1TZFA

X-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
259
structure length
251
Chain Sequence
MASKAVILAGGLGVKPKPMVEIGGKPILWHIMKMYSVHGIKDFIICCGYKGYVIKEYFANYFLHMSDVTFHMAENRMEVHHKRVEPWNVTLVDTGDSSMTGGRLKRVAEYVKDDEAFLFTYGDGVADLDIKATIDFHKAHGKKATLTATFPPGRFGALDIQAGQVRSFQEKPKGDGAMINGGFFVLNPSVIDLIDNDATTWEQEPLMTLAQQGELMAFEHPGFWQPMDTLRDKVYLEGLWEKGKAPWKTWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose-1-phosphate cytidylyltransferase
publication title Molecular structure of alpha-D-glucose-1-phosphate cytidylyltransferase from Salmonella typhi
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhi
molecule tags Transferase
total genus 70
structure length 251
sequence length 259
ec nomenclature ec 2.7.7.33: Glucose-1-phosphate cytidylyltransferase.
pdb deposition date 2004-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1tzfA00
1R80A 4NALA 1LL2A 3USRA 2X65A 1PZTA 1GX4A 1R7YA 4NAKA 5FUHA 1H5SC 4HO9A 3USQA 5C4DA 4FRLA 5EIYA 1O7QA 1QGSA 1ZDFA 2FYAA 4G3SA 3POLA 3V91A 3F1YA 3PKPA 3V0PA 2YQCA 1NWGB 2P72A 2Y4MA 1IIMA 1LL0A 3JUKA 1HM0A 5CQPA 4EVWA 1JYKA 4FQWA 3HL3A 4Y63A 2PGYA 1JVGA 4B4BA 5FU8A 4EEAA 4HCQA 3U0XA 5L6SA 2P6WA 4HOCA 4KNRA 2VD4A 2BO8A 1GQCA 1GX0A 3Q7UA 1WT2A 4Y7TA 4M2AA 4Y6NA 1LZ0A 2Y7AA 4CVHA 2XMEA 1G2VA 1O23B 1R7TA 1H5SA 4R7PA 5CQOA 4EEOA 1TW5A 2VXMA 3SXBA 1YP4A 1ZCTA 3I0DA 2V0LA 3DUVA 3SX5A 1ZI3A 2I5KA 2A8UA 2QH5A 1HV9A 1S4PA 1W55A 4K6RA 5C3BA 1WT1A 4MNDA 1ZJOA 2RIYA 2V0JA 1GWWA 3ZF8A 4EEMA 2V0KA 4M2BA 5C49A 1VICA 3ZLKA 5I1FA 4AYLA 4B2XA 3OC9A 1OMXA 4KPXA 3OH4A 2WGZA 4FRAA 3V8YA 3OH2A 1R7UA 2UX8A 1ZHJA 2OI6A 1W57A 3I0CA 3U2XA 4ARWA 1H5RB 5EJ1A 2V0HA 2P73A 1VPAA 1O0RA 3EE5A 2E3DA 3GUEA 2PX7A 4MYBA 3SX7A 2ZU8A 2VFZA 1ZJ3A 5CQLX 4DECA 1NKHB 1H4EA 3K8EA 1MC3A 1HJJA 4HG6A 1H7FA 4HO6A 4ECMA 3OH1A 3SXGA 2Y4KA 3ZLLA 2E8BA 4FRBA 2X60A 1HM8A 2Q4JA 3I0KA 2Y6PA 1FXJA 4B4MA 1ZIZA 3CKQA 5C3AA 2DPWA 2RITA 3IOJA 5CMGX 2AH9A 2BO7A 1V83A 2FYBA 5HS2A 3NGWA 5C48A 1JV1A 2QGIA 3SXDA 2YC3A 1VGWA 1ZI4A 2FYCB 4YS8A 1LZJA 1FR9A 4Y7VA 3D98A 3R3IA 5CMJA 1LZIA 1WT3A 5FU0A 2ICXA 2YQHA 1YROB 3E26A 3OAMA 3V8ZA 1QGQA 2D0JA 4Y7UA 1G9RA 2CU2A 3CKJA 4UEGA 1TZFA 1VZXA 1Z90A 2RJ9A 4IRQA 2WVLA 2RJ1A 1MP3A 4Y62A 3FWWA 3I0EA 1G23A 3OGZA 3SXCA 1WT0A 2O1FA 4FRMA 2BO4A 1OQMB 2RJ7A 1LVWA 4M4KA 1K4VA 1R81A 4FRQA 4KC1A 1YP3A 1QWJA 4D48A 2ZU7A 1GA8A 1H4CA 2Z86A 3JTJA 4GBPA 4KT7A 5CMIA 3V0QA 1H7LA 1O7OA 3OH3A 1INIA 2XWNA 4FRHA 1H5TA 3E25A 3OH0A 4BMAA 1OMZA 4EE5A 1VGTA 5C47A 5AJOA 1VGZA 3IOIA 4DDZA 3D8VA 2X5ZA 3CU0A 1LZ7A 4FREA 2JCLA 4HO8A 4DE7A 2VS5A 2YCMA 4B4GA 3Q4SA 2RJ8A 3SX8A 1E5KA 2ICYA 1VGUA 4Y64A 1ZJ1A 4JISA 2WEEA 3DK5A 3FOQA 3T7OA 2YQSA 1FWYA 1H5SD 4EE4A 1VZTA 5CMHA 2I5EA 3QVBA 5FTVA 1VH3A 2ZU9A 4G87A 2YESA 2V0IA 1VM8A 2D7IA 1H7GA 1H5SB 2A8WA 4EE3A 4HO4A 5C3DA 1FG5N 2RIZA 4G3QA 4KNXA 5JQQA 4Y9XA 2WAWA 4CJ8A 4KQLA 5C4CA 4J18A 3SX3A 1VH1A 2OEFA 4KXOA 3V0MA 4XWIA 4Y7GA 1V84A 3ST8A 1R82A 1R7XA 4HO5A 1XHBA 4Y7FA 1FRWA 5DDVA 2D7RA 1ZI1A 1FGGA 3OKRA 3Q80A 2VSHA 2X5SA 4AAWA 4FRDA 4D11C 1FGXA 3RSBA 2AECA 1WSZA 2FYDB 1G8OA 1ZCVA 1EZIA 1W77A 4LW3A 4AC3A 2NXVA 5C36A 1ZJPA 2XMHA 1JVDA 1G3LA 4KC4A 1GQ9A 4M28A 3V0NA 3TZTA 4KRVA 2RJ0A 4ZDQA 1S4OA 1FO9A 2WVKA 3CKVA 4LW6A 3LW6A 2W0WA 5C1HA 1FO8A 2PA4A 2XWLA 2AM4A 3I0IX 4KPZA 5C1LA 2JCJA 2WVMA 4FROA 3U2TA 1ON6A 2YQJA 2AM3A 1G97A 4P00A 4D0ZA 4D11A 3DJ4A 5AJNA 1ZJ0A 5EJZA 5C4EA 2W0VA 1MP4A 1VZUA 1TW1A 2RJ6A 5C38A 5C4BA 1ZI5A 3CGXA 1H3MA 5FYEA 2VSIA 1H7EA 1NHEB 3KIAA 5DDTA 3K8DA 2FY7A 3V0OA 4IRPA 1HM9A 4L41C 3U2WA 3IOHA 2O1HA 3TQDA 2Y4LA 3V0LA 