4KRVA

Crystal structure of catalytic domain of bovine beta1,4-galactosyltransferase mutant m344h-galt1 complex with 6-sulfo-glcnac
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
272
structure length
272
Chain Sequence
LTACPEESPLLVGPMLIEFNIPVDLKLVEQQNPKVKLGGRYTPMDCISPHKVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGESMFNRAKLLNVGFKEALKDYDYNCFVFSDVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLSINGFPNNYWGWGGEDDDIYNRLAFRGMSVSRPNAVIGKTRHIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYMVLEVQRYPLYTKITVDIGTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-1,4-galactosyltransferase 1
publication title Investigations on beta 1,4-galactosyltransferase I using 6-sulfo-GlcNAc as an acceptor sugar substrate.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 93
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.4.1.22: Lactose synthase.
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02709 Glyco_transf_7C N-terminal domain of galactosyltransferase
A PF13733 Glyco_transf_7N N-terminal region of glycosyl transferase group 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4krvA00
3V90A 1LZ7A 2YQJA 2UX8A 4UEGA 4ASJA 2JCKA 4Y7TA 1H5RA 1TW5A 3U2VA 2WVLA 2VXMA 3JTJA 3EE5A 3I0LA 2VXLA 2OI5A 4M4KA 2I7BA 2OEGA 1R7VA 4BQHA 2RJ9A 1VGTA 3I0HA 4ZDQA 4E1KA 1HJLA 2D7RA 2ICYA 1G8OA 3PKQA 4FRMA 1ZCYA 4HO3A 5C4BA 1LZJA 1YP3A 3E26A 5C1HA 5AJPA 4Y9XA 5DDTA 1GWVA 2V0KA 5C4DA 4KPXA 3U2TA 2FFUA 2YC5A 4JD0A 2XMEA 2D7IA 3KIAA 1G95A 2GGQA 3QVBA 1YP2A 3F1CA 5C38A 2PGYA 1ZJPA 1ZDGA 3RMWA 3K8EA 5I1FA 2RIXA 3JUKA 2Y4KA 1ZJ0A 4KXOA 4FROA 4EEGA 2RJ6A 2FFVA 3V0NA 5FV9A 1JVDA 2YQCA 1S4NA 1MP5A 2OI6A 4NAKA 1R80A 3I0EA 3SXGA 1E5KA 1V83A 2ZU9A 2V0LA 3V8YA 2I5KA 4Y64A 1JVGA 1QGQA 4EE5A 3U0XA 2Z86A 1MP3A 2FYAA 4FREA 5C3DA 1XHBA 1PZYB 2VSIA 2RJ4A 4CVHA 1ZCVA 5EJZA 3ZLLA 3HL3A 3CU0A 2XWMA 2Y4MA 3OH2A 1H5RB 1WT1A 2MZBA 1H7FA 2Y7AA 1H4CA 1YROB 1VM8A 1GA8A 1HM8A 2AGDA 2OEFA 3GUEA 2I5EA 1G3LA 2Y6PA 1K4VA 3D98A 1WT2A 3PNNA 2PGVA 1LZ0A 2WEEA 3PKPA 1H3MA 3U0YA 2AM5A 1ZJ3A 3NGWA 4DE7A 4C2SA 2W0VA 2BO7A 1FXOA 1MP4A 4YS8A 1VH3A 5CMIA 3V91A 1S4OA 3I0GA 2WVMA 2AECA 1H5SD 1GX0A 1V84A 1WVCA 2XWLA 3IOIA 5FYEA 1NF5B 5C4EA 3Q80A 1FG5N 4KC2A 1ZJOA 3RSBA 4K6RA 1FWYA 4FRBA 2YQHA 2AH9A 3D8VA 4MNDA 4EE4A 3R2WA 3U2WA 1VZUA 2AE7A 3U2UA 1R82A 2ZU7A 2RJ7A 1ZDFA 1W55A 2VFZA 2OI7A 2ZU8A 4Y6UA 1LL3A 4KC4A 3OH3A 2PX7A 1FR9A 1WT0A 1ZCTA 2WVKA 2NXVA 2GGOA 1JYLA 4KNXA 2RJ1A 4FQWA 2XMHA 4Y6NA 5CQOA 1TVYA 4M2AA 5C1GA 1VGUA 2QKXA 1QG8A 2V0JA 4MYBA 1INIA 1GQ9A 5C4CA 2BO4A 1VH1A 5C48A 2Y4LA 3V0QA 3TZTA 1H7TA 4D0ZA 3LW6A 2FY7A 4FRHA 4JISA 4FCEA 4HO5A 4B2XA 1VPAA 1ZCUA 4KRVA 5JQQA 2CU2A 4AC3A 1IIMA 4R7PA 4IRPA 3SX5A 5C3BA 1KWSA 5AJNA 3CKJA 1O7QA 1S4PA 4D11A 2AESA 1HM9A 4M2BA 4B4BA 1ZI5A 2D0JA 2JCOA 5C49A 3I0CA 4B5BA 1ZI4A 3CKVA 4HO2A 1H7QA 2P72A 3I0DA 1H5TA 1H7EA 1V82A 1EYRA 1O0RA 4P02A 1W77A 4B4MA 5C8RA 1JYKA 5EJ1A 1SS9A 2X5SA 4BMAA 2X5ZA 1NMMB 4HG6A 1G2VA 1G97A 1H7GA 1ZJ1A 4KNRA 1W57A 1NKHB 3OKRA 4ECMA 1YP4A 1HM0A 1H5SC 4FRAA 2YC3A 4HO0A 3CKQA 1VZTA 3Q7UA 3USQA 2VSHA 5CMFX 1R7XA 1NHEB 5L6VA 1INJA 1OMXA 1VGWA 4KQLA 3U2XA 5IDTA 2BO6A 5AJOA 1ON8A 2QGIA 1H7HA 4Y62A 5CQNX 4D11C 1JV1A 3V8ZA 1IINA 2APCA 4D0TA 1WT3A 3BRKX 1FXJA 3V0MA 2Z87A 4D48A 4EEOA 4B42A 3O3PA 5CQMX 2O1HA 2JCJA 1NQIB 1Z90A 2P6WA 1LVWA 2VD4A 4HO9A 4EE3A 3ZF8A 4FRPA 2FYDB 1G1LA 5CMHA 3SXDA 4M28A 4NAIA 4B4GA 2YCMA 3POLA 3SX7A 3ZGFA 1H5TB 3E25A 2ICXA 3OAMA 2RITA 3K8DA 4ASYA 2E3DA 1O23B 3R3IA 1VICA 4L41C 4Y7UA 3T7OA 1FGXA 1I52A 2AM4A 3I0FA 3TQDA 3CKNA 5IFYA 3OH4A 2O1FA 1LZIA 