4KRVA

Crystal structure of catalytic domain of bovine beta1,4-galactosyltransferase mutant m344h-galt1 complex with 6-sulfo-glcnac
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
272
structure length
272
Chain Sequence
LTACPEESPLLVGPMLIEFNIPVDLKLVEQQNPKVKLGGRYTPMDCISPHKVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGESMFNRAKLLNVGFKEALKDYDYNCFVFSDVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLSINGFPNNYWGWGGEDDDIYNRLAFRGMSVSRPNAVIGKTRHIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYMVLEVQRYPLYTKITVDIGTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Beta-1,4-galactosyltransferase 1
publication title Investigations on beta 1,4-galactosyltransferase I using 6-sulfo-GlcNAc as an acceptor sugar substrate.
pubmed doi rcsb
source organism Bos taurus
total genus 93
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.4.1.22: Lactose synthase.
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02709 Glyco_transf_7C N-terminal domain of galactosyltransferase
A PF13733 Glyco_transf_7N N-terminal region of glycosyl transferase group 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4krvA00
1VH1A 1EZIA 1H7QA 1ZCYA 1G3LA 3R2WA 4P00A 3D98A 4FRBA 4Y6NA 1VGTA 4AYJA 5L6SA 1HM0A 3TZTA 1NMMB 1ON6A 4D11A 4FRLA 2FFUA 2BO8A 3SXEA 3V8ZA 1YP3A 3F1CA 1MP3A 1LVWA 2V0KA 1FR9A 2OI6A 5FTSA 5DDVA 1H7HA 3V0LA 1H7LA 4HG6A 2V0IA 2NXVA 3SX5A 1LZ0A 3SXCA 3SXDA 3CU0A 1LL2A 2Y4MA 3OH4A 3RMVA 1INIA 1H5SB 1ZDGA 1NKHB 2GGOA 1VM8A 4Y7VA 2PX7A 2OI7A 4DECA 3U2WA 2JCLA 2JCJA 2RITA 4UEGA 3I0HA 5JQQA 3U2XA 1R80A 4K6RA 5CMJA 4EVWA 4J18A 4FRQA 2AGDA 4KRVA 1HJJA 2BO4A 4KPXA 1ZI3A 2A8UA 1WT1A 1ZI5A 2GGQA 4CVHA 1VICA 1PZTA 1ZIZA 1W77A 1H3MA 3IOHA 2RJ4A 1LL0A 2RIZA 4M2AA 4R7PA 1O7OA 1ZCUA 1ZHJA 2AESA 4Y6UA 4HO4A 4HOCA 3KIAA 2RJ6A 1FXJA 4ARWA 1O0RA 1GA8A 3CGXA 5CQMX 3V90A 4B2XA 5C48A 5AJOA 1GWWA 1JYLA 4GBPA 2O1GA 2W0WA 4Y64A 2WVMA 4B3UA 1JYKA 3F1YA 2D7IA 4EEAA 1S4PA 5CQPA 1E5KA 2Y4KA 4DE7A 3E26A 1H7FA 1G95A 4KNXA 2V0JA 5CMIA 2PGVA 4FCUA 4EEOA 1OMZA 4Y7GA 1FWYA 1EYRA 1V82A 3IOIA 1WT2A 5FV9A 3OC9A 3V0NA 5EIYA 2YQJA 4BMAA 1R7TA 5CMGX 1HM9A 4EEMA 1ZCTA 2A8WA 3I0KA 3GUEA 4ASJA 4B4GA 4IRPA 3HL3A 3I0IX 1ZJ3A 4ASYA 2AH9A 5C1GA 5J49A 4AC3A 1H5TB 4Y9XA 3T7OA 1H7EA 4NALA 4D48A 2BO7A 5FTVA 1NF5B 5AJPA 2QGIA 4NANA 1HV9A 5EJZA 1VZXA 4AYLA 3USRA 1TZFA 1R7VA 2RIYA 4FRDA 1H5RB 3NGWA 5FUHA 2I5EA 5C4CA 5IDSA 2VSIA 4CJ8A 1FG5N 3I0JA 3SX8A 4Y63A 2YQHA 1R81A 2FY7A 3OGZA 5IDTA 5CQLX 1O23B 4YS8A 1ZJ1A 2YQSA 5FU8A 2O1HA 1PZYB 2RJ1A 1GX4A 4KXOA 4EE5A 2D7RA 3OH1A 4FREA 1OQMB 4B4MA 4D11C 2OEGA 2ZU7A 1H5RA 3QVBA 3V0MA 1G23A 1YP4A 4HO2A 1NHEB 4KC1A 2I5KA 3PKPA 1ZJ0A 3E25A 4P02A 1QGQA 1VH3A 1R7YA 1IINA 4B42A 2YESA 1G9RA 1G2VA 3PKQA 1FO9A 3N9WA 3V0QA 4FCEA 3DUVA 2FYBA 1VGUA 3ZLLA 1VZUA 2V0LA 1R7XA 1NWGB 3D5NA 1ZJPA 2Y7AA 1SS9A 3V8YA 1H5SA 5C3DA 3JTJA 1INJA 1WT3A 3U2UA 2ICXA 3CKQA 1GX0A 3I0EA 3I0LA 4M4KA 5BXCA 4KC2A 2WE9A 4FQWA 3OH3A 4D0ZA 4MNDA 1G93A 4MYBA 2P6WA 3V0PA 4LW3A 1ON8A 3OAMA 1LZ7A 1WVCA 2AM5A 2XWMA 5CMHA 1FRWA 2RJ9A 3CKNA 5HS2A 1ZCVA 3ZGGA 4JD0A 1MC3A 1I52A 1JV1A 2QKXA 1H7TA 3V91A 1G0RA 5C4DA 1FO8A 4B4BA 3K8DA 1LL3A 3FOQA 1TW5A 4KC4A 3D8VA 1G8OA 2BO6A 3ZLKA 2P73A 5EJ1A 3R3IA 4LW6A 2JCKA 2FYAA 3ZGFA 4HO0A 1OMXA 2O1FA 1XZ6A 4G3QA 1H5SD 1WT0A 3K8EA 5C38A 4NAIA 5AJNA 5CMFX 2ZU8A 1VGWA 1O7QA 2Y6PA 3TQDA 3PNNA 2VXLA 3I0CA 5DDTA 1ZJOA 2YC3A 4FROA 2XWLA 1H4EA 1LZIA 1QWJA 2APCA 1H7GA 1S4NA 1FOAA 3OH2A 2YCMA 3ST8A 1LZJA 5C3AA 2RJ7A 3Q7UA 5C1LA 2RIXA 2OEFA 2RJ8A 2XMHA 4ZDQA 4DDZA 4Y62A 1H4DA 3RMWA 5I1FA 1FGXA 2RJ5A 1V83A 2WVLA 1JV3A 