1TZFA

X-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
259
structure length
251
Chain Sequence
MASKAVILAGGLGVKPKPMVEIGGKPILWHIMKMYSVHGIKDFIICCGYKGYVIKEYFANYFLHMSDVTFHMAENRMEVHHKRVEPWNVTLVDTGDSSMTGGRLKRVAEYVKDDEAFLFTYGDGVADLDIKATIDFHKAHGKKATLTATFPPGRFGALDIQAGQVRSFQEKPKGDGAMINGGFFVLNPSVIDLIDNDATTWEQEPLMTLAQQGELMAFEHPGFWQPMDTLRDKVYLEGLWEKGKAPWKTWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose-1-phosphate cytidylyltransferase
publication title Molecular structure of alpha-D-glucose-1-phosphate cytidylyltransferase from Salmonella typhi
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhi
molecule tags Transferase
total genus 70
structure length 251
sequence length 259
ec nomenclature ec 2.7.7.33: Glucose-1-phosphate cytidylyltransferase.
pdb deposition date 2004-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1tzfA00
4BQHA 2FYAA 3RMVA 4D0ZA 2FFUA 1G3LA 1ZDFA 4KT7A 2PGVA 2X5ZA 1ZIZA 4FQWA 1LL0A 3IOIA 1LZ0A 5CMGX 4B4BA 2VXMA 4IRQA 2VS4A 3HL3A 4KC4A 2YESA 3ZGGA 4NANA 5CMHA 2AM5A 3DUVA 2VXLA 4NAIA 5I1FA 3CGXA 1LZIA 2WVKA 2JCLA 3POLA 1YP3A 1YROB 2FYDB 1G93A 1H5SB 3ST8A 2ZU7A 2V0LA 3U2XA 1HV9A 1Z90A 5L6SA 1JV3A 3EE5A 1NHEB 2Y4MA 4UEGA 1SS9A 1H4CA 2V0JA 1LL3A 2RJ7A 1ZCYA 2OI5A 4D48A 1I52A 1QG8A 5FYEA 5C3DA 5C38A 3GUEA 4HOCA 2RJ0A 4Y62A 4KQLA 1VICA 4ZDQA 2GGQA 1JVGA 2A8UA 4M2AA 1ZI4A 1G95A 4ASYA 2OEGA 5CMIA 1FO9A 2JCOA 2FYCB 3JUJA 3SXGA 1ZJ3A 4Y7TA 3I0CA 1INIA 1ZJOA 1FGXA 1FWYA 2XMEA 4Y7FA 2P6WA 4G3SA 1YP4A 5AJNA 1ZJPA 2BO7A 1G8OA 5C4FA 2BO6A 1GQCA 1ON8A 1OQMB 1S4NA 4P02A 1FZWA 2RJ9A 3PKPA 1H5SA 3CKJA 3I0EA 4DDZA 3OGZA 5AJOA 3OC9A 2O1FA 3OAMA 4FRAA 1XZ6A 4B2XA 1INJA 2Y4LA 1W77A 4KNXA 2ZU9A 2RJ8A 2PA4A 4DE7A 1G23A 2QH5A 1TW1A 4KRVA 3IOHA 1H4EA 4FROA 1FR9A 2Y4KA 4XWIA 4Y9XA 4B5BA 2O1GA 5CMJA 3RSBA 