5CMJA 4IRQA 2VS3A 2JCLA 4KC1A 3CKOA 3Q4SA 2A8WA 3FWWA 1H5SA 4HOCA 1H7LA 3JUJA 5DDVA 4LW6A 1R7TA 2YQSA 2X65A 4CJ8A 2VS5A 3OC9A 2Q4JA 1VZXA 4HO4A 5FU8A 3OH0A 5C1LA 1ZHJA 3SX8A 1MC3A 5FTSA 1G93A 2XWNA 1FR8A 3N9WA 3USRA 4B3UA 1NWGB 1R81A 2P73A 4FRQA 2RIZA 4CJBA 1ON6A 1OQMB 5BXCA 4DECA 5CQLX 2WE9A 4EVWA 3SXBA 1G9RA 1WSZA 1QGSA 2BO8A 4G87A 3IOHA 5EIYA 1TW1A 1FGGA 4HO8A 3FOQA 3V0PA 1GX4A 2AM3A 4EEAA 1R7YA 4EEMA 5L6SA 4Y7FA 2V0IA 3ZGGA 5C36A 1R7UA 4CJCA 5C3AA 1O7OA 1G23A 3OH1A 5C47A 1LL0A 4Y7VA 4G3SA 2PA4A 2FYBA 4B2WA 2FYCB 1GWWA 2X60A 5C4FA 4J18A 1GQCA 2E8BA 5J49A 4HO6A 3ZLKA 1ZIZA 1FO8A 3I0KA 1ZI1A 4GBPA 4DDZA 3V0LA 4KPZA 4FRLA 3SPTA 2W0WA 1VGZA 2YESA 1HV9A 1H5SB 3RMVA 3IOJA 3SX3A 3SXAA 3BCVA 4G3PA 1TZFA 1QWJA 4AAWA 1ZI3A 2RJ8A 2O1GA 3DK5A 4Y7GA 2WAWA 2V0HA 3V0OA 5CMGX 2Y4JA 1FOAA 5CQPA 3CGXA 2RJ5A 3I0IX 1EZIA 4XWIA 1XZ6A 5HS2A 4ARWA 3OGZA 4NALA 1FO9A 2WGZA 2VS4A 4NANA 4P00A 2RIYA 4FCUA 1FRWA 1LL2A 4KT7A 5FUHA 3ST8A 4HCQA 2RJ0A 1H4EA 4AYLA 3DUVA 3T7NA 1FZWA 3SXEA 1PZTA 2DPWA 2A8UA 3I0JA 3SXCA 5FU0A 4Y63A 4LW3A 3F1YA 1HJJA 4AYJA 1JV3A 3D5NA 1OMZA 5IDSA 3T7MA 1G0RA 3DJ4A 5FTVA 4FRDA 1H4DA 4G3QA 1ZJ2A 2QH5A
chains in the Genus database with same CATH superfamily
3V90A 1LZ7A 2YQJA 2UX8A 4UEGA 4ASJA 2JCKA 4Y7TA 1H5RA 1TW5A 3U2VA 2WVLA 2VXMA 3JTJA 4O6NA 3EE5A 3I0LA 2VXLA 2OI5A 4M4KA 2I7BA 2OEGA 1R7VA 4BQHA 2RJ9A 1VGTA 3I0HA 4ZDQA 4E1KA 1HJLA 2D7RA 2ICYA 1G8OA 3PKQA 4FRMA 1ZCYA 4HO3A 5C4BA 1LZJA 1YP3A 3E26A 5C1HA 5AJPA 4Y9XA 5DDTA 1GWVA 2V0KA 5C4DA 4KPXA 3U2TA 2FFUA 2YC5A 4JD0A 2XMEA 2D7IA 3KIAA 1G95A 2GGQA 3QVBA 1YP2A 3F1CA 5C38A 2PGYA 1ZJPA 1ZDGA 3RMWA 3K8EA 5I1FA 2RIXA 3JUKA 2Y4KA 1ZJ0A 4KXOA 4FROA 4EEGA 2RJ6A 2FFVA 3V0NA 5FV9A 1JVDA 2YQCA 1S4NA 1MP5A 2OI6A 4NAKA 1R80A 3I0EA 3SXGA 1E5KA 1V83A 2ZU9A 2V0LA 3V8YA 2I5KA 4Y64A 1JVGA 1QGQA 4EE5A 3U0XA 2Z86A 1MP3A 2FYAA 4FREA 5C3DA 1XHBA 1PZYB 2VSIA 2RJ4A 4CVHA 1ZCVA 5EJZA 3ZLLA 3HL3A 3CU0A 2XWMA 2Y4MA 3OH2A 1H5RB 1WT1A 2MZBA 1H7FA 2Y7AA 1H4CA 1YROB 1VM8A 1GA8A 1HM8A 2AGDA 2OEFA 3GUEA 2I5EA 1G3LA 2Y6PA 1K4VA 3D98A 1WT2A 3PNNA 2PGVA 1LZ0A 2WEEA 3PKPA 1H3MA 3U0YA 2AM5A 1ZJ3A 3NGWA 4DE7A 4C2SA 2W0VA 2BO7A 1FXOA 1MP4A 4YS8A 1VH3A 5CMIA 3V91A 1S4OA 3I0GA 2WVMA 2AECA 1H5SD 1GX0A 1V84A 1WVCA 2XWLA 3IOIA 5FYEA 1NF5B 5C4EA 3Q80A 1FG5N 4KC2A 1ZJOA 3RSBA 4K6RA 1FWYA 4FRBA 2YQHA 2AH9A 3D8VA 4MNDA 4EE4A 3R2WA 3U2WA 1VZUA 2AE7A 3U2UA 1R82A 2ZU7A 2RJ7A 1ZDFA 1W55A 2VFZA 2OI7A 2ZU8A 4Y6UA 1LL3A 4KC4A 3OH3A 2PX7A 1FR9A 1WT0A 1ZCTA 2WVKA 2NXVA 2GGOA 1JYLA 4KNXA 2C0NA 2RJ1A 4FQWA 2XMHA 4Y6NA 5CQOA 1TVYA 4M2AA 5C1GA 1VGUA 2QKXA 1QG8A 2V0JA 4MYBA 1INIA 1GQ9A 5C4CA 2BO4A 1VH1A 5C48A 2Y4LA 5D91A 3V0QA 3TZTA 1H7TA 4D0ZA 3LW6A 2FY7A 4FRHA 4JISA 4FCEA 4HO5A 4B2XA 1VPAA 1ZCUA 4KRVA 5JQQA 2CU2A 4AC3A 1IIMA 4R7PA 4IRPA 3SX5A 5C3BA 1KWSA 5AJNA 3CKJA 1O7QA 1S4PA 4D11A 2AESA 1HM9A 4M2BA 4B4BA 1ZI5A 2D0JA 2JCOA 5C49A 3I0CA 4B5BA 1ZI4A 3CKVA 4HO2A 1H7QA 2P72A 3I0DA 1H5TA 1H7EA 1V82A 1EYRA 1O0RA 4P02A 1W77A 4B4MA 5C8RA 1JYKA 5EJ1A 1SS9A 2X5SA 4BMAA 2X5ZA 1NMMB 4HG6A 1G2VA 1G97A 1H7GA 1ZJ1A 4KNRA 1W57A 1NKHB 3OKRA 4ECMA 1YP4A 1HM0A 1H5SC 4FRAA 2YC3A 4HO0A 3CKQA 1VZTA 3Q7UA 3USQA 2VSHA 5CMFX 1R7XA 1NHEB 4Q7CA 5L6VA 1INJA 1OMXA 1VGWA 4KQLA 3U2XA 5IDTA 2BO6A 5AJOA 1ON8A 2QGIA 1H7HA 4Y62A 5CQNX 4D11C 1JV1A 3V8ZA 1IINA 2APCA 4D0TA 1WT3A 3BRKX 1FXJA 3V0MA 2Z87A 4D48A 4EEOA 4B42A 3O3PA 5CQMX 2O1HA 2JCJA 1NQIB 1Z90A 2P6WA 1LVWA 2VD4A 4HO9A 4EE3A 3ZF8A 4FRPA 2FYDB 1G1LA 5CMHA 3SXDA 4M28A 4NAIA 4B4GA 2YCMA 3POLA 3SX7A 3ZGFA 1H5TB 3E25A 2ICXA 3OAMA 2RITA 3K8DA 4ASYA 2E3DA 1O23B 3R3IA 1VICA 4L41C 