  1H7L A;  2VK9 A;  2Z86 A;  5CQO A;  3V0P A;  4FRO A;  3OH3 A;  3USQ A;  4CJC A;  4C2S A;  4NAN A;  4FRB A;  3CKO A;  1VGU A;  1ZCY A;  1OMZ A;  4JD0 A;  1VM8 A;  2AEC A;  3D98 A;  1H7T A;  2P6W A;  2X5S A;  3BCV A;  4HO8 A;  3OGZ A;  3T7N A;  3SX8 A;  1H5T B;  4HOC A;  4Y62 A;  5IFY A;  4ZDQ A;  2FFV A;  3T7M A;  2O1H A;  3SXB A;  2Z87 A;  4HO3 A;  4D0Z A;  4M2B A;  2WAW A;  5CQP A;  1Z90 A;  5I1F A;  3DUV A;  3CU0 A;  1R7V A;  1JYK A;  5C48 A;  2Y4L A;  4FCU A;  1QGQ A;  4YS8 A;  3TZT A;  2J0B A;  1KWS A;  2YQS A;  4B4B A;  2O1G A;  1FO8 A;  2RJ4 A;  1MP4 A;  1WT1 A;  4O6N A;  3HL3 A;  1ZCU A;  5C4B A;  1V82 A;  4R7P A;  2W0W A;  3F1C A;  1R81 A;  3Q80 A;  4M2A A;  2FYC B;  1INJ A;  2VS5 A;  2JCL A;  1ZJ1 A;  1ZIZ A;  2FYD B;  2Y4K A;  2Y4J A;  3I0J A;  1EZI A;  2MZB A;  4HO5 A;  5C1G A;  3IOJ A;  3GUE A;  1QGS A;  5AJN A;  2Y7A A;  3KIA A;  5D92 A;  4AYJ A;  2RJ9 A;  4LW3 A;  2VS3 A;  3NGW A;  2AES A;  1JV1 A;  1FOA A;  3V0O A;  4Y64 A;  2XWL A;  1G9R A;  2QH5 A;  3I0K A;  3POL A;  4G3S A;  2YCM A;  1NHE B;  2Y4M A;  1IIM A;  1E5K A;  1VH1 A;  1O7Q A;  2JCO A;  4EEA A;  2PGY A;  1FR9 A;  1XZ6 A;  2YES A;  1ZCT A;  4G87 A;  1LZ7 A;  1TW1 A;  1FZW A;  1NKH B;  2OI5 A;  1ZJ2 A;  4MND A;  1YRO B;  1R7T A;  1S4N A;  1V84 A;  4FIX A;  1PZT A;  1G2V A;  1QWJ A;  2RIX A;  4Y6N A;  4CJ8 A;  2YC5 A;  1R82 A;  3IOI A;  3SX5 A;  4AYL A;  3OH4 A;  2YQJ A;  2RJ8 A;  4P00 A;  1MP3 A;  1GX4 A;  3DK5 A;  5L6V A;  3E26 A;  4G3P A;  5C4D A;  5C47 A;  4FIY A;  1O0R A;  4FRE A;  4NAK A;  1ZI3 A;  3U2V A;  1TZF A;  1LL0 A;  3U0Y A;  2FFU A;  3OKR A;  4D0T A;  1ZHJ A;  3OC9 A;  1FR8 A;  2W0V A;  3SXA A;  4Y7F A;  4KXO A;  3ZGG A;  2WE9 A;  3V0Q A;  3CGX A;  2APC A;  2V0I A;  3RMV A;  1YP4 A;  3F1Y A;  2RIZ A;  2D0J A;  4MIX A;  1YP2 A;  2OEF A;  4MYB A;  5CMI A;  2X5Z A;  1JVD A;  2VXL A;  1VH3 A;  1GWW A;  1VGW A;  4E1K A;  1ZI1 A;  1ZJ0 A;  4CVH A;  1VPA A;  1VGZ A;  3N9W A;  2ICX A;  1FRW A;  3USR A;  2WEE A;  2V0J A;  4Y7T A;  2VS4 A;  2J0A A;  1ON6 A;  2YQC A;  3PKP A;  3I0I X;  2XWM A;  3JUJ A;  4FRQ A;  2OEG A;  1GWV A;  5FTV A;  1FGX A;  1G1L A;  1H5R A;  2YQH A;  3R3I A;  1H5S B;  1W57 A;  5C49 A;  2X65 A;  5C3D A;  2GGO A;  3I0L A;  4HG6 A;  2PX7 A;  5IDS A;  4BMA A;  1EYR A;  2YC3 A;  4FQW A;  4D48 A;  2BO4 A;  2QGI A;  4M4K A;  5HS2 