1R7UA 5CQNX 3Q4SA 1MP4A 3T7NA 2Y4JA 1JVGA 3EE5A 1H5TA 3U0YA 2AECA 1HJLA 1MP5A 4BQHA 2VSHA 1NQIB 3U2VA 4FRMA 3I0GA 2Z86A 2XWNA 1VGZA 3POLA 5C36A 2VXMA 3Q80A 3CKVA 1FGGA 4IRQA 3I0DA 4JISA 5C47A 1QGSA 2RJ0A 2ZU9A 2W0VA 4CJCA 3OH0A 2JCOA 4XWIA 1JVDA 4Y7UA 4M2BA 1QG8A 3BCVA 1W55A 5C8RA 4HO3A 4AAWA 2ICYA 2WAWA 1H4CA 2Y4LA 3LW6A 1XHBA 1R82A 2WEEA 1VZTA 2WGZA 2VD4A 3U2TA 5C49A 2Z87A 1HM8A 3SXBA 4EE4A 2FYCB 1GQ9A 5C4BA 5FU0A 5C4FA 3DK5A 4G3SA 4HO6A 2QH5A 4Y7FA 4E1KA 5CQOA 2OI5A 4EEGA 4L41C 5C1HA 1H5SC 2P72A 3O3PA 2V0HA 3BRKX 5C4EA 2YC5A 2X5ZA 2PGYA 1TW1A 2X65A 2YQCA 3IOJA 4HO9A 1KWSA 1VPAA 3SXAA 2I7BA 1YROB 1ZI4A 5IFYA 1Z90A 1ZDFA 1S4OA 3USQA 2UX8A 3OKRA 2VS5A 2XMEA 4KQLA 2MZBA 3SX3A 1IIMA 5FYEA 1K4VA 4EE3A 1FR8A 2AM3A 2VS4A 3SX7A 1W57A 4HO5A 2VFZA 2AM4A 4M28A 3SXGA 4HCQA 1ZJ2A 1V84A 1TVYA 4NAKA 3T7MA 4G3PA 3V0OA 3JUJA 4CJBA 1FXOA 1YP2A 2PA4A 3ZF8A 3CKOA 2E8BA 2E3DA 1WSZA 5C3BA 4C2SA 2X60A 4FRHA 1G97A 2VS3A 2CU2A 3FWWA 1G1LA 5L6VA 3JUKA 3RSBA 3I0FA 4D0TA 1GQCA 2D0JA 2DPWA 1GWVA 2X5SA 4KPZA 3SPTA 3CKJA 4ECMA 2WVKA 4FRPA 4FRAA 2FFVA 2FYDB 4HO8A 4KNRA 4KT7A 3DJ4A 3U0XA 2AE7A 4B2WA 4G87A 4B5BA 1ZI1A 4Y7TA 2Q4JA 1FZWA
chains in the Genus database with same CATH superfamily
1VH1A 1EZIA 1H7QA 1ZCYA 1G3LA 3R2WA 4P00A 4MIXA 3D98A 4FRBA 4Y6NA 1VGTA 4AYJA 5L6SA 1HM0A 3TZTA 1NMMB 1ON6A 4D11A 4FRLA 2FFUA 2BO8A 3SXEA 3V8ZA 1YP3A 3F1CA 1MP3A 1LVWA 2V0KA 1FR9A 2OI6A 5FTSA 5DDVA 1H7HA 3V0LA 1H7LA 4HG6A 2V0IA 4FIYA 2NXVA 3SX5A 1LZ0A 3SXCA 3SXDA 3CU0A 1LL2A 2Y4MA 3OH4A 3RMVA 1INIA 1H5SB 1ZDGA 1NKHB 2GGOA 1VM8A 4Y7VA 2PX7A 2OI7A 4DECA 3U2WA 2JCLA 2JCJA 2RITA 4UEGA 3I0HA 5JQQA 3U2XA 1R80A 4K6RA 5CMJA 4EVWA 4J18A 4FRQA 2AGDA 4KRVA 1HJJA 2BO4A 4KPXA 1ZI3A 2A8UA 1WT1A 1ZI5A 2GGQA 4CVHA 1VICA 1PZTA 1ZIZA 1W77A 1H3MA 3IOHA 2RJ4A 1LL0A 2RIZA 4M2AA 4R7PA 4O6MA 1O7OA 1ZCUA 1ZHJA 2AESA 4Y6UA 2J0AA 4HO4A 4HOCA 3KIAA 2RJ6A 1FXJA 4ARWA 1O0RA 1GA8A 3CGXA 5CQMX 3V90A 4B2XA 5C48A 5AJOA 1GWWA 1JYLA 4GBPA 2O1GA 2W0WA 4Y64A 2WVMA 4B3UA 1JYKA 3F1YA 2D7IA 4EEAA 1S4PA 5CQPA 1E5KA 2Y4KA 4DE7A 3E26A 1H7FA 1G95A 4KNXA 2V0JA 5CMIA 2PGVA 4FCUA 4EEOA 1OMZA 4Y7GA 1FWYA 1EYRA 1V82A 3IOIA 1WT2A 5FV9A 3OC9A 3V0NA 5EIYA 2YQJA 4BMAA 1R7TA 5CMGX 1HM9A 4EEMA 1ZCTA 2A8WA 3I0KA 3GUEA 4ASJA 4B4GA 4IRPA 3HL3A 3I0IX 1ZJ3A 4ASYA 2AH9A 5C1GA 5J49A 4AC3A 1H5TB 4Y9XA 3T7OA 1H7EA 4NALA 4D48A 2BO7A 5FTVA 1NF5B 5AJPA 2QGIA 4NANA 1HV9A 5EJZA 1VZXA 4AYLA 3USRA 1TZFA 1R7VA 2RIYA 4FRDA 1H5RB 3NGWA 5FUHA 2I5EA 5C4CA 5IDSA 2VSIA 4CJ8A 1FG5N 2J0BA 3I0JA 3SX8A 4Y63A 2YQHA 1R81A 2FY7A 3OGZA 5IDTA 5CQLX 1O23B 4YS8A 1ZJ1A 2YQSA 5FU8A 2O1HA 1PZYB 2RJ1A 1GX4A 4KXOA 4EE5A 2D7RA 3OH1A 4FREA 1OQMB 4B4MA 4D11C 2OEGA 2ZU7A 1H5RA 3QVBA 3V0MA 1G23A 1YP4A 4HO2A 1NHEB 4KC1A 2I5KA 3PKPA 1ZJ0A 3E25A 4P02A 1QGQA 1VH3A 1R7YA 1IINA 4B42A 2YESA 1G9RA 1G2VA 3PKQA 1FO9A 3N9WA 3V0QA 4FCEA 3DUVA 2FYBA 1VGUA 3ZLLA 1VZUA 2V0LA 1R7XA 1NWGB 3D5NA 1ZJPA 2Y7AA 1SS9A 3V8YA 1H5SA 5C3DA 3JTJA 1INJA 2VK9A 1WT3A 3U2UA 2ICXA 3CKQA 1GX0A 3I0EA 3I0LA 4M4KA 5BXCA 4KC2A 2WE9A 4FQWA 3OH3A 4D0ZA 4MNDA 1G93A 4MYBA 2P6WA 3V0PA 4LW3A 1ON8A 3OAMA 1LZ7A 1WVCA 2AM5A 4FIXA 2XWMA 5CMHA 2C0NA 1FRWA 2RJ9A 3CKNA 5HS2A 1ZCVA 3ZGGA 4JD0A 1MC3A 1I52A 1JV1A 2QKXA 1H7TA 3V91A 1G0RA 5C4DA 1FO8A 4B4BA 3K8DA 1LL3A 3FOQA 1TW5A 5D91A 4KC4A 3D8VA 1G8OA 2BO6A 3ZLKA 2P73A 5EJ1A 3R3IA 4LW6A 2JCKA 2FYAA 3ZGFA 4HO0A 1OMXA 2O1FA 1XZ6A 4G3QA 1H5SD 1WT0A 3K8EA 5C38A 4NAIA 5AJNA 5CMFX 2ZU8A 1VGWA 1O7QA 2Y6PA 3TQDA 3PNNA 2VXLA 3I0CA 5DDTA 1ZJOA 2YC3A 4FROA 2XWLA 1H4EA 1LZIA 1QWJA 2APCA 1H7GA 1S4NA 1FOAA 3OH2A 2YCMA 3ST8A 1LZJA 5C3AA 2RJ7A 3Q7UA 