4Y7UA 3T7OA 1FGXA 1I52A 2AM4A 3I0FA 3TQDA 3CKNA 5IFYA 3OH4A 4MIXA 2O1FA 5D92A 1LZIA 5CMJA 4IRQA 2VS3A 2JCLA 2VK9A 4KC1A 3CKOA 3Q4SA 2A8WA 3FWWA 1H5SA 4HOCA 1H7LA 3JUJA 5DDVA 4LW6A 1R7TA 2YQSA 2X65A 4CJ8A 2VS5A 3OC9A 2Q4JA 1VZXA 4HO4A 5FU8A 3OH0A 5C1LA 1ZHJA 4FIXA 3SX8A 1MC3A 5FTSA 1G93A 2XWNA 1FR8A 3N9WA 3USRA 4B3UA 1NWGB 1R81A 2P73A 4FRQA 2RIZA 4CJBA 1ON6A 1OQMB 5BXCA 4DECA 4FIYA 5CQLX 2WE9A 4EVWA 3SXBA 1G9RA 1WSZA 1QGSA 2BO8A 4G87A 3IOHA 5EIYA 1TW1A 1FGGA 4HO8A 3FOQA 3V0PA 1GX4A 2AM3A 4EEAA 1R7YA 4EEMA 5L6SA 4Y7FA 2J0BA 2V0IA 3ZGGA 5C36A 1R7UA 4CJCA 5C3AA 1O7OA 1G23A 3OH1A 5C47A 1LL0A 4Y7VA 4G3SA 2PA4A 2FYBA 4B2WA 2FYCB 1GWWA 2X60A 5C4FA 4J18A 1GQCA 2E8BA 5J49A 4HO6A 3ZLKA 1ZIZA 1FO8A 3I0KA 1ZI1A 4GBPA 4DDZA 3V0LA 4KPZA 4FRLA 3SPTA 2W0WA 1VGZA 2YESA 1HV9A 1H5SB 3RMVA 3IOJA 3SX3A 3SXAA 3BCVA 4G3PA 1TZFA 1QWJA 4AAWA 1ZI3A 2RJ8A 2O1GA 3DK5A 4Y7GA 2WAWA 2J0AA 2V0HA 3V0OA 5CMGX 2Y4JA 1FOAA 5CQPA 3CGXA 2RJ5A 3I0IX 1EZIA 4XWIA 1XZ6A 5HS2A 4O6MA 4ARWA 3OGZA 4NALA 1FO9A 2WGZA 2VS4A 4NANA 4P00A 2RIYA 4FCUA 1FRWA 1LL2A 4KT7A 5FUHA 3ST8A 4HCQA 2RJ0A 1H4EA 4AYLA 3DUVA 3T7NA 1FZWA 3SXEA 1PZTA 2DPWA 2A8UA 3I0JA 3SXCA 5FU0A 4Y63A 4LW3A 3F1YA 1HJJA 4AYJA 1JV3A 3D5NA 1OMZA 5IDSA 3T7MA 1G0RA 3DJ4A 5FTVA 4FRDA 1H4DA 4G3QA 1ZJ2A 2QH5A
chains in the Genus database with same CATH topology
3V90A 1LZ7A 2YQJA 2UX8A 4UEGA 4ASJA 2JCKA 4Y7TA 1H5RA 1TW5A 3U2VA 2WVLA 2VXMA 3JTJA 4O6NA 3EE5A 3I0LA 2VXLA 2OI5A 4M4KA 2I7BA 2OEGA 1R7VA 4BQHA 2RJ9A 1VGTA 3I0HA 4ZDQA 4E1KA 1HJLA 2D7RA 2ICYA 1G8OA 3PKQA 4FRMA 1ZCYA 4HO3A 5C4BA 1LZJA 1YP3A 3E26A 5C1HA 5AJPA 4Y9XA 5DDTA 1GWVA 2V0KA 5C4DA 4KPXA 3U2TA 2FFUA 2YC5A 4JD0A 2XMEA 2D7IA 3KIAA 1G95A 2GGQA 3QVBA 1YP2A 3F1CA 5C38A 2PGYA 1ZJPA 1ZDGA 3RMWA 3K8EA 5I1FA 2RIXA 3JUKA 2Y4KA 1ZJ0A 4KXOA 4FROA 4EEGA 2RJ6A 2FFVA 3V0NA 5FV9A 1JVDA 2YQCA 1S4NA 1MP5A 2OI6A 4NAKA 1R80A 3I0EA 3SXGA 1E5KA 1V83A 2ZU9A 2V0LA 3V8YA 2I5KA 4Y64A 1JVGA 1QGQA 4EE5A 3U0XA 2Z86A 1MP3A 2FYAA 4FREA 5C3DA 1XHBA 1PZYB 2VSIA 2RJ4A 4CVHA 1ZCVA 5EJZA 3ZLLA 3HL3A 3CU0A 2XWMA 2Y4MA 3OH2A 1H5RB 1WT1A 2MZBA 1H7FA 2Y7AA 1H4CA 1YROB 1VM8A 1GA8A 1HM8A 2AGDA 2OEFA 3GUEA 2I5EA 1G3LA 2Y6PA 1K4VA 3D98A 1WT2A 3PNNA 2PGVA 1LZ0A 2WEEA 3PKPA 1H3MA 3U0YA 2AM5A 1ZJ3A 3NGWA 4DE7A 4C2SA 2W0VA 2BO7A 1FXOA 1MP4A 4YS8A 1VH3A 5CMIA 3V91A 1S4OA 3I0GA 2WVMA 2AECA 1H5SD 1GX0A 1V84A 1WVCA 2XWLA 3IOIA 5FYEA 1NF5B 5C4EA 3Q80A 1FG5N 4KC2A 1ZJOA 3RSBA 4K6RA 1FWYA 4FRBA 2YQHA 2AH9A 3D8VA 4MNDA 4EE4A 3R2WA 3U2WA 1VZUA 2AE7A 3U2UA 1R82A 2ZU7A 2RJ7A 1ZDFA 1W55A 2VFZA 2OI7A 2ZU8A 4Y6UA 1LL3A 4KC4A 3OH3A 2PX7A 1FR9A 1WT0A 1ZCTA 2WVKA 2NXVA 2GGOA 1JYLA 4KNXA 2C0NA 2RJ1A 4FQWA 2XMHA 4Y6NA 5CQOA 1TVYA 4M2AA 5C1GA 1VGUA 2QKXA 1QG8A 2V0JA 4MYBA 1INIA 1GQ9A 5C4CA 2BO4A 1VH1A 5C48A 2Y4LA 5D91A 3V0QA 3TZTA 1H7TA 4D0ZA 3LW6A 2FY7A 4FRHA 4JISA 4FCEA 4HO5A 4B2XA 1VPAA 1ZCUA 4KRVA 5JQQA 2CU2A 4AC3A 1IIMA 4R7PA 4IRPA 3SX5A 5C3BA 1KWSA 5AJNA 3CKJA 1O7QA 1S4PA 4D11A 2AESA 1HM9A 4M2BA 4B4BA 1ZI5A 2D0JA 2JCOA 5C49A 3I0CA 4B5BA 1ZI4A 3CKVA 4HO2A 1H7QA 2P72A 3I0DA 1H5TA 1H7EA 1V82A 1EYRA 1O0RA 4P02A 1W77A 4B4MA 5C8RA 1JYKA 5EJ1A 1SS9A 2X5SA 4BMAA 2X5ZA 1NMMB 4HG6A 1G2VA 1G97A 1H7GA 1ZJ1A 4KNRA 1W57A 1NKHB 3OKRA 4ECMA 1YP4A 1HM0A 1H5SC 4FRAA 2YC3A 4HO0A 3CKQA 1VZTA 3Q7UA 3USQA 2VSHA 5CMFX 1R7XA 1NHEB 4Q7CA 5L6VA 1INJA 1OMXA 1VGWA 4KQLA 3U2XA 5IDTA 2BO6A 5AJOA 1ON8A 2QGIA 1H7HA 4Y62A 5CQNX 4D11C 1JV1A 3V8ZA 1IINA 2APCA 4D0TA 1WT3A 3BRKX 1FXJA 3V0MA 2Z87A 4D48A 4EEOA 4B42A 3O3PA 5CQMX 2O1HA 2JCJA 1NQIB 1Z90A 2P6WA 1LVWA 2VD4A 4HO9A 4EE3A 3ZF8A 4FRPA 2FYDB 1G1LA 5CMHA 3SXDA 