A;  5FV9 A;  1MP5 A;  1TW5 A;  4HO4 A;  1H5S C;  2P72 A;  3I0C A;  4ASY A;  4HCQ A;  3PKQ A;  2FY7 A;  3I0H A;  2PA4 A;  1G93 A;  2QKX A;  1HM8 A;  1NQI B;  4Y6U A;  3BRK X;  4Y9X A;  5CMF X;  1FXJ A;  1V83 A;  4KT7 A;  2I5K A;  4B3U A;  3OAM A;  5BXC A;  2XME A;  4B2X A;  3ZF8 A;  3ZLK A;  1INI A;  1ZI4 A;  4FRL A;  3SXC A;  4CJB A;  1FO9 A;  4B42 A;  5D91 A;  5EJZ A;  3CKN A;  4M28 A;  5FTS A;  2A8W A;  3DJ4 A;  2E3D A;  4HO0 A;  1FG5 N;  2ZU8 A;  3V8Z A;  2RJ7 A;  4FRP A;  2GGQ A;  5JQQ A;  1G0R A;  1H5T A;  1H5S A;  3EE5 A;  4Y7U A;  3JTJ A;  4P02 A;  1GQ9 A;  2UX8 A;  4NAL A;  5CQL X;  2RIT A;  1VGT A;  1NMM B;  2I5E A;  5C3A A;  4DEC A;  5CQN X;  4HO9 A;  4G3Q A;  2VSI A;  3TQD A;  1S4P A;  4KPX A;  5CMH A;  1G8O A;  1H7E A;  1S4O A;  4DDZ A;  5EIY A;  2BO6 A;  2O1F A;  5C4C A;  3T7O A;  1XHB A;  5CMJ A;  2ZU9 A;  4EE5 A;  3FWW A;  1HM0 A;  1PZY B;  2WVL A;  2CU2 A;  1VZU A;  4KPZ A;  1ZI5 A;  2I7B A;  3D8V A;  3R2W A;  1WVC A;  4AC3 A;  3LW6 A;  2JCK A;  5DDV A;  1JYL A;  3I0G A;  4B4G A;  1WT0 A;  4NAI A;  3ZLL A;  5C36 A;  3OH2 A;  3CKJ A;  1H7H A;  1TVY A;  1HM9 A;  1OMX A;  5L6S A;  3IOH A;  1VZT A;  1YP3 A;  3I0E A;  1H7G A;  2JCJ A;  4GBP A;  2WGZ A;  1ON8 A;  2VXM A;  1H4C A;  2A8U A;  5FYE A;  4IRP A;  3I0F A;  1R7X A;  2WVK A;  5FU0 A;  1WSZ A;  3SX3 A;  3V8Y A;  4FRH A;  2V0H A;  1WT2 A;  5EJ1 A;  1G97 A;  4JIS A;  4Q7C A;  2RJ1 A;  1FWY A;  1ZJO A;  3SXD A;  4KC1 A;  1GQC A;  2Q4J A; 
#chains in the Genus database with same CATH homology
 1VZX A;  2BO8 A;  4FCE A;  3V90 A;  2OI7 A;  1JV3 A;  1O23 B;  1G23 A;  5FU8 A;  2BO7 A;  5C4E A;  4HO2 A;  2VFZ A;  5FUH A;  4B4M A;  2RJ6 A;  2X60 A;  1IIN A;  1NF5 B;  4FRM A;  2VD4 A;  1LZ0 A;  2XMH A;  4FRA A;  4B2W A;  2WVM A;  4ECM A;  3E25 A;  1H7Q A;  1W77 A;  2AM4 A;  1HJJ A;  1LVW A;  2ICY A;  4B5B A;  3JUK A;  1ZDG A;  2FYB A;  2RJ0 A;  1HJL A;  1H4E A;  4XWI A;  5C1L A;  2D7I A;  3FOQ A;  4O6M A;  1G3L A;  3QVB A;  4KNR A;  3D5N A;  1LZJ A;  2OI6 A;  1LL3 A;  2RJ5 A;  2NXV A;  3U2X A;  4LW6 A;  3ZGF A;  3PNN A;  3V0L A;  3RMW A;  1GX0 A;  4KQL A;  1ZDF A;  2AM5 A;  4KC4 A;  4EVW A;  4ASJ A;  2AGD A;  2PGV A;  3CKV A;  4HO6 A;  3V91 A;  2DPW A;  5IDT A;  3K8D A;  1LZI A;  2FYA A;  1H7F A;  5CQM X;  5C1H A;  1ZJP A;  5C4F A;  4EEG A;  5AJO A;  3V0M A;  4J18 A;  