5CMFX 4B2WA 2AGDA 2QKXA 1H5RA 1S4NA 2MZBA 1H4DA 2OEGA 5C1GA 3BCVA 3N9WA 4EEGA 4FCUA 2FFUA 3I0GA 2RIXA 5IDTA 3SXEA 3CKNA 1KWSA 1NF5B 3PKQA 1HJLA 1ZJ2A 2VS3A 2I7BA 3I0HA 5L6VA 1YP2A 4G3PA 3I0FA 3T7NA 1NQIB 4Y6UA 3T7MA 3ZGGA 3SXAA 1FXOA 2Y4JA 2APCA 3D5NA 3RMVA 2BO6A 1PZYB 1G1LA 3BRKX 2VXLA 4C2SA 2JCOA 1INJA 1G0RA 1ON8A 2WE9A 4HO2A 4P02A 5CQMX 3U2VA 4B42A 1ZCYA 2XWMA 1FOAA 5J49A 2AM5A 2YC5A 3V90A 2GGQA 1H7TA 3O3PA 3ZGFA 4BQHA 1XZ6A 4CJBA 1H7HA 5IFYA 4B5BA 1ZDGA 1H5TB 4HO0A 2Z87A 3U2UA 5FV9A 1H7QA 3U0YA 5C8RA 3SPTA 1MP5A 2OI5A 1NMMB 4HO3A 5IDSA 1IINA 4FRPA 1G95A 2VS4A 3JUJA 1TVYA 2AESA 1FR8A 5C4FA 4NAIA 4NANA 1QG8A 2AE7A 4B3UA 1FZWA 1V82A 3I0JA 2FFVA 3R2WA 5BXCA 3I0LA 1EYRA 2GGOA 3F1CA 2RJ5A 5AJPA 1G93A 5CQNX 1GWVA 4FCEA 2OI7A 1JV3A 2O1GA 4D0TA 3RMWA 4JD0A 1LL3A 4E1KA 4ASYA 1SS9A 3CKOA 2RJ4A 5FTSA 3PNNA 1R7VA 1JYLA 1WVCA 4ASJA 2JCKA 4CJCA 1ZCUA 4KC2A 1I52A 4AYJA 2PGVA
chains in the Genus database with same CATH superfamily
1R80A 4NALA 1LL2A 3USRA 2X65A 1PZTA 1GX4A 1R7YA 4NAKA 5FUHA 1H5SC 4HO9A 3USQA 5C4DA 4FRLA 5EIYA 1O7QA 1QGSA 1ZDFA 2FYAA 2J0BA 4G3SA 3POLA 3V91A 3F1YA 3PKPA 3V0PA 2YQCA 1NWGB 2P72A 2Y4MA 1IIMA 1LL0A 3JUKA 1HM0A 5CQPA 4EVWA 1JYKA 4FQWA 3HL3A 4Y63A 2PGYA 1JVGA 4B4BA 5FU8A 4EEAA 4HCQA 3U0XA 5L6SA 2P6WA 4HOCA 4KNRA 2C0NA 2VD4A 2BO8A 4FIXA 1GQCA 1GX0A 3Q7UA 1WT2A 4Y7TA 4M2AA 4Y6NA 1LZ0A 2Y7AA 4CVHA 2XMEA 1G2VA 1O23B 1R7TA 1H5SA 4R7PA 5CQOA 4EEOA 1TW5A 2VXMA 3SXBA 1YP4A 1ZCTA 3I0DA 2V0LA 3DUVA 3SX5A 1ZI3A 2I5KA 4MIXA 2A8UA 2QH5A 1HV9A 1S4PA 1W55A 4K6RA 5C3BA 1WT1A 4MNDA 1ZJOA 2RIYA 2V0JA 1GWWA 4O6MA 3ZF8A 4EEMA 2V0KA 4M2BA 5C49A 1VICA 3ZLKA 5I1FA 5D91A 4AYLA 4B2XA 3OC9A 1OMXA 4KPXA 3OH4A 2WGZA 4FRAA 3V8YA 3OH2A 1R7UA 2UX8A 1ZHJA 2OI6A 1W57A 3I0CA 3U2XA 2VK9A 4ARWA 1H5RB 5EJ1A 2V0HA 2P73A 1VPAA 1O0RA 3EE5A 2E3DA 3GUEA 2PX7A 4MYBA 3SX7A 2ZU8A 2VFZA 1ZJ3A 5CQLX 4DECA 1NKHB 1H4EA 3K8EA 1MC3A 1HJJA 4HG6A 1H7FA 4HO6A 4ECMA 3OH1A 3SXGA 2Y4KA 3ZLLA 2E8BA 4FRBA 2X60A 1HM8A 2Q4JA 3I0KA 2Y6PA 1FXJA 4B4MA 1ZIZA 3CKQA 5C3AA 2DPWA 2RITA 3IOJA 5CMGX 2AH9A 2BO7A 1V83A 2FYBA 5HS2A 3NGWA 5C48A 1JV1A 2QGIA 3SXDA 2YC3A 1VGWA 1ZI4A 2FYCB 4YS8A 1LZJA 1FR9A 4Y7VA 3D98A 3R3IA 5CMJA 1LZIA 1WT3A 5FU0A 2ICXA 2YQHA 1YROB 3E26A 3OAMA 3V8ZA 1QGQA 2D0JA 4Y7UA 1G9RA 2CU2A 3CKJA 4UEGA 1TZFA 1VZXA 1Z90A 2RJ9A 4IRQA 2WVLA 2RJ1A 1MP3A 4Y62A 3FWWA 3I0EA 1G23A 3OGZA 4O6NA 3SXCA 1WT0A 2O1FA 4FRMA 2BO4A 1OQMB 2RJ7A 1LVWA 4M4KA 1K4VA 1R81A 4FRQA 4KC1A 1YP3A 1QWJA 4D48A 2ZU7A 1GA8A 1H4CA 2Z86A 3JTJA 4GBPA 4KT7A 5CMIA 3V0QA 1H7LA 1O7OA 3OH3A 1INIA 2XWNA 4FRHA 1H5TA 3E25A 3OH0A 4BMAA 1OMZA 4EE5A 1VGTA 5C47A 5AJOA 1VGZA 3IOIA 4DDZA 3D8VA 2X5ZA 3CU0A 1LZ7A 4FREA 2JCLA 4HO8A 4DE7A 2VS5A 2YCMA 4B4GA 3Q4SA 2RJ8A 3SX8A 1E5KA 2ICYA 1VGUA 4Y64A 1ZJ1A 4JISA 2WEEA 3DK5A 3FOQA 3T7OA 2YQSA 1FWYA 1H5SD 4EE4A 1VZTA 5CMHA 2I5EA 3QVBA 5FTVA 1VH3A 2ZU9A 4G87A 2YESA 2V0IA 1VM8A 2D7IA 1H7GA 2J0AA 1H5SB 2A8WA 4EE3A 4HO4A 5C3DA 1FG5N 2RIZA 4G3QA 4KNXA 5JQQA 4Y9XA 2WAWA 4CJ8A 4KQLA 5C4CA 4J18A 3SX3A 1VH1A 2OEFA 4KXOA 3V0MA 4XWIA 4Y7GA 1V84A 3ST8A 1R82A 1R7XA 4HO5A 1XHBA 4FIYA 4Y7FA 1FRWA 5DDVA 2D7RA 1ZI1A 1FGGA 5D92A 3OKRA 3Q80A 2VSHA 2X5SA 4AAWA 4FRDA 4D11C 1FGXA 3RSBA 2AECA 1WSZA 2FYDB 1G8OA 1ZCVA 1EZIA 1W77A 4LW3A 4AC3A 2NXVA 5C36A 1ZJPA 2XMHA 1JVDA 1G3LA 4KC4A 1GQ9A 4M28A 3V0NA 3TZTA 4KRVA 2RJ0A 4ZDQA 1S4OA 1FO9A 2WVKA 3CKVA 4LW6A 3LW6A 2W0WA 5C1HA 1FO8A 2PA4A 2XWLA 2AM4A 3I0IX 4KPZA 5C1LA 2JCJA 2WVMA 4FROA 3U2TA 1ON6A 2YQJA 2AM3A 1G97A 4P00A 4D0ZA 4D11A 3DJ4A 5AJNA 1ZJ0A 5EJZA 5C4EA 2W0VA 1MP4A 1VZUA 1TW1A 