4M28A 4NAIA 4B4GA 2YCMA 3POLA 3SX7A 3ZGFA 1H5TB 3E25A 2ICXA 3OAMA 2RITA 3K8DA 4ASYA 2E3DA 1O23B 3R3IA 1VICA 4L41C 4Y7UA 3T7OA 1FGXA 1I52A 2AM4A 3I0FA 3TQDA 3CKNA 5IFYA 3OH4A 4MIXA 2O1FA 5D92A 1LZIA 5CMJA 4IRQA 2VS3A 2JCLA 2VK9A 4KC1A 3CKOA 3Q4SA 2A8WA 3FWWA 1H5SA 4HOCA 1H7LA 3JUJA 5DDVA 4LW6A 1R7TA 2YQSA 2X65A 4CJ8A 2VS5A 3OC9A 2Q4JA 1VZXA 4HO4A 5FU8A 3OH0A 5C1LA 1ZHJA 4FIXA 3SX8A 1MC3A 5FTSA 1G93A 2XWNA 1FR8A 3N9WA 3USRA 4B3UA 1NWGB 1R81A 2P73A 4FRQA 2RIZA 4CJBA 1ON6A 1OQMB 5BXCA 4DECA 4FIYA 5CQLX 2WE9A 4EVWA 3SXBA 1G9RA 1WSZA 1QGSA 2BO8A 4G87A 3IOHA 5EIYA 1TW1A 1FGGA 4HO8A 3FOQA 3V0PA 1GX4A 2AM3A 4EEAA 1R7YA 4EEMA 5L6SA 4Y7FA 2J0BA 2V0IA 3ZGGA 5C36A 1R7UA 4CJCA 5C3AA 1O7OA 1G23A 3OH1A 5C47A 1LL0A 4Y7VA 4G3SA 2PA4A 2FYBA 4B2WA 2FYCB 1GWWA 2X60A 5C4FA 4J18A 1GQCA 2E8BA 5J49A 4HO6A 3ZLKA 1ZIZA 1FO8A 3I0KA 1ZI1A 4GBPA 4DDZA 3V0LA 4KPZA 4FRLA 3SPTA 2W0WA 1VGZA 2YESA 1HV9A 1H5SB 3RMVA 3IOJA 3SX3A 3SXAA 3BCVA 4G3PA 1TZFA 1QWJA 4AAWA 1ZI3A 2RJ8A 2O1GA 3DK5A 4Y7GA 2WAWA 2J0AA 2V0HA 3V0OA 5CMGX 2Y4JA 1FOAA 5CQPA 3CGXA 2RJ5A 3I0IX 1EZIA 4XWIA 1XZ6A 5HS2A 4O6MA 4ARWA 3OGZA 4NALA 1FO9A 2WGZA 2VS4A 4NANA 4P00A 2RIYA 4FCUA 1FRWA 1LL2A 4KT7A 5FUHA 3ST8A 4HCQA 2RJ0A 1H4EA 4AYLA 3DUVA 3T7NA 1FZWA 3SXEA 1PZTA 2DPWA 2A8UA 3I0JA 3SXCA 5FU0A 4Y63A 4LW3A 3F1YA 1HJJA 4AYJA 1JV3A 3D5NA 1OMZA 5IDSA 3T7MA 1G0RA 3DJ4A 5FTVA 4FRDA 1H4DA 4G3QA 1ZJ2A 2QH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V90 A;  1LZ7 A;  2YQJ A;  2UX8 A;  4UEG A;  4ASJ A;  2JCK A;  4Y7T A;  1H5R A;  1TW5 A;  3U2V A;  2WVL A;  2VXM A;  3JTJ A;  3EE5 A;  3I0L A;  2VXL A;  2OI5 A;  4M4K A;  2I7B A;  2OEG A;  1R7V A;  4BQH A;  2RJ9 A;  1VGT A;  3I0H A;  4ZDQ A;  4E1K A;  1HJL A;  2D7R A;  2ICY A;  1G8O A;  3PKQ A;  4FRM A;  1ZCY A;  4HO3 A;  5C4B A;  1LZJ A;  1YP3 A;  3E26 A;  5C1H A;  5AJP A;  4Y9X A;  5DDT A;  1GWV A;  2V0K A;  5C4D A;  4KPX A;  3U2T A;  2FFU A;  2YC5 A;  4JD0 A;  2XME A;  2D7I A;  3KIA A;  1G95 A;  2GGQ A;  3QVB A;  1YP2 A;  3F1C A;  5C38 A;  2PGY A;  1ZJP A;  1ZDG A;  3RMW A;  3K8E A;  5I1F A;  2RIX A;  3JUK A;  2Y4K A;  1ZJ0 A;  4KXO A;  4FRO A;  4EEG A;  2RJ6 A;  2FFV A;  3V0N A;  5FV9 A;  1JVD A;  2YQC A;  1S4N A;  1MP5 A;  2OI6 A;  4NAK A;  1R80 A;  3I0E A;  3SXG A;  1E5K A;  1V83 A;  2ZU9 A;  2V0L A;  3V8Y A;  2I5K A;  4Y64 A;  1JVG A;  1QGQ A;  4EE5 A;  3U0X A;  2Z86 A;  1MP3 A;  2FYA A;  4FRE A;  5C3D A;  1XHB A;  1PZY B;  2VSI A;  2RJ4 A;  4CVH A;  1ZCV A;  5EJZ A;  3ZLL A;  3HL3 A;  3CU0 A;  2XWM A;  2Y4M A;  3OH2 A;  1H5R B;  1WT1 A;  2MZB A;  1H7F A;  2Y7A A;  1H4C A;  1YRO B;  1VM8 A;  1GA8 A;  1HM8 A;  2AGD A;  2OEF A;  3GUE A;  2I5E A;  1G3L A;  2Y6P A;  1K4V A;  3D98 A;  1WT2 A;  3PNN A;  2PGV A;  1LZ0 A;  2WEE A;  3PKP A;  1H3M A;  3U0Y A;  2AM5 A;  1ZJ3 A;  3NGW A;  4DE7 A;  4C2S A;  2W0V A;  2BO7 A;  1FXO A;  1MP4 A;  4YS8 A;  1VH3 A;  5CMI A;  3V91 A;  1S4O A;  3I0G A;  2WVM A;  2AEC A;  1H5S D;  1GX0 A;  1V84 A;  1WVC A;  2XWL A;  3IOI A;  5FYE A;  1NF5 B;  5C4E A;  3Q80 A;  1FG5 N;  4KC2 A;  1ZJO A;  3RSB A;  4K6R A;  1FWY A;  4FRB A;  2YQH A;  2AH9 A;  3D8V A;  4MND A;  4EE4 A;  3R2W A;  3U2W A;  1VZU A;  2AE7 A;  3U2U A;  1R82 A;  2ZU7 A;  2RJ7 A;  1ZDF A;  1W55 A;  2VFZ A;  2OI7 A;  2ZU8 A;  4Y6U A;  1LL3 A;  4KC4 A;  3OH3 A;  2PX7 A;  1FR9 A;  1WT0 A;  1ZCT A;  2WVK A;  2NXV A;  2GGO A;  1JYL A;  4KNX A;  2RJ1 A;  4FQW A;  2XMH A;  4Y6N A;  5CQO A;  1TVY A;  4M2A A;  5C1G A;  1VGU A;  2QKX A;  1QG8 A;  2V0J A;  4MYB A;  1INI A;  1GQ9 A;  5C4C A;  2BO4 A;  1VH1 A;  5C48 A;  2Y4L A;  3V0Q A;  