2P73 A;  5DDT A;  1GA8 A;  1WT3 A;  5C38 A;  2AM3 A;  4UEG A;  3OH1 A;  1G95 A;  4DE7 A;  4Y7G A;  3Q4S A;  2VSH A;  5C8R A;  3U2W A;  5AJP A;  1I52 A;  1K4V A;  2Y6P A;  1H4D A;  1FXO A;  4EE3 A;  1OQM B;  2XWN A;  2ZU7 A;  4KC2 A;  1W55 A;  1H3M A;  2C0N A;  4ARW A;  4Y7V A;  4D11 C;  3U2T A;  5C3B A;  2RIY A;  1ZJ3 A;  1NWG B;  4AAW A;  3K8E A;  4K6R A;  3SXG A;  1R7U A;  4BQH A;  1VIC A;  4EEO A;  2V0L A;  3U2U A;  1ZCV A;  3RSB A;  5CMG X;  2D7R A;  1FGG A;  3V0N A;  1H5R B;  4KRV A;  1HV9 A;  2V0K A;  4IRQ A;  2E8B A;  1MC3 A;  4EE4 A;  3SX7 A;  1LL2 A;  4EEM A;  1JVG A;  2AH9 A;  4KNX A;  3O3P A;  3SXE A;  1O7O A;  3I0D A;  5J49 A;  1R7Y A;  4L41 C;  1R80 A;  4D11 A;  3OH0 A;  4Y63 A;  2AE7 A;  1QG8 A;  3Q7U A;  3CKQ A;  3ST8 A;  1H5S D;  1SS9 A;  3U0X A;  3SPT A;  4FRD A;  1H7L A;  2VK9 A;  2Z86 A;  5CQO A;  3V0P A;  4FRO A;  3OH3 A;  3USQ A;  4CJC A;  4C2S A;  4NAN A;  4FRB A;  3CKO A;  1VGU A;  1ZCY A;  1OMZ A;  4JD0 A;  1VM8 A;  2AEC A;  3D98 A;  1H7T A;  2P6W A;  2X5S A;  3BCV A;  4HO8 A;  3OGZ A;  3T7N A;  3SX8 A;  1H5T B;  4HOC A;  4Y62 A;  5IFY A;  4ZDQ A;  2FFV A;  3T7M A;  2O1H A;  3SXB A;  2Z87 A;  4HO3 A;  4D0Z A;  4M2B A;  2WAW A;  5CQP A;  1Z90 A;  5I1F A;  3DUV A;  3CU0 A;  1R7V A;  1JYK A;  5C48 A;  2Y4L A;  4FCU A;  1QGQ A;  4YS8 A;  3TZT A;  2J0B A;  1KWS A;  2YQS A;  4B4B A;  2O1G A;  1FO8 A;  2RJ4 A;  1MP4 A;  1WT1 A;  4O6N A;  3HL3 A;  1ZCU A;  5C4B A;  1V82 A;  4R7P A;  2W0W A;  3F1C A;  1R81 A;  3Q80 A;  4M2A A;  2FYC B;  1INJ A;  2VS5 A;  2JCL A;  1ZJ1 A;  1ZIZ A;  2FYD B;  2Y4K A;  2Y4J A;  3I0J A;  1EZI A;  2MZB A;  4HO5 A;  5C1G A;  3IOJ A;  3GUE A;  1QGS A;  5AJN A;  2Y7A A;  3KIA A;  5D92 A;  4AYJ A;  2RJ9 A;  4LW3 A;  2VS3 A;  3NGW A;  2AES A;  1JV1 A;  1FOA A;  3V0O A;  4Y64 A;  2XWL A;  1G9R A;  2QH5 A;  3I0K A;  3POL A;  4G3S A;  2YCM A;  1NHE B;  2Y4M A;  1IIM A;  1E5K A;  1VH1 A;  1O7Q A;  2JCO A;  4EEA A;  2PGY A;  1FR9 A;  1XZ6 A;  2YES A;  1ZCT A;  4G87 A;  1LZ7 A;  1TW1 A;  1FZW A;  1NKH B;  2OI5 A;  1ZJ2 A;  4MND A;  1YRO B;  1R7T A;  1S4N A;  1V84 A;  4FIX A;  1PZT A;  1G2V A;  1QWJ A;  2RIX A;  4Y6N A;  4CJ8 A;  2YC5 A;  1R82 A;  3IOI A;  3SX5 A;  4AYL A;  3OH4 A;  2YQJ A;  2RJ8 A;  4P00 A;  1MP3 A;  1GX4 A;  3DK5 A;  5L6V A;  3E26 A;  4G3P A;  5C4D A;  5C47 A;  4FIY A;  1O0R A;  