2RJ6A 5C38A 5C4BA 1ZI5A 3CGXA 1H3MA 5FYEA 2VSIA 1H7EA 1NHEB 3KIAA 5DDTA 3K8DA 2FY7A 3V0OA 4IRPA 1HM9A 4L41C 3U2WA 3IOHA 2O1HA 3TQDA 2Y4LA 3V0LA 5CMFX 4B2WA 2AGDA 2QKXA 1H5RA 1S4NA 2MZBA 1H4DA 2OEGA 5C1GA 3BCVA 3N9WA 4EEGA 4FCUA 2FFUA 3I0GA 2RIXA 5IDTA 3SXEA 3CKNA 1KWSA 1NF5B 3PKQA 1HJLA 1ZJ2A 2VS3A 2I7BA 3I0HA 5L6VA 1YP2A 4G3PA 3I0FA 3T7NA 1NQIB 4Y6UA 3T7MA 4Q7CA 3ZGGA 3SXAA 1FXOA 2Y4JA 2APCA 3D5NA 3RMVA 2BO6A 1PZYB 1G1LA 3BRKX 2VXLA 4C2SA 2JCOA 1INJA 1G0RA 1ON8A 2WE9A 4HO2A 4P02A 5CQMX 3U2VA 4B42A 1ZCYA 2XWMA 1FOAA 5J49A 2AM5A 2YC5A 3V90A 2GGQA 1H7TA 3O3PA 3ZGFA 4BQHA 1XZ6A 4CJBA 1H7HA 5IFYA 4B5BA 1ZDGA 1H5TB 4HO0A 2Z87A 3U2UA 5FV9A 1H7QA 3U0YA 5C8RA 3SPTA 1MP5A 2OI5A 1NMMB 4HO3A 5IDSA 1IINA 4FRPA 1G95A 2VS4A 3JUJA 1TVYA 2AESA 1FR8A 5C4FA 4NAIA 4NANA 1QG8A 2AE7A 4B3UA 1FZWA 1V82A 3I0JA 2FFVA 3R2WA 5BXCA 3I0LA 1EYRA 2GGOA 3F1CA 2RJ5A 5AJPA 1G93A 5CQNX 1GWVA 4FCEA 2OI7A 1JV3A 2O1GA 4D0TA 3RMWA 4JD0A 1LL3A 4E1KA 4ASYA 1SS9A 3CKOA 2RJ4A 5FTSA 3PNNA 1R7VA 1JYLA 1WVCA 4ASJA 2JCKA 4CJCA 1ZCUA 4KC2A 1I52A 4AYJA 2PGVA
chains in the Genus database with same CATH topology
1R80A 4NALA 1LL2A 3USRA 2X65A 1PZTA 1GX4A 1R7YA 4NAKA 5FUHA 1H5SC 4HO9A 3USQA 5C4DA 4FRLA 5EIYA 1O7QA 1QGSA 1ZDFA 2FYAA 2J0BA 4G3SA 3POLA 3V91A 3F1YA 3PKPA 3V0PA 2YQCA 1NWGB 2P72A 2Y4MA 1IIMA 1LL0A 3JUKA 1HM0A 5CQPA 4EVWA 1JYKA 4FQWA 3HL3A 4Y63A 2PGYA 1JVGA 4B4BA 5FU8A 4EEAA 4HCQA 3U0XA 5L6SA 2P6WA 4HOCA 4KNRA 2C0NA 2VD4A 2BO8A 4FIXA 1GQCA 1GX0A 3Q7UA 1WT2A 4Y7TA 4M2AA 4Y6NA 1LZ0A 2Y7AA 4CVHA 2XMEA 1G2VA 1O23B 1R7TA 1H5SA 4R7PA 5CQOA 4EEOA 1TW5A 2VXMA 3SXBA 1YP4A 1ZCTA 3I0DA 2V0LA 3DUVA 3SX5A 1ZI3A 2I5KA 4MIXA 2A8UA 2QH5A 1HV9A 1S4PA 1W55A 4K6RA 5C3BA 1WT1A 4MNDA 1ZJOA 2RIYA 2V0JA 1GWWA 4O6MA 3ZF8A 4EEMA 2V0KA 4M2BA 5C49A 1VICA 3ZLKA 5I1FA 5D91A 4AYLA 4B2XA 3OC9A 1OMXA 4KPXA 3OH4A 2WGZA 4FRAA 3V8YA 3OH2A 1R7UA 2UX8A 1ZHJA 2OI6A 1W57A 3I0CA 3U2XA 2VK9A 4ARWA 1H5RB 5EJ1A 2V0HA 2P73A 1VPAA 1O0RA 3EE5A 2E3DA 3GUEA 2PX7A 4MYBA 3SX7A 2ZU8A 2VFZA 1ZJ3A 5CQLX 4DECA 1NKHB 1H4EA 3K8EA 1MC3A 1HJJA 4HG6A 1H7FA 4HO6A 4ECMA 3OH1A 3SXGA 2Y4KA 3ZLLA 2E8BA 4FRBA 2X60A 1HM8A 2Q4JA 3I0KA 2Y6PA 1FXJA 4B4MA 1ZIZA 3CKQA 5C3AA 2DPWA 2RITA 3IOJA 5CMGX 2AH9A 2BO7A 1V83A 2FYBA 5HS2A 3NGWA 5C48A 1JV1A 2QGIA 3SXDA 2YC3A 1VGWA 1ZI4A 2FYCB 4YS8A 1LZJA 1FR9A 4Y7VA 3D98A 3R3IA 5CMJA 1LZIA 1WT3A 5FU0A 2ICXA 2YQHA 1YROB 3E26A 3OAMA 3V8ZA 1QGQA 2D0JA 4Y7UA 1G9RA 2CU2A 3CKJA 4UEGA 1TZFA 1VZXA 1Z90A 2RJ9A 4IRQA 2WVLA 2RJ1A 1MP3A 4Y62A 3FWWA 3I0EA 1G23A 3OGZA 4O6NA 3SXCA 1WT0A 2O1FA 4FRMA 2BO4A 1OQMB 2RJ7A 1LVWA 4M4KA 1K4VA 1R81A 4FRQA 4KC1A 1YP3A 1QWJA 4D48A 2ZU7A 1GA8A 1H4CA 2Z86A 3JTJA 4GBPA 4KT7A 5CMIA 3V0QA 1H7LA 1O7OA 3OH3A 1INIA 2XWNA 4FRHA 1H5TA 3E25A 3OH0A 4BMAA 1OMZA 4EE5A 1VGTA 5C47A 5AJOA 1VGZA 3IOIA 4DDZA 3D8VA 2X5ZA 3CU0A 1LZ7A 4FREA 2JCLA 4HO8A 4DE7A 2VS5A 2YCMA 4B4GA 3Q4SA 2RJ8A 3SX8A 1E5KA 2ICYA 1VGUA 4Y64A 1ZJ1A 4JISA 2WEEA 3DK5A 3FOQA 3T7OA 2YQSA 1FWYA 1H5SD 4EE4A 1VZTA 5CMHA 2I5EA 3QVBA 5FTVA 1VH3A 2ZU9A 4G87A 2YESA 2V0IA 1VM8A 2D7IA 1H7GA 2J0AA 1H5SB 2A8WA 4EE3A 4HO4A 5C3DA 1FG5N 2RIZA 4G3QA 4KNXA 5JQQA 4Y9XA 2WAWA 4CJ8A 4KQLA 5C4CA 4J18A 3SX3A 1VH1A 2OEFA 4KXOA 3V0MA 4XWIA 4Y7GA 1V84A 3ST8A 1R82A 1R7XA 4HO5A 1XHBA 4FIYA 4Y7FA 1FRWA 5DDVA 2D7RA 1ZI1A 1FGGA 5D92A 3OKRA 3Q80A 2VSHA 2X5SA 4AAWA 4FRDA 4D11C 1FGXA 3RSBA 2AECA 1WSZA 2FYDB 1G8OA 1ZCVA 1EZIA 1W77A 4LW3A 4AC3A 2NXVA 5C36A 1ZJPA 2XMHA 1JVDA 1G3LA 4KC4A 1GQ9A 4M28A 3V0NA 3TZTA 4KRVA 2RJ0A 4ZDQA 1S4OA 1FO9A 2WVKA 3CKVA 4LW6A 3LW6A 2W0WA 5C1HA 1FO8A 2PA4A 