3TZT A;  1H7T A;  4D0Z A;  3LW6 A;  2FY7 A;  4FRH A;  4JIS A;  4FCE A;  4HO5 A;  4B2X A;  1VPA A;  1ZCU A;  4KRV A;  5JQQ A;  2CU2 A;  4AC3 A;  1IIM A;  4R7P A;  4IRP A;  3SX5 A;  5C3B A;  1KWS A;  5AJN A;  3CKJ A;  1O7Q A;  1S4P A;  4D11 A;  2AES A;  1HM9 A;  4M2B A;  4B4B A;  1ZI5 A;  2D0J A;  2JCO A;  5C49 A;  3I0C A;  4B5B A;  1ZI4 A;  3CKV A;  4HO2 A;  1H7Q A;  2P72 A;  3I0D A;  1H5T A;  1H7E A;  1V82 A;  1EYR A;  1O0R A;  4P02 A;  1W77 A;  4B4M A;  5C8R A;  1JYK A;  5EJ1 A;  1SS9 A;  2X5S A;  4BMA A;  2X5Z A;  1NMM B;  4HG6 A;  1G2V A;  1G97 A;  1H7G A;  1ZJ1 A;  4KNR A;  1W57 A;  1NKH B;  3OKR A;  4ECM A;  1YP4 A;  1HM0 A;  1H5S C;  4FRA A;  2YC3 A;  4HO0 A;  3CKQ A;  1VZT A;  3Q7U A;  3USQ A;  2VSH A;  5CMF X;  1R7X A;  1NHE B;  5L6V A;  1INJ A;  1OMX A;  1VGW A;  4KQL A;  3U2X A;  5IDT A;  2BO6 A;  5AJO A;  1ON8 A;  2QGI A;  1H7H A;  4Y62 A;  5CQN X;  4D11 C;  1JV1 A;  3V8Z A;  1IIN A;  2APC A;  4D0T A;  1WT3 A;  3BRK X;  1FXJ A;  3V0M A;  2Z87 A;  4D48 A;  4EEO A;  4B42 A;  3O3P A;  5CQM X;  2O1H A;  2JCJ A;  1NQI B;  1Z90 A;  2P6W A;  1LVW A;  2VD4 A;  4HO9 A;  4EE3 A;  3ZF8 A;  4FRP A;  2FYD B;  1G1L A;  5CMH A;  3SXD A;  4M28 A;  4NAI A;  4B4G A;  2YCM A;  3POL A;  3SX7 A;  3ZGF A;  1H5T B;  3E25 A;  2ICX A;  3OAM A;  2RIT A;  3K8D A;  4ASY A;  2E3D A;  1O23 B;  3R3I A;  1VIC A;  4L41 C;  4Y7U A;  3T7O A;  1FGX A;  1I52 A;  2AM4 A;  3I0F A;  3TQD A;  3CKN A;  5IFY A;  3OH4 A;  2O1F A;  1LZI A;  5CMJ A;  4IRQ A;  2VS3 A;  2JCL A;  4KC1 A;  3CKO A;  3Q4S A;  2A8W A;  3FWW A;  1H5S A;  4HOC A;  1H7L A;  3JUJ A;  5DDV A;  4LW6 A;  1R7T A;  2YQS A;  2X65 A;  4CJ8 A;  2VS5 A;  3OC9 A;  2Q4J A;  1VZX A;  4HO4 A;  5FU8 A;  3OH0 A;  5C1L A;  1ZHJ A;  3SX8 A;  1MC3 A;  5FTS A;  1G93 A;  2XWN A;  1FR8 A;  3N9W A;  3USR A;  4B3U A;  1NWG B;  1R81 A;  2P73 A;  4FRQ A;  2RIZ A;  4CJB A;  1ON6 A;  1OQM B;  5BXC A;  4DEC A;  5CQL X;  2WE9 A;  4EVW A;  3SXB A;  1G9R A;  1WSZ A;  1QGS A;  2BO8 A;  4G87 A;  3IOH A;  5EIY A;  1TW1 A;  1FGG A;  4HO8 A;  3FOQ A;  3V0P A;  1GX4 A;  2AM3 A;  4EEA A;  1R7Y A;  4EEM A;  5L6S A;  4Y7F A;  2V0I A;  3ZGG A;  5C36 A;  1R7U A;  4CJC A;  5C3A A;  1O7O A;  1G23 A;  3OH1 A;  5C47 A;  1LL0 A;  4Y7V A;  4G3S A;  2PA4 A;  2FYB A;  4B2W A;  2FYC B;  1GWW A;  2X60 A;  5C4F A;  4J18 A;  1GQC A;  2E8B A;  5J49 A;  4HO6 A;  3ZLK A;  1ZIZ A;  1FO8 A;  3I0K A;  1ZI1 A;  4GBP A;  4DDZ A;  3V0L A;  4KPZ A;  4FRL A;  3SPT A;  2W0W A;  1VGZ A;  2YES A;  1HV9 A;  1H5S B;  3RMV A;  3IOJ A;  3SX3 A;  3SXA A;  3BCV A;  4G3P A;  1TZF A;  1QWJ A;  4AAW A;  1ZI3 A;  2RJ8 A;  2O1G A;  3DK5 A;  4Y7G A;  2WAW A;  2V0H A;  3V0O A;  5CMG X;  2Y4J A;  1FOA A;  5CQP A;  3CGX A;  2RJ5 A;  3I0I X;  1EZI A;  4XWI A;  1XZ6 A;  5HS2 A;  4ARW A;  3OGZ A;  4NAL A;  1FO9 A;  2WGZ A;  2VS4 A;  4NAN A;  4P00 A;  2RIY A;  4FCU A;  1FRW A;  1LL2 A;  4KT7 A;  5FUH A;  3ST8 A;  4HCQ A;  2RJ0 A;  1H4E A;  4AYL A;  3DUV A;  3T7N A;  1FZW A;  3SXE A;  1PZT A;  2DPW A;  2A8U A;  3I0J A;  3SXC A;  5FU0 A;  4Y63 A;  4LW3 A;  3F1Y A;  1HJJ A;  4AYJ A;  1JV3 A;  3D5N A;  1OMZ A;  5IDS A;  3T7M A;  1G0R A;  3DJ4 A;  5FTV A;  4FRD A;  1H4D A;  4G3Q A;  1ZJ2 A;  2QH5 A; 
#chains in the Genus database with same CATH topology