5C4EA 1H7EA 1MP3A 4EVWA 1V83A 5CMFX 2OEFA 1TVYA 3O3PA 4FRLA 3SPTA 2E8BA 4ARWA 2VSIA 4B3UA 4ECMA 5C36A 3K8EA 2QKXA 3BRKX 5C4BA 5HS2A 3V0OA 4FRHA 1R80A 4NAKA 4B4MA 4MNDA 2I5EA 4EEAA 4CJ8A 1FXOA 4KC1A 4LW6A 2XWMA 3SXEA 1NQIB 4HO0A 4FRQA 3IOJA 1H5SD 1WSZA 2RIXA 1GWWA 4NALA 1YP2A 2D0JA 1PZYB 4IRPA 5EJZA 5CQPA 3PKQA 3T7OA 3I0HA 1MC3A 2W0WA 1NWGB 4E1KA 1H5TB 1ZI1A 4KPXA 2ICYA 3ZGFA 4KPZA 1MP4A 2Z86A 5FTVA 3SX8A 3I0GA 4EEOA 3U0XA 4KXOA 4CJBA 2YQJA 1FOAA 3SX7A 2YQHA 1ZI3A 4KC2A 5C3AA 4Y64A 4ASJA 1VGUA 4B2WA 1JYLA 1ZHJA 2Y7AA 4GBPA 3V8ZA 4FRDA 2APCA 3BCVA 3SXBA 3U2UA 2PGYA 2Y4JA 3V90A 5IFYA 1ON6A 2P73A 1NKHB 2AE7A 4Y7UA 1FR8A 1JV1A 3U0YA 1HJJA 4HO5A 1O7QA 1WT3A 1G1LA 2AESA 2P72A 3SX3A 1FGGA 3CKVA 4FRBA 2NXVA 2O1HA 2Z87A 1W57A 4HG6A 4Y6UA 4EE4A 4P00A 4HO8A 4K6RA 1H5RB 2QGIA 4EEMA 1ZCVA 2RJ6A 3CU0A 4HCQA 5C4CA 3JUKA 4D11C 3V91A 1O0RA 3OH0A 3V8YA 2RJ5A 3I0KA 4D11A 2GGOA 2YC5A 3U2VA 1GWVA 4JISA 1H5SC 3V0MA 3D5NA 1VH1A 5J49A 5CQNX 1G97A 4LW3A 1H5TA 1ZJ1A 3DK5A 1S4PA 2ZU8A 3F1YA 3E26A 1H7GA 4M4KA 4CJCA 2FY7A 4AC3A 1GQ9A 3Q7UA 4B42A 3D98A 2BO8A 2AM3A 4HO3A 5C3BA 4HO6A 5C49A 1EYRA 1G9RA 1VH3A 1K4VA 5C8RA 5EIYA 3OH4A 1LL2A 4FRMA 5L6VA 2WVMA 2RJ4A 1S4OA 1H7HA 2A8WA 1V82A 4G87A 1FRWA 2VS5A 4B4GA 5FV9A 3T7NA 2FFVA 5DDVA 4R7PA 1E5KA 1VGZA 1NF5B 1ZJ0A 2Y6PA 1LZ7A 2VSHA 1H5RA 3V0PA 3F1CA 2E3DA 3R2WA 3R3IA 1VZTA 1HM0A 4M28A 1WT0A 2XWLA 4Y7GA 2PX7A 2WGZA 1IIMA 1FXJA 2D7RA 1VM8A 1H7QA 5AJPA 1EZIA 3SXAA 1R82A 2YQSA 2I7BA 2FYBA 5C1LA 4C2SA 1OMZA 1VZXA 2RITA 1R81A 2WE9A 2CU2A 3RMWA 2VS3A 1WT2A 3V0QA 1FO8A 1HM8A 3OH2A 5CQMX 5IDSA 1HM9A 1LVWA 2I5KA 3U2WA 3Q4SA 4AYJA 1MP5A 2YQCA 4L41C 4AAWA 2WAWA 1QWJA 1JVDA 1PZTA 3JTJA 3U2TA 4AYLA 1JYKA 3I0LA 1H7TA 1ZCUA 1TZFA 2YCMA 5C47A 1R7YA 3CKNA 3ZLLA 3TQDA 1IINA 3N9WA 5EJ1A 1R7VA 5C1GA 3K8DA 4Y63A 1ZCTA 