2XWLA 2AM4A 3I0IX 4KPZA 5C1LA 2JCJA 2WVMA 4FROA 3U2TA 1ON6A 2YQJA 2AM3A 1G97A 4P00A 4D0ZA 4D11A 3DJ4A 5AJNA 1ZJ0A 5EJZA 5C4EA 2W0VA 1MP4A 1VZUA 1TW1A 2RJ6A 5C38A 5C4BA 1ZI5A 3CGXA 1H3MA 5FYEA 2VSIA 1H7EA 1NHEB 3KIAA 5DDTA 3K8DA 2FY7A 3V0OA 4IRPA 1HM9A 4L41C 3U2WA 3IOHA 2O1HA 3TQDA 2Y4LA 3V0LA 5CMFX 4B2WA 2AGDA 2QKXA 1H5RA 1S4NA 2MZBA 1H4DA 2OEGA 5C1GA 3BCVA 3N9WA 4EEGA 4FCUA 2FFUA 3I0GA 2RIXA 5IDTA 3SXEA 3CKNA 1KWSA 1NF5B 3PKQA 1HJLA 1ZJ2A 2VS3A 2I7BA 3I0HA 5L6VA 1YP2A 4G3PA 3I0FA 3T7NA 1NQIB 4Y6UA 3T7MA 4Q7CA 3ZGGA 3SXAA 1FXOA 2Y4JA 2APCA 3D5NA 3RMVA 2BO6A 1PZYB 1G1LA 3BRKX 2VXLA 4C2SA 2JCOA 1INJA 1G0RA 1ON8A 2WE9A 4HO2A 4P02A 5CQMX 3U2VA 4B42A 1ZCYA 2XWMA 1FOAA 5J49A 2AM5A 2YC5A 3V90A 2GGQA 1H7TA 3O3PA 3ZGFA 4BQHA 1XZ6A 4CJBA 1H7HA 5IFYA 4B5BA 1ZDGA 1H5TB 4HO0A 2Z87A 3U2UA 5FV9A 1H7QA 3U0YA 5C8RA 3SPTA 1MP5A 2OI5A 1NMMB 4HO3A 5IDSA 1IINA 4FRPA 1G95A 2VS4A 3JUJA 1TVYA 2AESA 1FR8A 5C4FA 4NAIA 4NANA 1QG8A 2AE7A 4B3UA 1FZWA 1V82A 3I0JA 2FFVA 3R2WA 5BXCA 3I0LA 1EYRA 2GGOA 3F1CA 2RJ5A 5AJPA 1G93A 5CQNX 1GWVA 4FCEA 2OI7A 1JV3A 2O1GA 4D0TA 3RMWA 4JD0A 1LL3A 4E1KA 4ASYA 1SS9A 3CKOA 2RJ4A 5FTSA 3PNNA 1R7VA 1JYLA 1WVCA 4ASJA 2JCKA 4CJCA 1ZCUA 4KC2A 1I52A 4AYJA 2PGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R80 A;  4NAL A;  1LL2 A;  3USR A;  2X65 A;  1PZT A;  1GX4 A;  1R7Y A;  4NAK A;  5FUH A;  1H5S C;  4HO9 A;  3USQ A;  5C4D A;  4FRL A;  5EIY A;  1O7Q A;  1QGS A;  1ZDF A;  2FYA A;  4G3S A;  3POL A;  3V91 A;  3F1Y A;  3PKP A;  3V0P A;  2YQC A;  1NWG B;  2P72 A;  2Y4M A;  1IIM A;  1LL0 A;  3JUK A;  1HM0 A;  5CQP A;  4EVW A;  1JYK A;  4FQW A;  3HL3 A;  4Y63 A;  2PGY A;  1JVG A;  4B4B A;  5FU8 A;  4EEA A;  4HCQ A;  3U0X A;  5L6S A;  2P6W A;  4HOC A;  4KNR A;  2VD4 A;  2BO8 A;  1GQC A;  1GX0 A;  3Q7U A;  1WT2 A;  4Y7T A;  4M2A A;  4Y6N A;  1LZ0 A;  2Y7A A;  4CVH A;  2XME A;  1G2V A;  1O23 B;  1R7T A;  1H5S A;  4R7P A;  5CQO A;  4EEO A;  1TW5 A;  2VXM A;  3SXB A;  1YP4 A;  1ZCT A;  3I0D A;  2V0L A;  3DUV A;  3SX5 A;  1ZI3 A;  2I5K A;  2A8U A;  2QH5 A;  1HV9 A;  1S4P A;  1W55 A;  4K6R A;  5C3B A;  1WT1 A;  4MND A;  1ZJO A;  2RIY A;  2V0J A;  1GWW A;  3ZF8 A;  4EEM A;  2V0K A;  4M2B A;  5C49 A;  1VIC A;  3ZLK A;  5I1F A;  4AYL A;  4B2X A;  3OC9 A;  1OMX A;  4KPX A;  3OH4 A;  2WGZ A;  4FRA A;  3V8Y A;  3OH2 A;  1R7U A;  2UX8 A;  1ZHJ A;  2OI6 A;  1W57 A;  3I0C A;  3U2X A;  4ARW A;  1H5R B;  5EJ1 A;  2V0H A;  2P73 A;  1VPA A;  1O0R A;  3EE5 A;  2E3D A;  3GUE A;  2PX7 A;  4MYB A;  3SX7 A;  2ZU8 A;  2VFZ A;  1ZJ3 A;  5CQL X;  4DEC A;  1NKH B;  1H4E A;  3K8E A;  1MC3 A;  1HJJ A;  4HG6 A;  1H7F A;  4HO6 A;  4ECM A;  3OH1 A;  3SXG A;  2Y4K A;  3ZLL A;  2E8B A;  4FRB A;  2X60 A;  1HM8 A;  2Q4J A;  3I0K A;  2Y6P A;  1FXJ A;  4B4M A;  1ZIZ A;  3CKQ A;  5C3A A;  2DPW A;  2RIT A;  3IOJ A;  5CMG X;  2AH9 A;  2BO7 A;  1V83 A;  2FYB A;  5HS2 A;  3NGW A;  5C48 A;  1JV1 A;  2QGI A;  3SXD A;  2YC3 A;  1VGW A;  1ZI4 A;  2FYC B;  4YS8 A;  1LZJ A;  1FR9 A;  4Y7V A;  3D98 A;  3R3I A;  5CMJ A;  1LZI A;  1WT3 A;  5FU0 A;  2ICX A;  2YQH A;  1YRO B;  3E26 A;  3OAM A;  3V8Z A;  1QGQ A;  2D0J A;  4Y7U A;  1G9R A;  2CU2 A;  3CKJ A;  4UEG A;  1TZF A;  1VZX A;  1Z90 A;  2RJ9 A;  4IRQ A;  2WVL A;  2RJ1 A;  1MP3 A;  4Y62 A;  3FWW A;  3I0E A;  1G23 A;  3OGZ A;  3SXC A;  1WT0 A;  2O1F A;  4FRM A;  2BO4 A;  1OQM B;  2RJ7 A;  1LVW A;  4M4K A;  1K4V A;  1R81 A;  4FRQ A;  4KC1 A;  1YP3 A;  1QWJ A;  4D48 A;  2ZU7 A;  1GA8 A;  1H4C A;  2Z86 A;  3JTJ A;  4GBP A;  4KT7 A;  5CMI A;  3V0Q A;  1H7L A;  1O7O