 3V90 A;  1LZ7 A;  2YQJ A;  2UX8 A;  4UEG A;  4ASJ A;  2JCK A;  4Y7T A;  1H5R A;  1TW5 A;  3U2V A;  2WVL A;  2VXM A;  3JTJ A;  4O6N A;  3EE5 A;  3I0L A;  2VXL A;  2OI5 A;  4M4K A;  2I7B A;  2OEG A;  1R7V A;  4BQH A;  2RJ9 A;  1VGT A;  3I0H A;  4ZDQ A;  4E1K A;  1HJL A;  2D7R A;  2ICY A;  1G8O A;  3PKQ A;  4FRM A;  1ZCY A;  4HO3 A;  5C4B A;  1LZJ A;  1YP3 A;  3E26 A;  5C1H A;  5AJP A;  4Y9X A;  5DDT A;  1GWV A;  2V0K A;  5C4D A;  4KPX A;  3U2T A;  2FFU A;  2YC5 A;  4JD0 A;  2XME A;  2D7I A;  3KIA A;  1G95 A;  2GGQ A;  3QVB A;  1YP2 A;  3F1C A;  5C38 A;  2PGY A;  1ZJP A;  1ZDG A;  3RMW A;  3K8E A;  5I1F A;  2RIX A;  3JUK A;  2Y4K A;  1ZJ0 A;  4KXO A;  4FRO A;  4EEG A;  2RJ6 A;  2FFV A;  3V0N A;  5FV9 A;  1JVD A;  2YQC A;  1S4N A;  1MP5 A;  2OI6 A;  4NAK A;  1R80 A;  3I0E A;  3SXG A;  1E5K A;  1V83 A;  2ZU9 A;  2V0L A;  3V8Y A;  2I5K A;  4Y64 A;  1JVG A;  1QGQ A;  4EE5 A;  3U0X A;  2Z86 A;  1MP3 A;  2FYA A;  4FRE A;  5C3D A;  1XHB A;  1PZY B;  2VSI A;  2RJ4 A;  4CVH A;  1ZCV A;  5EJZ A;  3ZLL A;  3HL3 A;  3CU0 A;  2XWM A;  2Y4M A;  3OH2 A;  1H5R B;  1WT1 A;  2MZB A;  1H7F A;  2Y7A A;  1H4C A;  1YRO B;  1VM8 A;  1GA8 A;  1HM8 A;  2AGD A;  2OEF A;  3GUE A;  2I5E A;  1G3L A;  2Y6P A;  1K4V A;  3D98 A;  1WT2 A;  3PNN A;  2PGV A;  1LZ0 A;  2WEE A;  3PKP A;  1H3M A;  3U0Y A;  2AM5 A;  1ZJ3 A;  3NGW A;  4DE7 A;  4C2S A;  2W0V A;  2BO7 A;  1FXO A;  1MP4 A;  4YS8 A;  1VH3 A;  5CMI A;  3V91 A;  1S4O A;  3I0G A;  2WVM A;  2AEC A;  1H5S D;  1GX0 A;  1V84 A;  1WVC A;  2XWL A;  3IOI A;  5FYE A;  1NF5 B;  5C4E A;  3Q80 A;  1FG5 N;  4KC2 A;  1ZJO A;  3RSB A;  4K6R A;  1FWY A;  4FRB A;  2YQH A;  2AH9 A;  3D8V A;  4MND A;  4EE4 A;  3R2W A;  3U2W A;  1VZU A;  2AE7 A;  3U2U A;  1R82 A;  2ZU7 A;  2RJ7 A;  1ZDF A;  1W55 A;  2VFZ A;  2OI7 A;  2ZU8 A;  4Y6U A;  1LL3 A;  4KC4 A;  3OH3 A;  2PX7 A;  1FR9 A;  1WT0 A;  1ZCT A;  2WVK A;  2NXV A;  2GGO A;  1JYL A;  4KNX A;  2C0N A;  2RJ1 A;  4FQW A;  2XMH A;  4Y6N A;  5CQO A;  1TVY A;  4M2A A;  5C1G A;  1VGU A;  2QKX A;  1QG8 A;  2V0J A;  4MYB A;  1INI A;  1GQ9 A;  5C4C A;  2BO4 A;  1VH1 A;  5C48 A;  2Y4L A;  5D91 A;  3V0Q A;  3TZT A;  1H7T A;  4D0Z A;  3LW6 A;  2FY7 A;  4FRH A;  4JIS A;  4FCE A;  4HO5 A;  4B2X A;  1VPA A;  1ZCU A;  4KRV A;  5JQQ A;  2CU2 A;  4AC3 A;  1IIM A;  4R7P A;  4IRP A;  3SX5 A;  5C3B A;  1KWS A;  5AJN A;  3CKJ A;  1O7Q A;  1S4P A;  4D11 A;  2AES A;  1HM9 A;  4M2B A;  4B4B A;  1ZI5 A;  2D0J A;  2JCO A;  5C49 A;  3I0C A;  4B5B A;  1ZI4 A;  3CKV A;  4HO2 A;  1H7Q A;  2P72 A;  3I0D A;  1H5T A;  1H7E A;  1V82 A;  1EYR A;  1O0R A;  4P02 A;  1W77 A;  4B4M A;  5C8R A;  1JYK A;  5EJ1 A;  1SS9 A;  2X5S A;  4BMA A;  2X5Z A;  1NMM B;  4HG6 A;  1G2V A;  1G97 A;  1H7G A;  1ZJ1 A;  4KNR A;  1W57 A;  1NKH B;  3OKR A;  4ECM A;  1YP4 A;  1HM0 A;  1H5S C;  4FRA A;  2YC3 A;  4HO0 A;  3CKQ A;  1VZT A;  3Q7U A;  3USQ A;  2VSH A;  5CMF X;  1R7X A;  1NHE B;  4Q7C A;  5L6V A;  1INJ A;  1OMX A;  1VGW A;  4KQL A;  3U2X A;  5IDT A;  2BO6 A;  5AJO A;  1ON8 A;  2QGI A;  1H7H A;  4Y62 A;  5CQN X;  4D11 C;  1JV1 A;  3V8Z A;  1IIN A;  2APC A;  4D0T A;  1WT3 A;  3BRK X;  1FXJ A;  3V0M A;  2Z87 A;  4D48 A;  4EEO A;  4B42 A;  3O3P A;  5CQM X;  2O1H A;  2JCJ A;  1NQI B;  1Z90 A;  2P6W A;  1LVW A;  2VD4 A;  4HO9 A;  4EE3 A;  3ZF8 A;  4FRP A;  2FYD B;  1G1L A;  5CMH A;  3SXD A;  4M28 A;  4NAI A;  4B4G A;  2YCM A;  3POL A;  3SX7 A;  3ZGF A;  1H5T B;  3E25 A;  2ICX A;  3OAM A;  2RIT A;  3K8D A;  4ASY A;  2E3D A;  1O23 B;  3R3I A;  1VIC A;  4L41 C;  4Y7U A;  3T7O A;  1FGX A;  1I52 A;  2AM4 A;  3I0F A;  3TQD A;  3CKN A;  5IFY A;  3OH4 A;  4MIX A;  2O1F A;  5D92 A;  1LZI A;  5CMJ A;  4IRQ A;  2VS3 A;  2JCL A;  2VK9 A;  4KC1 A;  3CKO A;  3Q4S A;  2A8W A;  3FWW A;  1H5S A;  4HOC A;  1H7L A;  3JUJ A;  5DDV A;  4LW6 A;  1R7T A;  2YQS A;  2X65 A;  4CJ8 A;  2VS5 A;  3OC9 A;  