5C1LA 2RIXA 2OEFA 2RJ8A 2XMHA 4ZDQA 4DDZA 4Y62A 1H4DA 3RMWA 5I1FA 1FGXA 2RJ5A 1V83A 2WVLA 1JV3A 1R7UA 5CQNX 3Q4SA 1MP4A 3T7NA 2Y4JA 1JVGA 3EE5A 1H5TA 3U0YA 2AECA 1HJLA 1MP5A 4BQHA 2VSHA 1NQIB 3U2VA 4FRMA 3I0GA 2Z86A 2XWNA 1VGZA 3POLA 5C36A 2VXMA 3Q80A 3CKVA 1FGGA 4IRQA 3I0DA 4JISA 5C47A 1QGSA 2RJ0A 2ZU9A 2W0VA 4CJCA 3OH0A 2JCOA 4XWIA 1JVDA 4Y7UA 4M2BA 1QG8A 3BCVA 1W55A 5C8RA 4HO3A 4AAWA 2ICYA 2WAWA 1H4CA 2Y4LA 3LW6A 1XHBA 1R82A 2WEEA 1VZTA 2WGZA 2VD4A 3U2TA 5C49A 2Z87A 1HM8A 3SXBA 4EE4A 2FYCB 1GQ9A 5C4BA 5FU0A 4Q7CA 5C4FA 3DK5A 4G3SA 4HO6A 2QH5A 4Y7FA 4E1KA 5CQOA 2OI5A 4EEGA 4L41C 5C1HA 1H5SC 2P72A 3O3PA 2V0HA 3BRKX 5C4EA 2YC5A 2X5ZA 2PGYA 1TW1A 2X65A 2YQCA 3IOJA 4HO9A 1KWSA 1VPAA 3SXAA 2I7BA 5D92A 1YROB 1ZI4A 5IFYA 1Z90A 1ZDFA 1S4OA 4O6NA 3USQA 2UX8A 3OKRA 2VS5A 2XMEA 4KQLA 2MZBA 3SX3A 1IIMA 5FYEA 1K4VA 4EE3A 1FR8A 2AM3A 2VS4A 3SX7A 1W57A 4HO5A 2VFZA 2AM4A 4M28A 3SXGA 4HCQA 1ZJ2A 1V84A 1TVYA 4NAKA 3T7MA 4G3PA 3V0OA 3JUJA 4CJBA 1FXOA 1YP2A 2PA4A 3ZF8A 3CKOA 2E8BA 2E3DA 1WSZA 5C3BA 4C2SA 2X60A 4FRHA 1G97A 2VS3A 2CU2A 3FWWA 1G1LA 5L6VA 3JUKA 3RSBA 3I0FA 4D0TA 1GQCA 2D0JA 2DPWA 1GWVA 2X5SA 4KPZA 3SPTA 3CKJA 4ECMA 2WVKA 4FRPA 4FRAA 2FFVA 2FYDB 4HO8A 4KNRA 4KT7A 3DJ4A 3U0XA 2AE7A 4B2WA 4G87A 4B5BA 1ZI1A 4Y7TA 2Q4JA 1FZWA
chains in the Genus database with same CATH topology
1VH1A 1EZIA 1H7QA 1ZCYA 1G3LA 3R2WA 4P00A 4MIXA 3D98A 4FRBA 4Y6NA 1VGTA 4AYJA 5L6SA 1HM0A 3TZTA 1NMMB 1ON6A 4D11A 4FRLA 2FFUA 2BO8A 3SXEA 3V8ZA 1YP3A 3F1CA 1MP3A 1LVWA 2V0KA 1FR9A 2OI6A 5FTSA 5DDVA 1H7HA 3V0LA 1H7LA 4HG6A 2V0IA 4FIYA 2NXVA 3SX5A 1LZ0A 3SXCA 3SXDA 3CU0A 1LL2A 2Y4MA 3OH4A 3RMVA 1INIA 1H5SB 1ZDGA 1NKHB 2GGOA 1VM8A 4Y7VA 2PX7A 2OI7A 4DECA 3U2WA 2JCLA 2JCJA 2RITA 4UEGA 3I0HA 5JQQA 3U2XA 1R80A 4K6RA 5CMJA 4EVWA 4J18A 4FRQA 2AGDA 4KRVA 1HJJA 2BO4A 4KPXA 1ZI3A 2A8UA 1WT1A 1ZI5A 2GGQA 4CVHA 1VICA 1PZTA 1ZIZA 1W77A 1H3MA 3IOHA 2RJ4A 1LL0A 2RIZA 4M2AA 4R7PA 4O6MA 1O7OA 1ZCUA 1ZHJA 2AESA 4Y6UA 2J0AA 4HO4A 4HOCA 3KIAA 2RJ6A 1FXJA 4ARWA 1O0RA 1GA8A 3CGXA 5CQMX 3V90A 4B2XA 5C48A 5AJOA 1GWWA 1JYLA 4GBPA 2O1GA 2W0WA 4Y64A 2WVMA 4B3UA 1JYKA 3F1YA 2D7IA 4EEAA 1S4PA 5CQPA 1E5KA 2Y4KA 4DE7A 3E26A 1H7FA 1G95A 4KNXA 2V0JA 5CMIA 2PGVA 4FCUA 4EEOA 1OMZA 4Y7GA 1FWYA 1EYRA 1V82A 3IOIA 1WT2A 5FV9A 3OC9A 3V0NA 5EIYA 2YQJA 4BMAA 1R7TA 5CMGX 1HM9A 4EEMA 1ZCTA 2A8WA 3I0KA 3GUEA 4ASJA 4B4GA 4IRPA 3HL3A 3I0IX 1ZJ3A 4ASYA 2AH9A 5C1GA 5J49A 4AC3A 1H5TB 4Y9XA 3T7OA 1H7EA 4NALA 4D48A 2BO7A 5FTVA 1NF5B 5AJPA 2QGIA 4NANA 1HV9A 5EJZA 1VZXA 4AYLA 3USRA 1TZFA 1R7VA 2RIYA 4FRDA 1H5RB 3NGWA 5FUHA 2I5EA 5C4CA 5IDSA 2VSIA 4CJ8A 1FG5N 2J0BA 3I0JA 3SX8A 4Y63A 2YQHA 1R81A 2FY7A 3OGZA 5IDTA 5CQLX 1O23B 4YS8A 1ZJ1A 2YQSA 5FU8A 2O1HA 1PZYB 2RJ1A 1GX4A 4KXOA 4EE5A 2D7RA 3OH1A 4FREA 1OQMB 4B4MA 4D11C 2OEGA 2ZU7A 1H5RA 3QVBA 3V0MA 1G23A 1YP4A 4HO2A 1NHEB 4KC1A 2I5KA 3PKPA 1ZJ0A 3E25A 4P02A 1QGQA 1VH3A 1R7YA 1IINA 4B42A 2YESA 1G9RA 1G2VA 3PKQA 1FO9A 3N9WA 3V0QA 4FCEA 3DUVA 2FYBA 1VGUA 3ZLLA 1VZUA 2V0LA 1R7XA 1NWGB 3D5NA 1ZJPA 2Y7AA 1SS9A 3V8YA 1H5SA 5C3DA 3JTJA 1INJA 2VK9A 1WT3A 3U2UA 2ICXA 3CKQA 1GX0A 3I0EA 3I0LA 4M4KA 5BXCA 4KC2A 2WE9A 4FQWA 3OH3A 4D0ZA 4MNDA 1G93A 4MYBA 2P6WA 3V0PA 4LW3A 1ON8A 3OAMA 1LZ7A 1WVCA 2AM5A 4FIXA 2XWMA 5CMHA 2C0NA 1FRWA 2RJ9A 3CKNA 5HS2A 1ZCVA 3ZGGA 4JD0A 1MC3A 1I52A 1JV1A 2QKXA 1H7TA 3V91A 1G0RA 5C4DA 1FO8A 4B4BA 3K8DA 1LL3A 3FOQA 1TW5A 5D91A 4KC4A 3D8VA 1G8OA 2BO6A 3ZLKA 2P73A 5EJ1A 3R3IA 4LW6A 2JCKA 2FYAA 3ZGFA 4HO0A 1OMXA 2O1FA 1XZ6A 4G3QA 1H5SD 1WT0A 3K8EA 5C38A 4NAIA 5AJNA 5CMFX 2ZU8A 1VGWA 1O7QA 2Y6PA 3TQDA 3PNNA 2VXLA 3I0CA 