A;  3OH3 A;  1INI A;  2XWN A;  4FRH A;  1H5T A;  3E25 A;  3OH0 A;  4BMA A;  1OMZ A;  4EE5 A;  1VGT A;  5C47 A;  5AJO A;  1VGZ A;  3IOI A;  4DDZ A;  3D8V A;  2X5Z A;  3CU0 A;  1LZ7 A;  4FRE A;  2JCL A;  4HO8 A;  4DE7 A;  2VS5 A;  2YCM A;  4B4G A;  3Q4S A;  2RJ8 A;  3SX8 A;  1E5K A;  2ICY A;  1VGU A;  4Y64 A;  1ZJ1 A;  4JIS A;  2WEE A;  3DK5 A;  3FOQ A;  3T7O A;  2YQS A;  1FWY A;  1H5S D;  4EE4 A;  1VZT A;  5CMH A;  2I5E A;  3QVB A;  5FTV A;  1VH3 A;  2ZU9 A;  4G87 A;  2YES A;  2V0I A;  1VM8 A;  2D7I A;  1H7G A;  1H5S B;  2A8W A;  4EE3 A;  4HO4 A;  5C3D A;  1FG5 N;  2RIZ A;  4G3Q A;  4KNX A;  5JQQ A;  4Y9X A;  2WAW A;  4CJ8 A;  4KQL A;  5C4C A;  4J18 A;  3SX3 A;  1VH1 A;  2OEF A;  4KXO A;  3V0M A;  4XWI A;  4Y7G A;  1V84 A;  3ST8 A;  1R82 A;  1R7X A;  4HO5 A;  1XHB A;  4Y7F A;  1FRW A;  5DDV A;  2D7R A;  1ZI1 A;  1FGG A;  3OKR A;  3Q80 A;  2VSH A;  2X5S A;  4AAW A;  4FRD A;  4D11 C;  1FGX A;  3RSB A;  2AEC A;  1WSZ A;  2FYD B;  1G8O A;  1ZCV A;  1EZI A;  1W77 A;  4LW3 A;  4AC3 A;  2NXV A;  5C36 A;  1ZJP A;  2XMH A;  1JVD A;  1G3L A;  4KC4 A;  1GQ9 A;  4M28 A;  3V0N A;  3TZT A;  4KRV A;  2RJ0 A;  4ZDQ A;  1S4O A;  1FO9 A;  2WVK A;  3CKV A;  4LW6 A;  3LW6 A;  2W0W A;  5C1H A;  1FO8 A;  2PA4 A;  2XWL A;  2AM4 A;  3I0I X;  4KPZ A;  5C1L A;  2JCJ A;  2WVM A;  4FRO A;  3U2T A;  1ON6 A;  2YQJ A;  2AM3 A;  1G97 A;  4P00 A;  4D0Z A;  4D11 A;  3DJ4 A;  5AJN A;  1ZJ0 A;  5EJZ A;  5C4E A;  2W0V A;  1MP4 A;  1VZU A;  1TW1 A;  2RJ6 A;  5C38 A;  5C4B A;  1ZI5 A;  3CGX A;  1H3M A;  5FYE A;  2VSI A;  1H7E A;  1NHE B;  3KIA A;  5DDT A;  3K8D A;  2FY7 A;  3V0O A;  4IRP A;  1HM9 A;  4L41 C;  3U2W A;  3IOH A;  2O1H A;  3TQD A;  2Y4L A;  3V0L A;  5CMF X;  4B2W A;  2AGD A;  2QKX A;  1H5R A;  1S4N A;  2MZB A;  1H4D A;  2OEG A;  5C1G A;  3BCV A;  3N9W A;  4EEG A;  4FCU A;  2FFU A;  3I0G A;  2RIX A;  5IDT A;  3SXE A;  3CKN A;  1KWS A;  1NF5 B;  3PKQ A;  1HJL A;  1ZJ2 A;  2VS3 A;  2I7B A;  3I0H A;  5L6V A;  1YP2 A;  4G3P A;  3I0F A;  3T7N A;  1NQI B;  4Y6U A;  3T7M A;  3ZGG A;  3SXA A;  1FXO A;  2Y4J A;  2APC A;  3D5N A;  3RMV A;  2BO6 A;  1PZY B;  1G1L A;  3BRK X;  2VXL A;  4C2S A;  2JCO A;  1INJ A;  1G0R A;  1ON8 A;  2WE9 A;  4HO2 A;  4P02 A;  5CQM X;  3U2V A;  4B42 A;  1ZCY A;  2XWM A;  1FOA A;  5J49 A;  2AM5 A;  2YC5 A;  3V90 A;  2GGQ A;  1H7T A;  3O3P A;  3ZGF A;  4BQH A;  1XZ6 A;  4CJB A;  1H7H A;  5IFY A;  4B5B A;  1ZDG A;  1H5T B;  4HO0 A;  2Z87 A;  3U2U A;  5FV9 A;  1H7Q A;  3U0Y A;  5C8R A;  3SPT A;  1MP5 A;  2OI5 A;  1NMM B;  4HO3 A;  5IDS A;  1IIN A;  4FRP A;  1G95 A;  2VS4 A;  3JUJ A;  1TVY A;  2AES A;  1FR8 A;  5C4F A;  4NAI A;  4NAN A;  1QG8 A;  2AE7 A;  4B3U A;  1FZW A;  1V82 A;  3I0J A;  2FFV A;  3R2W A;  5BXC A;  3I0L A;  1EYR A;  2GGO A;  3F1C A;  2RJ5 A;  5AJP A;  1G93 A;  5CQN X;  1GWV A;  4FCE A;  2OI7 A;  1JV3 A;  2O1G A;  4D0T A;  3RMW A;  4JD0 A;  1LL3 A;  4E1K A;  4ASY A;  1SS9 A;  3CKO A;  2RJ4 A;  5FTS A;  3PNN A;  1R7V A;  1JYL A;  1WVC A;  4ASJ A;  2JCK A;  4CJC A;  1ZCU A;  4KC2 A;  1I52 A;  4AYJ A;  2PGV A; 
#chains in the Genus database with same CATH topology