2Q4J A;  1VZX A;  4HO4 A;  5FU8 A;  3OH0 A;  5C1L A;  1ZHJ A;  4FIX A;  3SX8 A;  1MC3 A;  5FTS A;  1G93 A;  2XWN A;  1FR8 A;  3N9W A;  3USR A;  4B3U A;  1NWG B;  1R81 A;  2P73 A;  4FRQ A;  2RIZ A;  4CJB A;  1ON6 A;  1OQM B;  5BXC A;  4DEC A;  4FIY A;  5CQL X;  2WE9 A;  4EVW A;  3SXB A;  1G9R A;  1WSZ A;  1QGS A;  2BO8 A;  4G87 A;  3IOH A;  5EIY A;  1TW1 A;  1FGG A;  4HO8 A;  3FOQ A;  3V0P A;  1GX4 A;  2AM3 A;  4EEA A;  1R7Y A;  4EEM A;  5L6S A;  4Y7F A;  2J0B A;  2V0I A;  3ZGG A;  5C36 A;  1R7U A;  4CJC A;  5C3A A;  1O7O A;  1G23 A;  3OH1 A;  5C47 A;  1LL0 A;  4Y7V A;  4G3S A;  2PA4 A;  2FYB A;  4B2W A;  2FYC B;  1GWW A;  2X60 A;  5C4F A;  4J18 A;  1GQC A;  2E8B A;  5J49 A;  4HO6 A;  3ZLK A;  1ZIZ A;  1FO8 A;  3I0K A;  1ZI1 A;  4GBP A;  4DDZ A;  3V0L A;  4KPZ A;  4FRL A;  3SPT A;  2W0W A;  1VGZ A;  2YES A;  1HV9 A;  1H5S B;  3RMV A;  3IOJ A;  3SX3 A;  3SXA A;  3BCV A;  4G3P A;  1TZF A;  1QWJ A;  4AAW A;  1ZI3 A;  2RJ8 A;  2O1G A;  3DK5 A;  4Y7G A;  2WAW A;  2J0A A;  2V0H A;  3V0O A;  5CMG X;  2Y4J A;  1FOA A;  5CQP A;  3CGX A;  2RJ5 A;  3I0I X;  1EZI A;  4XWI A;  1XZ6 A;  5HS2 A;  4O6M A;  4ARW A;  3OGZ A;  4NAL A;  1FO9 A;  2WGZ A;  2VS4 A;  4NAN A;  4P00 A;  2RIY A;  4FCU A;  1FRW A;  1LL2 A;  4KT7 A;  5FUH A;  3ST8 A;  4HCQ A;  2RJ0 A;  1H4E A;  4AYL A;  3DUV A;  3T7N A;  1FZW A;  3SXE A;  1PZT A;  2DPW A;  2A8U A;  3I0J A;  3SXC A;  5FU0 A;  4Y63 A;  4LW3 A;  3F1Y A;  1HJJ A;  4AYJ A;  1JV3 A;  3D5N A;  1OMZ A;  5IDS A;  3T7M A;  1G0R A;  3DJ4 A;  5FTV A;  4FRD A;  1H4D A;  4G3Q A;  1ZJ2 A;  2QH5 A; 
#chains in the Genus database with same CATH homology
 3V90 A;  1LZ7 A;  2YQJ A;  2UX8 A;  4UEG A;  4ASJ A;  2JCK A;  4Y7T A;  1H5R A;  1TW5 A;  3U2V A;  2WVL A;  2VXM A;  3JTJ A;  4O6N A;  3EE5 A;  3I0L A;  2VXL A;  2OI5 A;  4M4K A;  2I7B A;  2OEG A;  1R7V A;  4BQH A;  2RJ9 A;  1VGT A;  3I0H A;  4ZDQ A;  4E1K A;  1HJL A;  2D7R A;  2ICY A;  1G8O A;  3PKQ A;  4FRM A;  1ZCY A;  4HO3 A;  5C4B A;  1LZJ A;  1YP3 A;  3E26 A;  5C1H A;  5AJP A;  4Y9X A;  5DDT A;  1GWV A;  2V0K A;  5C4D A;  4KPX A;  3U2T A;  2FFU A;  2YC5 A;  4JD0 A;  2XME A;  2D7I A;  3KIA A;  1G95 A;  2GGQ A;  3QVB A;  1YP2 A;  3F1C A;  5C38 A;  2PGY A;  1ZJP A;  1ZDG A;  3RMW A;  3K8E A;  5I1F A;  2RIX A;  3JUK A;  2Y4K A;  1ZJ0 A;  4KXO A;  4FRO A;  4EEG A;  2RJ6 A;  2FFV A;  3V0N A;  5FV9 A;  1JVD A;  2YQC A;  1S4N A;  1MP5 A;  2OI6 A;  4NAK A;  1R80 A;  3I0E A;  3SXG A;  1E5K A;  1V83 A;  2ZU9 A;  2V0L A;  3V8Y A;  2I5K A;  4Y64 A;  1JVG A;  1QGQ A;  4EE5 A;  3U0X A;  2Z86 A;  1MP3 A;  2FYA A;  4FRE A;  5C3D A;  1XHB A;  1PZY B;  2VSI A;  2RJ4 A;  4CVH A;  1ZCV A;  5EJZ A;  3ZLL A;  3HL3 A;  3CU0 A;  2XWM A;  2Y4M A;  3OH2 A;  1H5R B;  1WT1 A;  2MZB A;  1H7F A;  2Y7A A;  1H4C A;  1YRO B;  1VM8 A;  1GA8 A;  1HM8 A;  2AGD A;  2OEF A;  3GUE A;  2I5E A;  1G3L A;  2Y6P A;  1K4V A;  3D98 A;  1WT2 A;  3PNN A;  2PGV A;  1LZ0 A;  2WEE A;  3PKP A;  1H3M A;  3U0Y A;  2AM5 A;  1ZJ3 A;  3NGW A;  4DE7 A;  4C2S A;  2W0V A;  2BO7 A;  1FXO A;  1MP4 A;  4YS8 A;  1VH3 A;  5CMI A;  3V91 A;  1S4O A;  3I0G A;  2WVM A;  2AEC A;  1H5S D;  1GX0 A;  1V84 A;  1WVC A;  2XWL A;  3IOI A;  5FYE A;  1NF5 B;  5C4E A;  3Q80 A;  1FG5 N;  4KC2 A;  1ZJO A;  3RSB A;  4K6R A;  1FWY A;  4FRB A;  2YQH A;  2AH9 A;  3D8V A;  4MND A;  4EE4 A;  3R2W A;  3U2W A;  1VZU A;  2AE7 A;  3U2U A;  1R82 A;  2ZU7 A;  2RJ7 A;  1ZDF A;  1W55 A;  2VFZ A;  2OI7 A;  2ZU8 A;  4Y6U A;  1LL3 A;  4KC4 A;  3OH3 A;  2PX7 A;  1FR9 A;  1WT0 A;  1ZCT A;  2WVK A;  2NXV A;  2GGO A;  1JYL A;  4KNX