2BO4A 2MZBA 3QVBA 1OMXA 3CKOA 1H3MA 4D0TA 5FU8A 3ZF8A 1G2VA 3OH3A 1NMMB 1GA8A 1WVCA 2ICXA 4FREA 4HO2A 3E25A 2UX8A 3FWWA 3SXCA 2OI6A 1W55A 4G3PA 4JD0A 2V0HA 4HO4A 1LZJA 3DJ4A 2OI7A 2WVLA 2XWNA 3V0NA 3TZTA 2WEEA 2W0VA 4MYBA 1QGQA 3LW6A 5FUHA 3PNNA 3D8VA 2X60A 1R7TA 3OH1A 5BXCA 4EEGA 4CVHA 2XMHA 3NGWA 1VPAA 4EE5A 1G0RA 4DECA 1ZI5A 4Y7VA 2AGDA 1VZUA 2VFZA 2YC3A 1TW5A 5FU0A 1H7FA 1WT1A 3V0LA 3FOQA 1GX4A 3USRA 2V0KA 1ZJ2A 2AH9A 4HO9A 5CQLX 3I0FA 1H4DA 3ZLKA 2V0IA 4J18A 1O7OA 4FRPA 4M2BA 1ZDGA 5CQOA 3T7MA 3I0IX 2RJ1A 1KWSA 5IDTA 1HJLA 5DDTA 1V84A 1R7UA 2DPWA 4YS8A 2VD4A 2X5SA 1H7LA 3OKRA 2AM4A 3I0JA 2RIYA 3SX5A 4FCUA 1R7XA 2D7IA 5JQQA 1XHBA 1QGSA 3CKQA 5C48A 2Q4JA 5C1HA 1VGWA 5C4DA 5FTSA 4BMAA 3KIAA 2AECA 4KNRA 4Y6NA 1O23B 4EE3A 3SXDA 3Q80A 1GX0A 2RIZA 4G3QA 4FCEA 3USQA 2JCKA 2X65A 1VGTA 3I0DA 2JCJA 1FG5N
chains in the Genus database with same CATH superfamily
4BQHA 2FYAA 3RMVA 4D0ZA 2FFUA 1G3LA 1ZDFA 4KT7A 2PGVA 2X5ZA 1ZIZA 4FQWA 1LL0A 3IOIA 1LZ0A 5CMGX 4B4BA 2VXMA 4IRQA 2VS4A 3HL3A 4KC4A 2YESA 3ZGGA 4NANA 5CMHA 2AM5A 3DUVA 2VXLA 4NAIA 5I1FA 3CGXA 1LZIA 2WVKA 2JCLA 3POLA 1YP3A 1YROB 2FYDB 2C0NA 1G93A 1H5SB 3ST8A 2ZU7A 2V0LA 3U2XA 1HV9A 1Z90A 5L6SA 1JV3A 3EE5A 1NHEB 2Y4MA 4UEGA 1SS9A 1H4CA 2V0JA 1LL3A 2RJ7A 1ZCYA 2OI5A 4MIXA 4D48A 1I52A 1QG8A 5FYEA 5C3DA 5C38A 3GUEA 4HOCA 2RJ0A 4Y62A 4KQLA 1VICA 4ZDQA 2GGQA 1JVGA 2A8UA 4M2AA 1ZI4A 1G95A 4ASYA 2OEGA 5CMIA 1FO9A 2JCOA 2FYCB 3JUJA 3SXGA 1ZJ3A 4Y7TA 3I0CA 1INIA 1ZJOA 1FGXA 1FWYA 2XMEA 4Y7FA 2P6WA 4G3SA 1YP4A 5AJNA 1ZJPA 2BO7A 1G8OA 5C4FA 2BO6A 1GQCA 1ON8A 1OQMB 1S4NA 4P02A 1FZWA 2RJ9A 3PKPA 1H5SA 3CKJA 3I0EA 4DDZA 3OGZA 5AJOA 3OC9A 2O1FA 3OAMA 4FRAA 1XZ6A 4B2XA 1INJA 2Y4LA 1W77A 4KNXA 2ZU9A 2RJ8A 2PA4A 4DE7A 1G23A 2QH5A 1TW1A 4KRVA 3IOHA 4O6NA 1H4EA 4FROA 1FR9A 2Y4KA 4XWIA 