4FRE A;  4NAK A;  1ZI3 A;  3U2V A;  1TZF A;  1LL0 A;  3U0Y A;  2FFU A;  3OKR A;  4D0T A;  1ZHJ A;  3OC9 A;  1FR8 A;  2W0V A;  3SXA A;  4Y7F A;  4KXO A;  3ZGG A;  2WE9 A;  3V0Q A;  3CGX A;  2APC A;  2V0I A;  3RMV A;  1YP4 A;  3F1Y A;  2RIZ A;  2D0J A;  4MIX A;  1YP2 A;  2OEF A;  4MYB A;  5CMI A;  2X5Z A;  1JVD A;  2VXL A;  1VH3 A;  1GWW A;  1VGW A;  4E1K A;  1ZI1 A;  1ZJ0 A;  4CVH A;  1VPA A;  1VGZ A;  3N9W A;  2ICX A;  1FRW A;  3USR A;  2WEE A;  2V0J A;  4Y7T A;  2VS4 A;  2J0A A;  1ON6 A;  2YQC A;  3PKP A;  3I0I X;  2XWM A;  3JUJ A;  4FRQ A;  2OEG A;  1GWV A;  5FTV A;  1FGX A;  1G1L A;  1H5R A;  2YQH A;  3R3I A;  1H5S B;  1W57 A;  5C49 A;  2X65 A;  5C3D A;  2GGO A;  3I0L A;  4HG6 A;  2PX7 A;  5IDS A;  4BMA A;  1EYR A;  2YC3 A;  4FQW A;  4D48 A;  2BO4 A;  2QGI A;  4M4K A;  5HS2 A;  5FV9 A;  1MP5 A;  1TW5 A;  4HO4 A;  1H5S C;  2P72 A;  3I0C A;  4ASY A;  4HCQ A;  3PKQ A;  2FY7 A;  3I0H A;  2PA4 A;  1G93 A;  2QKX A;  1HM8 A;  1NQI B;  4Y6U A;  3BRK X;  4Y9X A;  5CMF X;  1FXJ A;  1V83 A;  4KT7 A;  2I5K A;  4B3U A;  3OAM A;  5BXC A;  2XME A;  4B2X A;  3ZF8 A;  3ZLK A;  1INI A;  1ZI4 A;  4FRL A;  3SXC A;  4CJB A;  1FO9 A;  4B42 A;  5D91 A;  5EJZ A;  3CKN A;  4M28 A;  5FTS A;  2A8W A;  3DJ4 A;  2E3D A;  4HO0 A;  1FG5 N;  2ZU8 A;  3V8Z A;  2RJ7 A;  4FRP A;  2GGQ A;  5JQQ A;  1G0R A;  1H5T A;  1H5S A;  3EE5 A;  4Y7U A;  3JTJ A;  4P02 A;  1GQ9 A;  2UX8 A;  4NAL A;  5CQL X;  2RIT A;  1VGT A;  1NMM B;  2I5E A;  5C3A A;  4DEC A;  5CQN X;  4HO9 A;  4G3Q A;  2VSI A;  3TQD A;  1S4P A;  4KPX A;  5CMH A;  1G8O A;  1H7E A;  1S4O A;  4DDZ A;  5EIY A;  2BO6 A;  2O1F A;  5C4C A;  3T7O A;  1XHB A;  5CMJ A;  2ZU9 A;  4EE5 A;  3FWW A;  1HM0 A;  1PZY B;  2WVL A;  2CU2 A;  1VZU A;  4KPZ A;  1ZI5 A;  2I7B A;  3D8V A;  3R2W A;  1WVC A;  4AC3 A;  3LW6 A;  2JCK A;  5DDV A;  1JYL A;  3I0G A;  4B4G A;  1WT0 A;  4NAI A;  3ZLL A;  5C36 A;  3OH2 A;  3CKJ A;  1H7H A;  1TVY A;  1HM9 A;  1OMX A;  5L6S A;  3IOH A;  1VZT A;  1YP3 A;  3I0E A;  1H7G A;  2JCJ A;  4GBP A;  2WGZ A;  1ON8 A;  2VXM A;  1H4C A;  2A8U A;  5FYE A;  4IRP A;  3I0F A;  1R7X A;  2WVK A;  5FU0 A;  1WSZ A;  3SX3 A;  3V8Y A;  4FRH A;  2V0H A;  1WT2 A;  5EJ1 A;  1G97 A;  4JIS A;  4Q7C A;  2RJ1 A;  1FWY A;  1ZJO A;  3SXD A;  4KC1 A;  1GQC A;  2Q4J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...