A;  2C0N A;  2RJ1 A;  4FQW A;  2XMH A;  4Y6N A;  5CQO A;  1TVY A;  4M2A A;  5C1G A;  1VGU A;  2QKX A;  1QG8 A;  2V0J A;  4MYB A;  1INI A;  1GQ9 A;  5C4C A;  2BO4 A;  1VH1 A;  5C48 A;  2Y4L A;  5D91 A;  3V0Q A;  3TZT A;  1H7T A;  4D0Z A;  3LW6 A;  2FY7 A;  4FRH A;  4JIS A;  4FCE A;  4HO5 A;  4B2X A;  1VPA A;  1ZCU A;  4KRV A;  5JQQ A;  2CU2 A;  4AC3 A;  1IIM A;  4R7P A;  4IRP A;  3SX5 A;  5C3B A;  1KWS A;  5AJN A;  3CKJ A;  1O7Q A;  1S4P A;  4D11 A;  2AES A;  1HM9 A;  4M2B A;  4B4B A;  1ZI5 A;  2D0J A;  2JCO A;  5C49 A;  3I0C A;  4B5B A;  1ZI4 A;  3CKV A;  4HO2 A;  1H7Q A;  2P72 A;  3I0D A;  1H5T A;  1H7E A;  1V82 A;  1EYR A;  1O0R A;  4P02 A;  1W77 A;  4B4M A;  5C8R A;  1JYK A;  5EJ1 A;  1SS9 A;  2X5S A;  4BMA A;  2X5Z A;  1NMM B;  4HG6 A;  1G2V A;  1G97 A;  1H7G A;  1ZJ1 A;  4KNR A;  1W57 A;  1NKH B;  3OKR A;  4ECM A;  1YP4 A;  1HM0 A;  1H5S C;  4FRA A;  2YC3 A;  4HO0 A;  3CKQ A;  1VZT A;  3Q7U A;  3USQ A;  2VSH A;  5CMF X;  1R7X A;  1NHE B;  4Q7C A;  5L6V A;  1INJ A;  1OMX A;  1VGW A;  4KQL A;  3U2X A;  5IDT A;  2BO6 A;  5AJO A;  1ON8 A;  2QGI A;  1H7H A;  4Y62 A;  5CQN X;  4D11 C;  1JV1 A;  3V8Z A;  1IIN A;  2APC A;  4D0T A;  1WT3 A;  3BRK X;  1FXJ A;  3V0M A;  2Z87 A;  4D48 A;  4EEO A;  4B42 A;  3O3P A;  5CQM X;  2O1H A;  2JCJ A;  1NQI B;  1Z90 A;  2P6W A;  1LVW A;  2VD4 A;  4HO9 A;  4EE3 A;  3ZF8 A;  4FRP A;  2FYD B;  1G1L A;  5CMH A;  3SXD A;  4M28 A;  4NAI A;  4B4G A;  2YCM A;  3POL A;  3SX7 A;  3ZGF A;  1H5T B;  3E25 A;  2ICX A;  3OAM A;  2RIT A;  3K8D A;  4ASY A;  2E3D A;  1O23 B;  3R3I A;  1VIC A;  4L41 C;  4Y7U A;  3T7O A;  1FGX A;  1I52 A;  2AM4 A;  3I0F A;  3TQD A;  3CKN A;  5IFY A;  3OH4 A;  4MIX A;  2O1F A;  5D92 A;  1LZI A;  5CMJ A;  4IRQ A;  2VS3 A;  2JCL A;  2VK9 A;  4KC1 A;  3CKO A;  3Q4S A;  2A8W A;  3FWW A;  1H5S A;  4HOC A;  1H7L A;  3JUJ A;  5DDV A;  4LW6 A;  1R7T A;  2YQS A;  2X65 A;  4CJ8 A;  2VS5 A;  3OC9 A;  2Q4J A;  1VZX A;  4HO4 A;  5FU8 A;  3OH0 A;  5C1L A;  1ZHJ A;  4FIX A;  3SX8 A;  1MC3 A;  5FTS A;  1G93 A;  2XWN A;  1FR8 A;  3N9W A;  3USR A;  4B3U A;  1NWG B;  1R81 A;  2P73 A;  4FRQ A;  2RIZ A;  4CJB A;  1ON6 A;  1OQM B;  5BXC A;  4DEC A;  4FIY A;  5CQL X;  2WE9 A;  4EVW A;  3SXB A;  1G9R A;  1WSZ A;  1QGS A;  2BO8 A;  4G87 A;  3IOH A;  5EIY A;  1TW1 A;  1FGG A;  4HO8 A;  3FOQ A;  3V0P A;  1GX4 A;  2AM3 A;  4EEA A;  1R7Y A;  4EEM A;  5L6S A;  4Y7F A;  2J0B A;  2V0I A;  3ZGG A;  5C36 A;  1R7U A;  4CJC A;  5C3A A;  1O7O A;  1G23 A;  3OH1 A;  5C47 A;  1LL0 A;  4Y7V A;  4G3S A;  2PA4 A;  2FYB A;  4B2W A;  2FYC B;  1GWW A;  2X60 A;  5C4F A;  4J18 A;  1GQC A;  2E8B A;  5J49 A;  4HO6 A;  3ZLK A;  1ZIZ A;  1FO8 A;  3I0K A;  1ZI1 A;  4GBP A;  4DDZ A;  3V0L A;  4KPZ A;  4FRL A;  3SPT A;  2W0W A;  1VGZ A;  2YES A;  1HV9 A;  1H5S B;  3RMV A;  3IOJ A;  3SX3 A;  3SXA A;  3BCV A;  4G3P A;  1TZF A;  1QWJ A;  4AAW A;  1ZI3 A;  2RJ8 A;  2O1G A;  3DK5 A;  4Y7G A;  2WAW A;  2J0A A;  2V0H A;  3V0O A;  5CMG X;  2Y4J A;  1FOA A;  5CQP A;  3CGX A;  2RJ5 A;  3I0I X;  1EZI A;  4XWI A;  1XZ6 A;  5HS2 A;  4O6M A;  4ARW A;  3OGZ A;  4NAL A;  1FO9 A;  2WGZ A;  2VS4 A;  4NAN A;  4P00 A;  2RIY A;  4FCU A;  1FRW A;  1LL2 A;  4KT7 A;  5FUH A;  3ST8 A;  4HCQ A;  2RJ0 A;  1H4E A;  4AYL A;  3DUV A;  3T7N A;  1FZW A;  3SXE A;  1PZT A;  2DPW A;  2A8U A;  3I0J A;  3SXC A;  5FU0 A;  4Y63 A;  4LW3 A;  3F1Y A;  1HJJ A;  4AYJ A;  1JV3 A;  3D5N A;  1OMZ A;  5IDS A;  3T7M A;  1G0R A;  3DJ4 A;  5FTV A;  4FRD A;  1H4D A;  4G3Q A;  1ZJ2 A;  2QH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...