4Y9XA 4B5BA 2O1GA 5CMJA 3RSBA 5C4EA 1H7EA 1MP3A 4EVWA 1V83A 5CMFX 2OEFA 1TVYA 3O3PA 4FRLA 3SPTA 2E8BA 4ARWA 2VSIA 4B3UA 4ECMA 5C36A 3K8EA 2QKXA 3BRKX 5C4BA 5HS2A 3V0OA 4FRHA 1R80A 4NAKA 4B4MA 4MNDA 2I5EA 4EEAA 4CJ8A 1FXOA 4KC1A 4LW6A 2XWMA 3SXEA 1NQIB 4HO0A 4FRQA 3IOJA 1H5SD 1WSZA 2RIXA 1GWWA 4NALA 1YP2A 2D0JA 1PZYB 4IRPA 5EJZA 5CQPA 3PKQA 3T7OA 3I0HA 1MC3A 2W0WA 1NWGB 4E1KA 1H5TB 1ZI1A 4KPXA 2ICYA 3ZGFA 4KPZA 1MP4A 2Z86A 5FTVA 3SX8A 3I0GA 4EEOA 3U0XA 4KXOA 4CJBA 2YQJA 1FOAA 3SX7A 2YQHA 1ZI3A 4KC2A 5C3AA 4Y64A 4ASJA 1VGUA 4B2WA 1JYLA 1ZHJA 2Y7AA 4GBPA 3V8ZA 4FRDA 4O6MA 2APCA 3BCVA 3SXBA 3U2UA 2PGYA 2Y4JA 3V90A 5IFYA 1ON6A 2P73A 1NKHB 2AE7A 4Y7UA 1FR8A 1JV1A 3U0YA 1HJJA 4HO5A 1O7QA 1WT3A 1G1LA 2AESA 2P72A 3SX3A 4FIYA 1FGGA 3CKVA 4FRBA 2NXVA 2O1HA 2Z87A 1W57A 4HG6A 4Y6UA 4EE4A 4P00A 4HO8A 4K6RA 1H5RB 2QGIA 4EEMA 1ZCVA 2RJ6A 3CU0A 4HCQA 5C4CA 3JUKA 4D11C 3V91A 1O0RA 3OH0A 3V8YA 2RJ5A 3I0KA 4D11A 2GGOA 2YC5A 3U2VA 1GWVA 4JISA 1H5SC 3V0MA 3D5NA 1VH1A 5J49A 5CQNX 1G97A 4LW3A 1H5TA 1ZJ1A 3DK5A 1S4PA 2ZU8A 3F1YA 3E26A 1H7GA 4M4KA 4CJCA 2FY7A 4AC3A 1GQ9A 3Q7UA 4B42A 3D98A 2BO8A 2AM3A 4HO3A 5C3BA 4HO6A 5C49A 1EYRA 1G9RA 1VH3A 1K4VA 5C8RA 5EIYA 3OH4A 1LL2A 4FRMA 5L6VA 2WVMA 2RJ4A 1S4OA 1H7HA 2A8WA 1V82A 4G87A 1FRWA 2VS5A 4B4GA 5FV9A 3T7NA 2FFVA 5DDVA 4R7PA 1E5KA 1VGZA 1NF5B 1ZJ0A 2Y6PA 1LZ7A 2VSHA 1H5RA 3V0PA 2VK9A 3F1CA 2E3DA 3R2WA 3R3IA 1VZTA 1HM0A 4M28A 1WT0A 2XWLA 4Y7GA 2PX7A 2WGZA 1IIMA 1FXJA 2D7RA 1VM8A 1H7QA 5AJPA 5D92A 1EZIA 3SXAA 1R82A 2YQSA 2I7BA 2FYBA 5C1LA 4C2SA 1OMZA 1VZXA 2RITA 1R81A 2WE9A 2CU2A 3RMWA 2VS3A 1WT2A 3V0QA 1FO8A 1HM8A 3OH2A 5CQMX 5IDSA 1HM9A 1LVWA 2I5KA 3U2WA 2J0BA 4Q7CA 3Q4SA 4AYJA 1MP5A 2YQCA 4L41C 4AAWA 2WAWA 1QWJA 1JVDA 1PZTA 3JTJA 3U2TA 4AYLA 1JYKA 3I0LA 1H7TA 1ZCUA 1TZFA 2YCMA 5C47A 