5DDTA 1ZJOA 2YC3A 4FROA 2XWLA 1H4EA 1LZIA 1QWJA 2APCA 1H7GA 1S4NA 1FOAA 3OH2A 2YCMA 3ST8A 1LZJA 5C3AA 2RJ7A 3Q7UA 5C1LA 2RIXA 2OEFA 2RJ8A 2XMHA 4ZDQA 4DDZA 4Y62A 1H4DA 3RMWA 5I1FA 1FGXA 2RJ5A 1V83A 2WVLA 1JV3A 1R7UA 5CQNX 3Q4SA 1MP4A 3T7NA 2Y4JA 1JVGA 3EE5A 1H5TA 3U0YA 2AECA 1HJLA 1MP5A 4BQHA 2VSHA 1NQIB 3U2VA 4FRMA 3I0GA 2Z86A 2XWNA 1VGZA 3POLA 5C36A 2VXMA 3Q80A 3CKVA 1FGGA 4IRQA 3I0DA 4JISA 5C47A 1QGSA 2RJ0A 2ZU9A 2W0VA 4CJCA 3OH0A 2JCOA 4XWIA 1JVDA 4Y7UA 4M2BA 1QG8A 3BCVA 1W55A 5C8RA 4HO3A 4AAWA 2ICYA 2WAWA 1H4CA 2Y4LA 3LW6A 1XHBA 1R82A 2WEEA 1VZTA 2WGZA 2VD4A 3U2TA 5C49A 2Z87A 1HM8A 3SXBA 4EE4A 2FYCB 1GQ9A 5C4BA 5FU0A 4Q7CA 5C4FA 3DK5A 4G3SA 4HO6A 2QH5A 4Y7FA 4E1KA 5CQOA 2OI5A 4EEGA 4L41C 5C1HA 1H5SC 2P72A 3O3PA 2V0HA 3BRKX 5C4EA 2YC5A 2X5ZA 2PGYA 1TW1A 2X65A 2YQCA 3IOJA 4HO9A 1KWSA 1VPAA 3SXAA 2I7BA 5D92A 1YROB 1ZI4A 5IFYA 1Z90A 1ZDFA 1S4OA 4O6NA 3USQA 2UX8A 3OKRA 2VS5A 2XMEA 4KQLA 2MZBA 3SX3A 1IIMA 5FYEA 1K4VA 4EE3A 1FR8A 2AM3A 2VS4A 3SX7A 1W57A 4HO5A 2VFZA 2AM4A 4M28A 3SXGA 4HCQA 1ZJ2A 1V84A 1TVYA 4NAKA 3T7MA 4G3PA 3V0OA 3JUJA 4CJBA 1FXOA 1YP2A 2PA4A 3ZF8A 3CKOA 2E8BA 2E3DA 1WSZA 5C3BA 4C2SA 2X60A 4FRHA 1G97A 2VS3A 2CU2A 3FWWA 1G1LA 5L6VA 3JUKA 3RSBA 3I0FA 4D0TA 1GQCA 2D0JA 2DPWA 1GWVA 2X5SA 4KPZA 3SPTA 3CKJA 4ECMA 2WVKA 4FRPA 4FRAA 2FFVA 2FYDB 4HO8A 4KNRA 4KT7A 3DJ4A 3U0XA 2AE7A 4B2WA 4G87A 4B5BA 1ZI1A 4Y7TA 2Q4JA 1FZWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VH1 A;  1EZI A;  1H7Q A;  1ZCY A;  1G3L A;  3R2W A;  4P00 A;  3D98 A;  4FRB A;  4Y6N A;  1VGT A;  4AYJ A;  5L6S A;  1HM0 A;  3TZT A;  1NMM B;  1ON6 A;  4D11 A;  4FRL A;  2FFU A;  2BO8 A;  3SXE A;  3V8Z A;  1YP3 A;  3F1C A;  1MP3 A;  1LVW A;  2V0K A;  1FR9 A;  2OI6 A;  5FTS A;  5DDV A;  1H7H A;  3V0L A;  1H7L A;  4HG6 A;  2V0I A;  2NXV A;  3SX5 A;  1LZ0 A;  3SXC A;  3SXD A;  3CU0 A;  1LL2 A;  2Y4M A;  3OH4 A;  3RMV A;  1INI A;  1H5S B;  1ZDG A;  1NKH B;  2GGO A;  1VM8 A;  4Y7V A;  2PX7 A;  2OI7 A;  4DEC A;  3U2W A;  2JCL A;  2JCJ A;  2RIT A;  4UEG A;  3I0H A;  5JQQ A;  3U2X A;  1R80 A;  4K6R A;  5CMJ A;  4EVW A;  4J18 A;  4FRQ A;  2AGD A;  4KRV A;  1HJJ A;  2BO4 A;  4KPX A;  1ZI3 A;  2A8U A;  1WT1 A;  1ZI5 A;  2GGQ A;  4CVH A;  1VIC A;  1PZT A;  1ZIZ A;  1W77 A;  1H3M A;  3IOH A;  2RJ4 A;  1LL0 A;  2RIZ A;  4M2A A;  4R7P A;  1O7O A;  1ZCU A;  1ZHJ A;  2AES A;  4Y6U A;  4HO4 A;  4HOC A;  3KIA A;  2RJ6 A;  1FXJ A;  4ARW A;  1O0R A;  1GA8 A;  3CGX A;  5CQM X;  3V90 A;  4B2X A;  5C48 A;  5AJO A;  1GWW A;  1JYL A;  4GBP A;  2O1G A;  2W0W A;  4Y64 A;  2WVM A;  4B3U A;  1JYK A;  3F1Y A;  2D7I A;  4EEA A;  1S4P A;  5CQP A;  1E5K A;  2Y4K A;  4DE7 A;  3E26 A;  1H7F A;  1G95 A;  4KNX A;  2V0J A;  5CMI A;  2PGV A;  4FCU A;  4EEO A;  1OMZ A;  4Y7G A;  1FWY A;  1EYR A;  1V82 A;  3IOI A;  1WT2 A;  5FV9 A;  3OC9 A;  3V0N A;  5EIY A;  2YQJ A;  4BMA A;  1R7T A;  5CMG X;  1HM9 A;  4EEM A;  1ZCT A;  2A8W A;  3I0K A;  3GUE A;  4ASJ A;  4B4G A;  4IRP A;  3HL3 A;  3I0I X;  1ZJ3 A;  4ASY A;  2AH9 A;  5C1G A;  5J49 A;  4AC3 A;  1H5T B;  4Y9X A;  3T7O A;  1H7E A;  4NAL A;  4D48 A;  2BO7 A;  5FTV A;  1NF5 B;  5AJP A;  2QGI A;  4NAN A;  1HV9 A;  5EJZ A;  1VZX A;  4AYL A;  3USR A;  1TZF A;  1R7V A;  2RIY A;  4FRD A;  1H5R B;  3NGW A;  5FUH A;  2I5E A;  5C4C A;  5IDS A;  2VSI A;  4CJ8 A;  1FG5 N;  3I0J A;  3SX8 A;  4Y63 A;  2YQH A;  1R81 A;  2FY7 A;  3OGZ A;  5IDT A;  5CQL X;  1O23 B;  4YS8 A;  1ZJ1 A;  2YQS A;  5FU8 A;  2O1H A;  1PZY B;  2RJ1 A;  1GX4 A;  4KXO A;  4EE5 A;  2D7R A;  3OH1 A;  4FRE A;  1OQM B;  4B4M A;  4D11 C;  2OEG A;  2ZU7 