 1R80 A;  4NAL A;  1LL2 A;  3USR A;  2X65 A;  1PZT A;  1GX4 A;  1R7Y A;  4NAK A;  5FUH A;  1H5S C;  4HO9 A;  3USQ A;  5C4D A;  4FRL A;  5EIY A;  1O7Q A;  1QGS A;  1ZDF A;  2FYA A;  2J0B A;  4G3S A;  3POL A;  3V91 A;  3F1Y A;  3PKP A;  3V0P A;  2YQC A;  1NWG B;  2P72 A;  2Y4M A;  1IIM A;  1LL0 A;  3JUK A;  1HM0 A;  5CQP A;  4EVW A;  1JYK A;  4FQW A;  3HL3 A;  4Y63 A;  2PGY A;  1JVG A;  4B4B A;  5FU8 A;  4EEA A;  4HCQ A;  3U0X A;  5L6S A;  2P6W A;  4HOC A;  4KNR A;  2C0N A;  2VD4 A;  2BO8 A;  4FIX A;  1GQC A;  1GX0 A;  3Q7U A;  1WT2 A;  4Y7T A;  4M2A A;  4Y6N A;  1LZ0 A;  2Y7A A;  4CVH A;  2XME A;  1G2V A;  1O23 B;  1R7T A;  1H5S A;  4R7P A;  5CQO A;  4EEO A;  1TW5 A;  2VXM A;  3SXB A;  1YP4 A;  1ZCT A;  3I0D A;  2V0L A;  3DUV A;  3SX5 A;  1ZI3 A;  2I5K A;  4MIX A;  2A8U A;  2QH5 A;  1HV9 A;  1S4P A;  1W55 A;  4K6R A;  5C3B A;  1WT1 A;  4MND A;  1ZJO A;  2RIY A;  2V0J A;  1GWW A;  4O6M A;  3ZF8 A;  4EEM A;  2V0K A;  4M2B A;  5C49 A;  1VIC A;  3ZLK A;  5I1F A;  5D91 A;  4AYL A;  4B2X A;  3OC9 A;  1OMX A;  4KPX A;  3OH4 A;  2WGZ A;  4FRA A;  3V8Y A;  3OH2 A;  1R7U A;  2UX8 A;  1ZHJ A;  2OI6 A;  1W57 A;  3I0C A;  3U2X A;  2VK9 A;  4ARW A;  1H5R B;  5EJ1 A;  2V0H A;  2P73 A;  1VPA A;  1O0R A;  3EE5 A;  2E3D A;  3GUE A;  2PX7 A;  4MYB A;  3SX7 A;  2ZU8 A;  2VFZ A;  1ZJ3 A;  5CQL X;  4DEC A;  1NKH B;  1H4E A;  3K8E A;  1MC3 A;  1HJJ A;  4HG6 A;  1H7F A;  4HO6 A;  4ECM A;  3OH1 A;  3SXG A;  2Y4K A;  3ZLL A;  2E8B A;  4FRB A;  2X60 A;  1HM8 A;  2Q4J A;  3I0K A;  2Y6P A;  1FXJ A;  4B4M A;  1ZIZ A;  3CKQ A;  5C3A A;  2DPW A;  2RIT A;  3IOJ A;  5CMG X;  2AH9 A;  2BO7 A;  1V83 A;  2FYB A;  5HS2 A;  3NGW A;  5C48 A;  1JV1 A;  2QGI A;  3SXD A;  2YC3 A;  1VGW A;  1ZI4 A;  2FYC B;  4YS8 A;  1LZJ A;  1FR9 A;  4Y7V A;  3D98 A;  3R3I A;  5CMJ A;  1LZI A;  1WT3 A;  5FU0 A;  2ICX A;  2YQH A;  1YRO B;  3E26 A;  3OAM A;  3V8Z A;  1QGQ A;  2D0J A;  4Y7U A;  1G9R A;  2CU2 A;  3CKJ A;  4UEG A;  1TZF A;  1VZX A;  1Z90 A;  2RJ9 A;  4IRQ A;  2WVL A;  2RJ1 A;  1MP3 A;  4Y62 A;  3FWW A;  3I0E A;  1G23 A;  3OGZ A;  4O6N A;  3SXC A;  1WT0 A;  2O1F A;  4FRM A;  2BO4 A;  1OQM B;  2RJ7 A;  1LVW A;  4M4K A;  1K4V A;  1R81 A;  4FRQ A;  4KC1 A;  1YP3 A;  1QWJ A;  4D48 A;  2ZU7 A;  1GA8 A;  1H4C A;  2Z86 A;  3JTJ A;  4GBP A;  4KT7 A;  5CMI A;  3V0Q A;  1H7L A;  1O7O A;  3OH3 A;  1INI A;  2XWN A;  4FRH A;  1H5T A;  3E25 A;  3OH0 A;  4BMA A;  1OMZ A;  4EE5 A;  1VGT A;  5C47 A;  5AJO A;  1VGZ A;  3IOI A;  4DDZ A;  3D8V A;  2X5Z A;  3CU0 A;  1LZ7 A;  4FRE A;  2JCL A;  4HO8 A;  4DE7 A;  2VS5 A;  2YCM A;  4B4G A;  3Q4S A;  2RJ8 A;  3SX8 A;  1E5K A;  2ICY A;  1VGU A;  4Y64 A;  1ZJ1 A;  4JIS A;  2WEE A;  3DK5 A;  3FOQ A;  3T7O A;  2YQS A;  1FWY A;  1H5S D;  4EE4 A;  1VZT A;  5CMH A;  2I5E A;  3QVB A;  5FTV A;  1VH3 A;  2ZU9 A;  4G87 A;  2YES A;  2V0I A;  1VM8 A;  2D7I A;  1H7G A;  2J0A A;  1H5S B;  2A8W A;  4EE3 A;  4HO4 A;  5C3D A;  1FG5 N;  2RIZ A;  4G3Q A;  4KNX A;  5JQQ A;  4Y9X A;  2WAW A;  4CJ8 A;  4KQL A;  5C4C A;  4J18 A;  3SX3 A;  1VH1 A;  2OEF A;  4KXO A;  3V0M A;  4XWI A;  4Y7G A;  1V84 A;  3ST8 A;  1R82 A;  1R7X A;  4HO5 A;  1XHB A;  4FIY A;  4Y7F A;  1FRW A;  5DDV A;  2D7R A;  1ZI1 A;  1FGG A;  5D92 A;  3OKR A;  3Q80 A;  2VSH A;  2X5S A;  4AAW A;  4FRD A;  4D11 C;  1FGX A;  3RSB A;  2AEC A;  1WSZ A;  2FYD B;  1G8O A;  1ZCV A;  1EZI A;  1W77 A;  4LW3 A;  4AC3 A;  2NXV A;  5C36 A;  1ZJP A;  2XMH A;  1JVD A;  1G3L A;  4KC4 A;  1GQ9 A;  4M28 A;  3V0N A;  3TZT A;  4KRV A;  2RJ0 A;  4ZDQ A;  1S4O A;  1FO9 A;  2WVK A;  3CKV A;  4LW6 A;  3LW6 A;  2W0W A;  5C1H A;  1FO8 A;  2PA4 A;  2XWL A;  2AM4 A;  3I0I X;  4KPZ A;  5C1L A;  2JCJ A;  2WVM A;  4FRO A;  3U2T A;  1ON6 A;  2YQJ A;  2AM3 A;  1G97 A;  4P00 A;  4D0Z A;  4D11 A;  3DJ4 A;  5AJN A;  1ZJ0 A;  5EJZ A;  5C4E A;  2W0V A;  1MP4 A;  1VZU A;  1TW1 A;  2RJ6 A;  5C38 A;  5C4B A;  1ZI5 A;  3CGX A;  1H3M A;  5FYE A;  2VSI A;  1H7E A;  