1R7YA 3CKNA 3ZLLA 3TQDA 1IINA 3N9WA 5EJ1A 1R7VA 5C1GA 3K8DA 4Y63A 1ZCTA 2BO4A 2MZBA 3QVBA 1OMXA 3CKOA 1H3MA 4D0TA 5FU8A 3ZF8A 1G2VA 3OH3A 1NMMB 1GA8A 1WVCA 2ICXA 4FREA 4HO2A 3E25A 2UX8A 3FWWA 3SXCA 2OI6A 1W55A 4G3PA 4JD0A 2V0HA 4HO4A 1LZJA 3DJ4A 2OI7A 2WVLA 2XWNA 3V0NA 3TZTA 2WEEA 2W0VA 4MYBA 1QGQA 3LW6A 5FUHA 3PNNA 3D8VA 2X60A 1R7TA 3OH1A 5BXCA 4EEGA 4CVHA 2XMHA 3NGWA 1VPAA 4EE5A 1G0RA 4DECA 1ZI5A 4Y7VA 2AGDA 1VZUA 2VFZA 2YC3A 4FIXA 1TW5A 5FU0A 1H7FA 1WT1A 3V0LA 3FOQA 5D91A 1GX4A 3USRA 2V0KA 1ZJ2A 2AH9A 4HO9A 5CQLX 3I0FA 1H4DA 3ZLKA 2V0IA 4J18A 1O7OA 4FRPA 4M2BA 1ZDGA 5CQOA 2J0AA 3T7MA 3I0IX 2RJ1A 1KWSA 5IDTA 1HJLA 5DDTA 1V84A 1R7UA 2DPWA 4YS8A 2VD4A 2X5SA 1H7LA 3OKRA 2AM4A 3I0JA 2RIYA 3SX5A 4FCUA 1R7XA 2D7IA 5JQQA 1XHBA 1QGSA 3CKQA 5C48A 2Q4JA 5C1HA 1VGWA 5C4DA 5FTSA 4BMAA 3KIAA 2AECA 4KNRA 4Y6NA 1O23B 4EE3A 3SXDA 3Q80A 1GX0A 2RIZA 4G3QA 4FCEA 3USQA 2JCKA 2X65A 1VGTA 3I0DA 2JCJA 1FG5N
chains in the Genus database with same CATH topology
4BQHA 2FYAA 3RMVA 4D0ZA 2FFUA 1G3LA 1ZDFA 4KT7A 2PGVA 2X5ZA 1ZIZA 4FQWA 1LL0A 3IOIA 1LZ0A 5CMGX 4B4BA 2VXMA 4IRQA 2VS4A 3HL3A 4KC4A 2YESA 3ZGGA 4NANA 5CMHA 2AM5A 3DUVA 2VXLA 4NAIA 5I1FA 3CGXA 1LZIA 2WVKA 2JCLA 3POLA 1YP3A 1YROB 2FYDB 2C0NA 1G93A 1H5SB 3ST8A 2ZU7A 2V0LA 3U2XA 1HV9A 1Z90A 5L6SA 1JV3A 3EE5A 1NHEB 2Y4MA 4UEGA 1SS9A 1H4CA 2V0JA 1LL3A 2RJ7A 1ZCYA 2OI5A 4MIXA 4D48A 1I52A 1QG8A 5FYEA 5C3DA 5C38A 3GUEA 4HOCA 2RJ0A 4Y62A 4KQLA 1VICA 4ZDQA 2GGQA 1JVGA 2A8UA 4M2AA 1ZI4A 1G95A 4ASYA 2OEGA 5CMIA 1FO9A 2JCOA 2FYCB 3JUJA 3SXGA 1ZJ3A 4Y7TA 3I0CA 1INIA 1ZJOA 1FGXA 1FWYA 2XMEA 4Y7FA 2P6WA 4G3SA 1YP4A 5AJNA 1ZJPA 2BO7A 1G8OA 5C4FA 2BO6A 1GQCA 1ON8A 1OQMB 1S4NA 4P02A 1FZWA 2RJ9A 3PKPA 1H5SA 3CKJA 3I0EA 4DDZA 3OGZA 5AJOA 3OC9A 2O1FA 3OAMA 4FRAA 1XZ6A 4B2XA 1INJA 2Y4LA 1W77A 4KNXA 