A;  1H5R A;  3QVB A;  3V0M A;  1G23 A;  1YP4 A;  4HO2 A;  1NHE B;  4KC1 A;  2I5K A;  3PKP A;  1ZJ0 A;  3E25 A;  4P02 A;  1QGQ A;  1VH3 A;  1R7Y A;  1IIN A;  4B42 A;  2YES A;  1G9R A;  1G2V A;  3PKQ A;  1FO9 A;  3N9W A;  3V0Q A;  4FCE A;  3DUV A;  2FYB A;  1VGU A;  3ZLL A;  1VZU A;  2V0L A;  1R7X A;  1NWG B;  3D5N A;  1ZJP A;  2Y7A A;  1SS9 A;  3V8Y A;  1H5S A;  5C3D A;  3JTJ A;  1INJ A;  1WT3 A;  3U2U A;  2ICX A;  3CKQ A;  1GX0 A;  3I0E A;  3I0L A;  4M4K A;  5BXC A;  4KC2 A;  2WE9 A;  4FQW A;  3OH3 A;  4D0Z A;  4MND A;  1G93 A;  4MYB A;  2P6W A;  3V0P A;  4LW3 A;  1ON8 A;  3OAM A;  1LZ7 A;  1WVC A;  2AM5 A;  2XWM A;  5CMH A;  1FRW A;  2RJ9 A;  3CKN A;  5HS2 A;  1ZCV A;  3ZGG A;  4JD0 A;  1MC3 A;  1I52 A;  1JV1 A;  2QKX A;  1H7T A;  3V91 A;  1G0R A;  5C4D A;  1FO8 A;  4B4B A;  3K8D A;  1LL3 A;  3FOQ A;  1TW5 A;  4KC4 A;  3D8V A;  1G8O A;  2BO6 A;  3ZLK A;  2P73 A;  5EJ1 A;  3R3I A;  4LW6 A;  2JCK A;  2FYA A;  3ZGF A;  4HO0 A;  1OMX A;  2O1F A;  1XZ6 A;  4G3Q A;  1H5S D;  1WT0 A;  3K8E A;  5C38 A;  4NAI A;  5AJN A;  5CMF X;  2ZU8 A;  1VGW A;  1O7Q A;  2Y6P A;  3TQD A;  3PNN A;  2VXL A;  3I0C A;  5DDT A;  1ZJO A;  2YC3 A;  4FRO A;  2XWL A;  1H4E A;  1LZI A;  1QWJ A;  2APC A;  1H7G A;  1S4N A;  1FOA A;  3OH2 A;  2YCM A;  3ST8 A;  1LZJ A;  5C3A A;  2RJ7 A;  3Q7U A;  5C1L A;  2RIX A;  2OEF A;  2RJ8 A;  2XMH A;  4ZDQ A;  4DDZ A;  4Y62 A;  1H4D A;  3RMW A;  5I1F A;  1FGX A;  2RJ5 A;  1V83 A;  2WVL A;  1JV3 A;  1R7U A;  5CQN X;  3Q4S A;  1MP4 A;  3T7N A;  2Y4J A;  1JVG A;  3EE5 A;  1H5T A;  3U0Y A;  2AEC A;  1HJL A;  1MP5 A;  4BQH A;  2VSH A;  1NQI B;  3U2V A;  4FRM A;  3I0G A;  2Z86 A;  2XWN A;  1VGZ A;  3POL A;  5C36 A;  2VXM A;  3Q80 A;  3CKV A;  1FGG A;  4IRQ A;  3I0D A;  4JIS A;  5C47 A;  1QGS A;  2RJ0 A;  2ZU9 A;  2W0V A;  4CJC A;  3OH0 A;  2JCO A;  4XWI A;  1JVD A;  4Y7U A;  4M2B A;  1QG8 A;  3BCV A;  1W55 A;  5C8R A;  4HO3 A;  4AAW A;  2ICY A;  2WAW A;  1H4C A;  2Y4L A;  3LW6 A;  1XHB A;  1R82 A;  2WEE A;  1VZT A;  2WGZ A;  2VD4 A;  3U2T A;  5C49 A;  2Z87 A;  1HM8 A;  3SXB A;  4EE4 A;  2FYC B;  1GQ9 A;  5C4B A;  5FU0 A;  5C4F A;  3DK5 A;  4G3S A;  4HO6 A;  2QH5 A;  4Y7F A;  4E1K A;  5CQO A;  2OI5 A;  4EEG A;  4L41 C;  5C1H A;  1H5S C;  2P72 A;  3O3P A;  2V0H A;  3BRK X;  5C4E A;  2YC5 A;  2X5Z A;  2PGY A;  1TW1 A;  2X65 A;  2YQC A;  3IOJ A;  4HO9 A;  1KWS A;  1VPA A;  3SXA A;  2I7B A;  1YRO B;  1ZI4 A;  5IFY A;  1Z90 A;  1ZDF A;  1S4O A;  3USQ A;  2UX8 A;  3OKR A;  2VS5 A;  2XME A;  4KQL A;  2MZB A;  3SX3 A;  1IIM A;  5FYE A;  1K4V A;  4EE3 A;  1FR8 A;  2AM3 A;  2VS4 A;  3SX7 A;  1W57 A;  4HO5 A;  2VFZ A;  2AM4 A;  4M28 A;  3SXG A;  4HCQ A;  1ZJ2 A;  1V84 A;  1TVY A;  4NAK A;  3T7M A;  4G3P A;  3V0O A;  3JUJ A;  4CJB A;  1FXO A;  1YP2 A;  2PA4 A;  3ZF8 A;  3CKO A;  2E8B A;  2E3D A;  1WSZ A;  5C3B A;  4C2S A;  2X60 A;  4FRH A;  1G97 A;  2VS3 A;  2CU2 A;  3FWW A;  1G1L A;  5L6V A;  3JUK A;  3RSB A;  3I0F A;  4D0T A;  1GQC A;  2D0J A;  2DPW A;  1GWV A;  2X5S A;  4KPZ A;  3SPT A;  3CKJ A;  4ECM A;  2WVK A;  4FRP A;  4FRA A;  2FFV A;  2FYD B;  4HO8 A;  4KNR A;  4KT7 A;  3DJ4 A;  3U0X A;  2AE7 A;  4B2W A;  4G87 A;  4B5B A;  1ZI1 A;  4Y7T A;  2Q4J A;  1FZW A; 
#chains in the Genus database with same CATH topology