1NHE B;  3KIA A;  5DDT A;  3K8D A;  2FY7 A;  3V0O A;  4IRP A;  1HM9 A;  4L41 C;  3U2W A;  3IOH A;  2O1H A;  3TQD A;  2Y4L A;  3V0L A;  5CMF X;  4B2W A;  2AGD A;  2QKX A;  1H5R A;  1S4N A;  2MZB A;  1H4D A;  2OEG A;  5C1G A;  3BCV A;  3N9W A;  4EEG A;  4FCU A;  2FFU A;  3I0G A;  2RIX A;  5IDT A;  3SXE A;  3CKN A;  1KWS A;  1NF5 B;  3PKQ A;  1HJL A;  1ZJ2 A;  2VS3 A;  2I7B A;  3I0H A;  5L6V A;  1YP2 A;  4G3P A;  3I0F A;  3T7N A;  1NQI B;  4Y6U A;  3T7M A;  4Q7C A;  3ZGG A;  3SXA A;  1FXO A;  2Y4J A;  2APC A;  3D5N A;  3RMV A;  2BO6 A;  1PZY B;  1G1L A;  3BRK X;  2VXL A;  4C2S A;  2JCO A;  1INJ A;  1G0R A;  1ON8 A;  2WE9 A;  4HO2 A;  4P02 A;  5CQM X;  3U2V A;  4B42 A;  1ZCY A;  2XWM A;  1FOA A;  5J49 A;  2AM5 A;  2YC5 A;  3V90 A;  2GGQ A;  1H7T A;  3O3P A;  3ZGF A;  4BQH A;  1XZ6 A;  4CJB A;  1H7H A;  5IFY A;  4B5B A;  1ZDG A;  1H5T B;  4HO0 A;  2Z87 A;  3U2U A;  5FV9 A;  1H7Q A;  3U0Y A;  5C8R A;  3SPT A;  1MP5 A;  2OI5 A;  1NMM B;  4HO3 A;  5IDS A;  1IIN A;  4FRP A;  1G95 A;  2VS4 A;  3JUJ A;  1TVY A;  2AES A;  1FR8 A;  5C4F A;  4NAI A;  4NAN A;  1QG8 A;  2AE7 A;  4B3U A;  1FZW A;  1V82 A;  3I0J A;  2FFV A;  3R2W A;  5BXC A;  3I0L A;  1EYR A;  2GGO A;  3F1C A;  2RJ5 A;  5AJP A;  1G93 A;  5CQN X;  1GWV A;  4FCE A;  2OI7 A;  1JV3 A;  2O1G A;  4D0T A;  3RMW A;  4JD0 A;  1LL3 A;  4E1K A;  4ASY A;  1SS9 A;  3CKO A;  2RJ4 A;  5FTS A;  3PNN A;  1R7V A;  1JYL A;  1WVC A;  4ASJ A;  2JCK A;  4CJC A;  1ZCU A;  4KC2 A;  1I52 A;  4AYJ A;  2PGV A; 
#chains in the Genus database with same CATH homology
 1R80 A;  4NAL A;  1LL2 A;  3USR A;  2X65 A;  1PZT A;  1GX4 A;  1R7Y A;  4NAK A;  5FUH A;  1H5S C;  4HO9 A;  3USQ A;  5C4D A;  4FRL A;  5EIY A;  1O7Q A;  1QGS A;  1ZDF A;  2FYA A;  2J0B A;  4G3S A;  3POL A;  3V91 A;  3F1Y A;  3PKP A;  3V0P A;  2YQC A;  1NWG B;  2P72 A;  2Y4M A;  1IIM A;  1LL0 A;  3JUK A;  1HM0 A;  5CQP A;  4EVW A;  1JYK A;  4FQW A;  3HL3 A;  4Y63 A;  2PGY A;  1JVG A;  4B4B A;  5FU8 A;  4EEA A;  4HCQ A;  3U0X A;  5L6S A;  2P6W A;  4HOC A;  4KNR A;  2C0N A;  2VD4 A;  2BO8 A;  4FIX A;  1GQC A;  1GX0 A;  3Q7U A;  1WT2 A;  4Y7T A;  4M2A A;  4Y6N A;  1LZ0 A;  2Y7A A;  4CVH A;  2XME A;  1G2V A;  1O23 B;  1R7T A;  1H5S A;  4R7P A;  5CQO A;  4EEO A;  1TW5 A;  2VXM A;  3SXB A;  1YP4 A;  1ZCT A;  3I0D A;  2V0L A;  3DUV A;  3SX5 A;  1ZI3 A;  2I5K A;  4MIX A;  2A8U A;  2QH5 A;  1HV9 A;  1S4P A;  1W55 A;  4K6R A;  5C3B A;  1WT1 A;  4MND A;  1ZJO A;  2RIY A;  2V0J A;  1GWW A;  4O6M A;  3ZF8 A;  4EEM A;  2V0K A;  4M2B A;  5C49 A;  1VIC A;  3ZLK A;  5I1F A;  5D91 A;  4AYL A;  4B2X A;  3OC9 A;  1OMX A;  4KPX A;  3OH4 A;  2WGZ A;  4FRA A;  3V8Y A;  3OH2 A;  1R7U A;  2UX8 A;  1ZHJ A;  2OI6 A;  1W57 A;  3I0C A;  3U2X A;  2VK9 A;  4ARW A;  1H5R B;  5EJ1 A;  2V0H A;  2P73 A;  1VPA A;  1O0R A;  3EE5 A;  2E3D A;  3GUE A;  2PX7 A;  4MYB A;  3SX7 A;  2ZU8 A;  2VFZ A;  1ZJ3 A;  5CQL X;  4DEC A;  1NKH B;  1H4E A;  3K8E A;  1MC3 A;  1HJJ A;  4HG6 A;  1H7F A;  4HO6 A;  4ECM A;  3OH1 A;  3SXG A;  2Y4K A;  3ZLL A;  2E8B A;  4FRB A;  2X60 A;  1HM8 A;  2Q4J A;  3I0K A;  2Y6P A;  1FXJ A;  4B4M A;  1ZIZ A;  3CKQ A;  5C3A A;  2DPW A;  2RIT A;  3IOJ A;  5CMG X;  2AH9 A;  2BO7 A;  1V83 A;  2FYB A;  5HS2 A;  3NGW A;  5C48 A;  1JV1 A;  2QGI A;  3SXD A;  2YC3 A;  1VGW A;  1ZI4 A;  2FYC B;  4YS8 A;  1LZJ A;  1FR9 A;  4Y7V A;  3D98 A;  3R3I A;  5CMJ A;  1LZI A;  1WT3 A;  5FU0 A;  2ICX A;  2YQH A;  1YRO B;  3E26 A;  3OAM A;  3V8Z A;  1QGQ A;  2D0J A;  4Y7U A;  1G9R A;  2CU2 A;  3CKJ A;  4UEG A;  