 1VH1 A;  1EZI A;  1H7Q A;  1ZCY A;  1G3L A;  3R2W A;  4P00 A;  4MIX A;  3D98 A;  4FRB A;  4Y6N A;  1VGT A;  4AYJ A;  5L6S A;  1HM0 A;  3TZT A;  1NMM B;  1ON6 A;  4D11 A;  4FRL A;  2FFU A;  2BO8 A;  3SXE A;  3V8Z A;  1YP3 A;  3F1C A;  1MP3 A;  1LVW A;  2V0K A;  1FR9 A;  2OI6 A;  5FTS A;  5DDV A;  1H7H A;  3V0L A;  1H7L A;  4HG6 A;  2V0I A;  4FIY A;  2NXV A;  3SX5 A;  1LZ0 A;  3SXC A;  3SXD A;  3CU0 A;  1LL2 A;  2Y4M A;  3OH4 A;  3RMV A;  1INI A;  1H5S B;  1ZDG A;  1NKH B;  2GGO A;  1VM8 A;  4Y7V A;  2PX7 A;  2OI7 A;  4DEC A;  3U2W A;  2JCL A;  2JCJ A;  2RIT A;  4UEG A;  3I0H A;  5JQQ A;  3U2X A;  1R80 A;  4K6R A;  5CMJ A;  4EVW A;  4J18 A;  4FRQ A;  2AGD A;  4KRV A;  1HJJ A;  2BO4 A;  4KPX A;  1ZI3 A;  2A8U A;  1WT1 A;  1ZI5 A;  2GGQ A;  4CVH A;  1VIC A;  1PZT A;  1ZIZ A;  1W77 A;  1H3M A;  3IOH A;  2RJ4 A;  1LL0 A;  2RIZ A;  4M2A A;  4R7P A;  4O6M A;  1O7O A;  1ZCU A;  1ZHJ A;  2AES A;  4Y6U A;  2J0A A;  4HO4 A;  4HOC A;  3KIA A;  2RJ6 A;  1FXJ A;  4ARW A;  1O0R A;  1GA8 A;  3CGX A;  5CQM X;  3V90 A;  4B2X A;  5C48 A;  5AJO A;  1GWW A;  1JYL A;  4GBP A;  2O1G A;  2W0W A;  4Y64 A;  2WVM A;  4B3U A;  1JYK A;  3F1Y A;  2D7I A;  4EEA A;  1S4P A;  5CQP A;  1E5K A;  2Y4K A;  4DE7 A;  3E26 A;  1H7F A;  1G95 A;  4KNX A;  2V0J A;  5CMI A;  2PGV A;  4FCU A;  4EEO A;  1OMZ A;  4Y7G A;  1FWY A;  1EYR A;  1V82 A;  3IOI A;  1WT2 A;  5FV9 A;  3OC9 A;  3V0N A;  5EIY A;  2YQJ A;  4BMA A;  1R7T A;  5CMG X;  1HM9 A;  4EEM A;  1ZCT A;  2A8W A;  3I0K A;  3GUE A;  4ASJ A;  4B4G A;  4IRP A;  3HL3 A;  3I0I X;  1ZJ3 A;  4ASY A;  2AH9 A;  5C1G A;  5J49 A;  4AC3 A;  1H5T B;  4Y9X A;  3T7O A;  1H7E A;  4NAL A;  4D48 A;  2BO7 A;  5FTV A;  1NF5 B;  5AJP A;  2QGI A;  4NAN A;  1HV9 A;  5EJZ A;  1VZX A;  4AYL A;  3USR A;  1TZF A;  1R7V A;  2RIY A;  4FRD A;  1H5R B;  3NGW A;  5FUH A;  2I5E A;  5C4C A;  5IDS A;  2VSI A;  4CJ8 A;  1FG5 N;  2J0B A;  3I0J A;  3SX8 A;  4Y63 A;  2YQH A;  1R81 A;  2FY7 A;  3OGZ A;  5IDT A;  5CQL X;  1O23 B;  4YS8 A;  1ZJ1 A;  2YQS A;  5FU8 A;  2O1H A;  1PZY B;  2RJ1 A;  1GX4 A;  4KXO A;  4EE5 A;  2D7R A;  3OH1 A;  4FRE A;  1OQM B;  4B4M A;  4D11 C;  2OEG A;  2ZU7 A;  1H5R A;  3QVB A;  3V0M A;  1G23 A;  1YP4 A;  4HO2 A;  1NHE B;  4KC1 A;  2I5K A;  3PKP A;  1ZJ0 A;  3E25 A;  4P02 A;  1QGQ A;  1VH3 A;  1R7Y A;  1IIN A;  4B42 A;  2YES A;  1G9R A;  1G2V A;  3PKQ A;  1FO9 A;  3N9W A;  3V0Q A;  4FCE A;  3DUV A;  2FYB A;  1VGU A;  3ZLL A;  1VZU A;  2V0L A;  1R7X A;  1NWG B;  3D5N A;  1ZJP A;  2Y7A A;  1SS9 A;  3V8Y A;  1H5S A;  5C3D A;  3JTJ A;  1INJ A;  2VK9 A;  1WT3 A;  3U2U A;  2ICX A;  3CKQ A;  1GX0 A;  3I0E A;  3I0L A;  4M4K A;  5BXC A;  4KC2 A;  2WE9 A;  4FQW A;  3OH3 A;  4D0Z A;  4MND A;  1G93 A;  4MYB A;  2P6W A;  3V0P A;  4LW3 A;  1ON8 A;  3OAM A;  1LZ7 A;  1WVC A;  2AM5 A;  4FIX A;  2XWM A;  5CMH A;  2C0N A;  1FRW A;  2RJ9 A;  3CKN A;  5HS2 A;  1ZCV A;  3ZGG A;  4JD0 A;  1MC3 A;  1I52 A;  1JV1 A;  2QKX A;  1H7T A;  3V91 A;  1G0R A;  5C4D A;  1FO8 A;  4B4B A;  3K8D A;  1LL3 A;  3FOQ A;  1TW5 A;  5D91 A;  4KC4 A;  3D8V A;  1G8O A;  2BO6 A;  3ZLK A;  2P73 A;  5EJ1 A;  3R3I A;  4LW6 A;  2JCK A;  2FYA A;  3ZGF A;  4HO0 A;  1OMX A;  2O1F A;  1XZ6 A;  4G3Q A;  1H5S D;  1WT0 A;  3K8E A;  5C38 A;  4NAI A;  5AJN A;  5CMF X;  2ZU8 A;  1VGW A;  1O7Q A;  2Y6P A;  3TQD A;  3PNN A;  2VXL A;  3I0C A;  5DDT A;  1ZJO A;  2YC3 A;  4FRO A;  2XWL A;  1H4E A;  1LZI A;  1QWJ A;  2APC A;  1H7G A;  1S4N A;  1FOA A;  3OH2 A;  2YCM A;  3ST8 A;  1LZJ A;  5C3A A;  2RJ7 A;  3Q7U A;  5C1L A;  2RIX A;  2OEF A;  2RJ8 A;  2XMH A;  4ZDQ A;  4DDZ A;  4Y62 A;  1H4D A;  3RMW A;  5I1F A;  1FGX A;  2RJ5 A;  1V83 A;  2WVL A;  1JV3 A;  1R7U A;  5CQN X;  3Q4S A;  1MP4 A;  3T7N A;  2Y4J A;  1JVG A;  3EE5 A;  1H5T A;  3U0Y A;  2AEC A;  1HJL A;  1MP5 A;  4BQH A;  2VSH A;  1NQI B;  3U2V A;  4FRM A;  3I0G A;  2Z86 A;  2XWN A;  1VGZ A;  3POL A;  5C36 A;  2VXM A;  3Q80 A;  3CKV A;  1FGG A;  4IRQ A;  3I0D A;  4JIS A;  5C47 A;  1QGS A;  2RJ0 A;  2ZU9 A;  2W0V A;  4CJC A;  3OH0 A;  2JCO A;  4XWI A;  1JVD A;  4Y7U A;  4M2B A;  1QG8 A;  3BCV A;  1W55 A;  5C8R A;  4HO3 A;  4AAW A;  2ICY A;  2WAW A;  1H4C A;  2Y4L A;  3LW6 A;  1XHB A;  1R82 A;  2WEE A;  1VZT A;  2WGZ A;  2VD4 A;  3U2T A;  5C49 A;  2Z87 A;  1HM8 A;  3SXB A;  4EE4 A;  2FYC B;  1GQ9 A;  5C4B A;  5FU0 A;  4Q7C A;  5C4F A;  3DK5 A;  4G3S A;  4HO6 A;  2QH5 A;  4Y7F A;  4E1K A;  5CQO A;  2OI5 A;  4EEG A;  4L41 C;  5C1H A;  1H5S C;  2P72 A;  3O3P A;  2V0H A;  3BRK X;  5C4E A;  2YC5 A;  2X5Z A;  2PGY A;  1TW1 A;  2X65 A;  2YQC A;  3IOJ A;  4HO9 A;  1KWS A;  1VPA A;  3SXA A;  2I7B A;  5D92 A;  1YRO B;  1ZI4 A;  5IFY A;  1Z90 A;  1ZDF A;  1S4O A;  4O6N A;  3USQ A;  2UX8 A;  3OKR A;  2VS5 A;  2XME A;  4KQL A;  2MZB A;  3SX3 A;  1IIM A;  5FYE A;  1K4V A;  4EE3 A;  1FR8 A;  2AM3 A;  2VS4 A;  3SX7 A;  1W57 A;  4HO5 A;  2VFZ A;  2AM4 A;  4M28 A;  3SXG A;  4HCQ A;  1ZJ2 A;  1V84 A;  1TVY A;  4NAK A;  3T7M A;  4G3P A;  3V0O A;  3JUJ A;  4CJB A;  1FXO A;  1YP2 A;  2PA4 A;  3ZF8 A;  3CKO A;  2E8B A;  2E3D A;  1WSZ A;  5C3B A;  4C2S A;  2X60 A;  4FRH A;  1G97 A;  2VS3 A;  2CU2 A;  3FWW A;  1G1L A;  5L6V A;  3JUK A;  3RSB A;  3I0F A;  4D0T A;  1GQC A;  2D0J A;  2DPW A;  1GWV A;  2X5S A;  4KPZ A;  3SPT A;  3CKJ A;  4ECM A;  2WVK A;  4FRP A;  4FRA A;  2FFV A;  2FYD B;  4HO8 A;  4KNR A;  4KT7 A;  3DJ4 A;  3U0X A;  2AE7 A;  4B2W A;  4G87 A;  4B5B A;  1ZI1 A;  4Y7T A;  2Q4J A;  1FZW A; 
#chains in the Genus database with same CATH homology
 1VH1 A;  1EZI A;  1H7Q A;  1ZCY A;  1G3L A;  3R2W A;  4P00 A;  4MIX A;  3D98 A;  4FRB A;  4Y6N A;  1VGT A;  4AYJ A;  5L6S A;  1HM0 A;  3TZT A;  1NMM B;  1ON6 A;  4D11 A;  4FRL A;  2FFU A;  2BO8 A;  3SXE A;  3V8Z A;  1YP3 A;  3F1C A;  1MP3 A;  1LVW A;  2V0K A;  1FR9 A;  2OI6 A;  5FTS A;  5DDV A;  1H7H A;  3V0L A;  1H7L A;  4HG6 A;  2V0I A;  4FIY A;  2NXV A;  3SX5 A;  1LZ0 A;  3SXC A;  3SXD A;  3CU0 A;  1LL2 A;  2Y4M A;  3OH4 A;  3RMV A;  1INI A;  1H5S B;  1ZDG A;  1NKH B;  2GGO A;  1VM8 A;  4Y7V A;  2PX7 A;  2OI7 A;  4DEC A;  3U2W A;  2JCL A;  2JCJ A;  2RIT A;  4UEG A;  3I0H A;  5JQQ A;  3U2X A;  1R80 A;  4K6R A;  5CMJ A;  4EVW A;  4J18 A;  4FRQ A;  2AGD A;  4KRV A;  1HJJ A;  2BO4 A;  4KPX A;  1ZI3 A;  2A8U A;  1WT1 A;  1ZI5 A;  2GGQ A;  4CVH A;  1VIC A;  1PZT A;  1ZIZ A;  1W77 A;  1H3M A;  3IOH A;  2RJ4 A;  1LL0 A;  2RIZ A;  4M2A A;  4R7P A;  4O6M A;  1O7O A;  1ZCU A;  1ZHJ A;  2AES A;  4Y6U A;  2J0A A;  4HO4 A;  4HOC A;  3KIA A;  2RJ6 A;  1FXJ A;  4ARW A;  1O0R A;  1GA8 A;  3CGX A;  5CQM X;  3V90 A;  4B2X A;  5C48 A;  5AJO A;  1GWW A;  1JYL A;  4GBP A;  2O1G A;  2W0W A;  4Y64 A;  2WVM A;  4B3U A;  1JYK A;  3F1Y A;  2D7I A;  4EEA A;  1S4P A;  5CQP A;  1E5K A;  2Y4K A;  4DE7 A;  3E26 A;  1H7F A;  1G95 A;  4KNX A;  2V0J A;  5CMI A;  2PGV A;  4FCU A;  4EEO A;  1OMZ A;  4Y7G A;  1FWY A;  1EYR A;  1V82 A;  3IOI A;  1WT2 A;  5FV9 A;  3OC9 A;  3V0N A;  5EIY A;  2YQJ A;  4BMA A;  1R7T A;  5CMG X;  1HM9 A;  4EEM A;  1ZCT A;  2A8W A;  3I0K A;  3GUE A;  4ASJ A;  4B4G A;  4IRP A;  3HL3 A;  3I0I X;  1ZJ3 A;  4ASY A;  2AH9 A;  5C1G A;  5J49 A;  4AC3 A;  1H5T B;  4Y9X A;  3T7O A;  1H7E A;  4NAL A;  4D48 A;  2BO7 A;  5FTV A;  1NF5 B;  5AJP A;  2QGI A;  4NAN A;  1HV9 A;  5EJZ A;  1VZX A;  4AYL A;  3USR A;  1TZF A;  1R7V A;  2RIY A;  4FRD A;  1H5R B;  3NGW A;  5FUH A;  2I5E A;  5C4C A;  5IDS A;  2VSI A;  4CJ8 A;  1FG5 N;  2J0B A;  3I0J A;  3SX8 A;  4Y63 