1TZF A;  1VZX A;  1Z90 A;  2RJ9 A;  4IRQ A;  2WVL A;  2RJ1 A;  1MP3 A;  4Y62 A;  3FWW A;  3I0E A;  1G23 A;  3OGZ A;  4O6N A;  3SXC A;  1WT0 A;  2O1F A;  4FRM A;  2BO4 A;  1OQM B;  2RJ7 A;  1LVW A;  4M4K A;  1K4V A;  1R81 A;  4FRQ A;  4KC1 A;  1YP3 A;  1QWJ A;  4D48 A;  2ZU7 A;  1GA8 A;  1H4C A;  2Z86 A;  3JTJ A;  4GBP A;  4KT7 A;  5CMI A;  3V0Q A;  1H7L A;  1O7O A;  3OH3 A;  1INI A;  2XWN A;  4FRH A;  1H5T A;  3E25 A;  3OH0 A;  4BMA A;  1OMZ A;  4EE5 A;  1VGT A;  5C47 A;  5AJO A;  1VGZ A;  3IOI A;  4DDZ A;  3D8V A;  2X5Z A;  3CU0 A;  1LZ7 A;  4FRE A;  2JCL A;  4HO8 A;  4DE7 A;  2VS5 A;  2YCM A;  4B4G A;  3Q4S A;  2RJ8 A;  3SX8 A;  1E5K A;  2ICY A;  1VGU A;  4Y64 A;  1ZJ1 A;  4JIS A;  2WEE A;  3DK5 A;  3FOQ A;  3T7O A;  2YQS A;  1FWY A;  1H5S D;  4EE4 A;  1VZT A;  5CMH A;  2I5E A;  3QVB A;  5FTV A;  1VH3 A;  2ZU9 A;  4G87 A;  2YES A;  2V0I A;  1VM8 A;  2D7I A;  1H7G A;  2J0A A;  1H5S B;  2A8W A;  4EE3 A;  4HO4 A;  5C3D A;  1FG5 N;  2RIZ A;  4G3Q A;  4KNX A;  5JQQ A;  4Y9X A;  2WAW A;  4CJ8 A;  4KQL A;  5C4C A;  4J18 A;  3SX3 A;  1VH1 A;  2OEF A;  4KXO A;  3V0M A;  4XWI A;  4Y7G A;  1V84 A;  3ST8 A;  1R82 A;  1R7X A;  4HO5 A;  1XHB A;  4FIY A;  4Y7F A;  1FRW A;  5DDV A;  2D7R A;  1ZI1 A;  1FGG A;  5D92 A;  3OKR A;  3Q80 A;  2VSH A;  2X5S A;  4AAW A;  4FRD A;  4D11 C;  1FGX A;  3RSB A;  2AEC A;  1WSZ A;  2FYD B;  1G8O A;  1ZCV A;  1EZI A;  1W77 A;  4LW3 A;  4AC3 A;  2NXV A;  5C36 A;  1ZJP A;  2XMH A;  1JVD A;  1G3L A;  4KC4 A;  1GQ9 A;  4M28 A;  3V0N A;  3TZT A;  4KRV A;  2RJ0 A;  4ZDQ A;  1S4O A;  1FO9 A;  2WVK A;  3CKV A;  4LW6 A;  3LW6 A;  2W0W A;  5C1H A;  1FO8 A;  2PA4 A;  2XWL A;  2AM4 A;  3I0I X;  4KPZ A;  5C1L A;  2JCJ A;  2WVM A;  4FRO A;  3U2T A;  1ON6 A;  2YQJ A;  2AM3 A;  1G97 A;  4P00 A;  4D0Z A;  4D11 A;  3DJ4 A;  5AJN A;  1ZJ0 A;  5EJZ A;  5C4E A;  2W0V A;  1MP4 A;  1VZU A;  1TW1 A;  2RJ6 A;  5C38 A;  5C4B A;  1ZI5 A;  3CGX A;  1H3M A;  5FYE A;  2VSI A;  1H7E A;  1NHE B;  3KIA A;  5DDT A;  3K8D A;  2FY7 A;  3V0O A;  4IRP A;  1HM9 A;  4L41 C;  3U2W A;  3IOH A;  2O1H A;  3TQD A;  2Y4L A;  3V0L A;  5CMF X;  4B2W A;  2AGD A;  2QKX A;  1H5R A;  1S4N A;  2MZB A;  1H4D A;  2OEG A;  5C1G A;  3BCV A;  3N9W A;  4EEG A;  4FCU A;  2FFU A;  3I0G A;  2RIX A;  5IDT A;  3SXE A;  3CKN A;  1KWS A;  1NF5 B;  3PKQ A;  1HJL A;  1ZJ2 A;  2VS3 A;  2I7B A;  3I0H A;  5L6V A;  1YP2 A;  4G3P A;  3I0F A;  3T7N A;  1NQI B;  4Y6U A;  3T7M A;  4Q7C A;  3ZGG A;  3SXA A;  1FXO A;  2Y4J A;  2APC A;  3D5N A;  3RMV A;  2BO6 A;  1PZY B;  1G1L A;  3BRK X;  2VXL A;  4C2S A;  2JCO A;  1INJ A;  1G0R A;  1ON8 A;  2WE9 A;  4HO2 A;  4P02 A;  5CQM X;  3U2V A;  4B42 A;  1ZCY A;  2XWM A;  1FOA A;  5J49 A;  2AM5 A;  2YC5 A;  3V90 A;  2GGQ A;  1H7T A;  3O3P A;  3ZGF A;  4BQH A;  1XZ6 A;  4CJB A;  1H7H A;  5IFY A;  4B5B A;  1ZDG A;  1H5T B;  4HO0 A;  2Z87 A;  3U2U A;  5FV9 A;  1H7Q A;  3U0Y A;  5C8R A;  3SPT A;  1MP5 A;  2OI5 A;  1NMM B;  4HO3 A;  5IDS A;  1IIN A;  4FRP A;  1G95 A;  2VS4 A;  3JUJ A;  1TVY A;  2AES A;  1FR8 A;  5C4F A;  4NAI A;  4NAN A;  1QG8 A;  2AE7 A;  4B3U A;  1FZW A;  1V82 A;  3I0J A;  2FFV A;  3R2W A;  5BXC A;  3I0L A;  1EYR A;  2GGO A;  3F1C A;  2RJ5 A;  5AJP A;  1G93 A;  5CQN X;  1GWV A;  4FCE A;  2OI7 A;  1JV3 A;  2O1G A;  4D0T A;  3RMW A;  4JD0 A;  1LL3 A;  4E1K A;  4ASY A;  1SS9 A;  3CKO A;  2RJ4 A;  5FTS A;  3PNN A;  1R7V A;  1JYL A;  1WVC A;  4ASJ A;  2JCK A;  4CJC A;  1ZCU A;  4KC2 A;  1I52 A;  4AYJ A;  2PGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...