A;  2YQH A;  1R81 A;  2FY7 A;  3OGZ A;  5IDT A;  5CQL X;  1O23 B;  4YS8 A;  1ZJ1 A;  2YQS A;  5FU8 A;  2O1H A;  1PZY B;  2RJ1 A;  1GX4 A;  4KXO A;  4EE5 A;  2D7R A;  3OH1 A;  4FRE A;  1OQM B;  4B4M A;  4D11 C;  2OEG A;  2ZU7 A;  1H5R A;  3QVB A;  3V0M A;  1G23 A;  1YP4 A;  4HO2 A;  1NHE B;  4KC1 A;  2I5K A;  3PKP A;  1ZJ0 A;  3E25 A;  4P02 A;  1QGQ A;  1VH3 A;  1R7Y A;  1IIN A;  4B42 A;  2YES A;  1G9R A;  1G2V A;  3PKQ A;  1FO9 A;  3N9W A;  3V0Q A;  4FCE A;  3DUV A;  2FYB A;  1VGU A;  3ZLL A;  1VZU A;  2V0L A;  1R7X A;  1NWG B;  3D5N A;  1ZJP A;  2Y7A A;  1SS9 A;  3V8Y A;  1H5S A;  5C3D A;  3JTJ A;  1INJ A;  2VK9 A;  1WT3 A;  3U2U A;  2ICX A;  3CKQ A;  1GX0 A;  3I0E A;  3I0L A;  4M4K A;  5BXC A;  4KC2 A;  2WE9 A;  4FQW A;  3OH3 A;  4D0Z A;  4MND A;  1G93 A;  4MYB A;  2P6W A;  3V0P A;  4LW3 A;  1ON8 A;  3OAM A;  1LZ7 A;  1WVC A;  2AM5 A;  4FIX A;  2XWM A;  5CMH A;  2C0N A;  1FRW A;  2RJ9 A;  3CKN A;  5HS2 A;  1ZCV A;  3ZGG A;  4JD0 A;  1MC3 A;  1I52 A;  1JV1 A;  2QKX A;  1H7T A;  3V91 A;  1G0R A;  5C4D A;  1FO8 A;  4B4B A;  3K8D A;  1LL3 A;  3FOQ A;  1TW5 A;  5D91 A;  4KC4 A;  3D8V A;  1G8O A;  2BO6 A;  3ZLK A;  2P73 A;  5EJ1 A;  3R3I A;  4LW6 A;  2JCK A;  2FYA A;  3ZGF A;  4HO0 A;  1OMX A;  2O1F A;  1XZ6 A;  4G3Q A;  1H5S D;  1WT0 A;  3K8E A;  5C38 A;  4NAI A;  5AJN A;  5CMF X;  2ZU8 A;  1VGW A;  1O7Q A;  2Y6P A;  3TQD A;  3PNN A;  2VXL A;  3I0C A;  5DDT A;  1ZJO A;  2YC3 A;  4FRO A;  2XWL A;  1H4E A;  1LZI A;  1QWJ A;  2APC A;  1H7G A;  1S4N A;  1FOA A;  3OH2 A;  2YCM A;  3ST8 A;  1LZJ A;  5C3A A;  2RJ7 A;  3Q7U A;  5C1L A;  2RIX A;  2OEF A;  2RJ8 A;  2XMH A;  4ZDQ A;  4DDZ A;  4Y62 A;  1H4D A;  3RMW A;  5I1F A;  1FGX A;  2RJ5 A;  1V83 A;  2WVL A;  1JV3 A;  1R7U A;  5CQN X;  3Q4S A;  1MP4 A;  3T7N A;  2Y4J A;  1JVG A;  3EE5 A;  1H5T A;  3U0Y A;  2AEC A;  1HJL A;  1MP5 A;  4BQH A;  2VSH A;  1NQI B;  3U2V A;  4FRM A;  3I0G A;  2Z86 A;  2XWN A;  1VGZ A;  3POL A;  5C36 A;  2VXM A;  3Q80 A;  3CKV A;  1FGG A;  4IRQ A;  3I0D A;  4JIS A;  5C47 A;  1QGS A;  2RJ0 A;  2ZU9 A;  2W0V A;  4CJC A;  3OH0 A;  2JCO A;  4XWI A;  1JVD A;  4Y7U A;  4M2B A;  1QG8 A;  3BCV A;  1W55 A;  5C8R A;  4HO3 A;  4AAW A;  2ICY A;  2WAW A;  1H4C A;  2Y4L A;  3LW6 A;  1XHB A;  1R82 A;  2WEE A;  1VZT A;  2WGZ A;  2VD4 A;  3U2T A;  5C49 A;  2Z87 A;  1HM8 A;  3SXB A;  4EE4 A;  2FYC B;  1GQ9 A;  5C4B A;  5FU0 A;  4Q7C A;  5C4F A;  3DK5 A;  4G3S A;  4HO6 A;  2QH5 A;  4Y7F A;  4E1K A;  5CQO A;  2OI5 A;  4EEG A;  4L41 C;  5C1H A;  1H5S C;  2P72 A;  3O3P A;  2V0H A;  3BRK X;  5C4E A;  2YC5 A;  2X5Z A;  2PGY A;  1TW1 A;  2X65 A;  2YQC A;  3IOJ A;  4HO9 A;  1KWS A;  1VPA A;  3SXA A;  2I7B A;  5D92 A;  1YRO B;  1ZI4 A;  5IFY A;  1Z90 A;  1ZDF A;  1S4O A;  4O6N A;  3USQ A;  2UX8 A;  3OKR A;  2VS5 A;  2XME A;  4KQL A;  2MZB A;  3SX3 A;  1IIM A;  5FYE A;  1K4V A;  4EE3 A;  1FR8 A;  2AM3 A;  2VS4 A;  3SX7 A;  1W57 A;  4HO5 A;  2VFZ A;  2AM4 A;  4M28 A;  3SXG A;  4HCQ A;  1ZJ2 A;  1V84 A;  1TVY A;  4NAK A;  3T7M A;  4G3P A;  3V0O A;  3JUJ A;  4CJB A;  1FXO A;  1YP2 A;  2PA4 A;  3ZF8 A;  3CKO A;  2E8B A;  2E3D A;  1WSZ A;  5C3B A;  4C2S A;  2X60 A;  4FRH A;  1G97 A;  2VS3 A;  2CU2 A;  3FWW A;  1G1L A;  5L6V A;  3JUK A;  3RSB A;  3I0F A;  4D0T A;  1GQC A;  2D0J A;  2DPW A;  1GWV A;  2X5S A;  4KPZ A;  3SPT A;  3CKJ A;  4ECM A;  2WVK A;  4FRP A;  4FRA A;  2FFV A;  2FYD B;  4HO8 A;  4KNR A;  4KT7 A;  3DJ4 A;  3U0X A;  2AE7 A;  4B2W A;  4G87 A;  4B5B A;  1ZI1 A;  4Y7T A;  2Q4J A;  1FZW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...