2ZU9A 2RJ8A 2PA4A 4DE7A 1G23A 2QH5A 1TW1A 4KRVA 3IOHA 4O6NA 1H4EA 4FROA 1FR9A 2Y4KA 4XWIA 4Y9XA 4B5BA 2O1GA 5CMJA 3RSBA 5C4EA 1H7EA 1MP3A 4EVWA 1V83A 5CMFX 2OEFA 1TVYA 3O3PA 4FRLA 3SPTA 2E8BA 4ARWA 2VSIA 4B3UA 4ECMA 5C36A 3K8EA 2QKXA 3BRKX 5C4BA 5HS2A 3V0OA 4FRHA 1R80A 4NAKA 4B4MA 4MNDA 2I5EA 4EEAA 4CJ8A 1FXOA 4KC1A 4LW6A 2XWMA 3SXEA 1NQIB 4HO0A 4FRQA 3IOJA 1H5SD 1WSZA 2RIXA 1GWWA 4NALA 1YP2A 2D0JA 1PZYB 4IRPA 5EJZA 5CQPA 3PKQA 3T7OA 3I0HA 1MC3A 2W0WA 1NWGB 4E1KA 1H5TB 1ZI1A 4KPXA 2ICYA 3ZGFA 4KPZA 1MP4A 2Z86A 5FTVA 3SX8A 3I0GA 4EEOA 3U0XA 4KXOA 4CJBA 2YQJA 1FOAA 3SX7A 2YQHA 1ZI3A 4KC2A 5C3AA 4Y64A 4ASJA 1VGUA 4B2WA 1JYLA 1ZHJA 2Y7AA 4GBPA 3V8ZA 4FRDA 4O6MA 2APCA 3BCVA 3SXBA 3U2UA 2PGYA 2Y4JA 3V90A 5IFYA 1ON6A 2P73A 1NKHB 2AE7A 4Y7UA 1FR8A 1JV1A 3U0YA 1HJJA 4HO5A 1O7QA 1WT3A 1G1LA 2AESA 2P72A 3SX3A 4FIYA 1FGGA 3CKVA 4FRBA 2NXVA 2O1HA 2Z87A 1W57A 4HG6A 4Y6UA 4EE4A 4P00A 4HO8A 4K6RA 1H5RB 2QGIA 4EEMA 1ZCVA 2RJ6A 3CU0A 4HCQA 5C4CA 3JUKA 4D11C 3V91A 1O0RA 3OH0A 3V8YA 2RJ5A 3I0KA 4D11A 2GGOA 2YC5A 3U2VA 1GWVA 4JISA 1H5SC 3V0MA 3D5NA 1VH1A 5J49A 5CQNX 1G97A 4LW3A 1H5TA 1ZJ1A 3DK5A 1S4PA 2ZU8A 3F1YA 3E26A 1H7GA 4M4KA 4CJCA 2FY7A 4AC3A 1GQ9A 3Q7UA 4B42A 3D98A 2BO8A 2AM3A 4HO3A 5C3BA 4HO6A 5C49A 1EYRA 1G9RA 1VH3A 1K4VA 5C8RA 5EIYA 3OH4A 1LL2A 4FRMA 5L6VA 2WVMA 2RJ4A 1S4OA 1H7HA 2A8WA 1V82A 4G87A 1FRWA 2VS5A 4B4GA 5FV9A 3T7NA 2FFVA 5DDVA 4R7PA 1E5KA 1VGZA 1NF5B 1ZJ0A 2Y6PA 1LZ7A 2VSHA 1H5RA 3V0PA 2VK9A 3F1CA 2E3DA 3R2WA 3R3IA 1VZTA 1HM0A 4M28A 1WT0A 2XWLA 4Y7GA 2PX7A 2WGZA 1IIMA 1FXJA 2D7RA 1VM8A 1H7QA 5AJPA 5D92A 1EZIA 3SXAA 1R82A 2YQSA 2I7BA 2FYBA 5C1LA 4C2SA 1OMZA 1VZXA 2RITA 1R81A 2WE9A 2CU2A 3RMWA 2VS3A 1WT2A 3V0QA 1FO8A 1HM8A 3OH2A 5CQMX 5IDSA 1HM9A 1LVWA 2I5KA 3U2WA 2J0BA 4Q7CA 3Q4SA 4AYJA 1MP5A 2YQCA 4L41C 4AAWA 2WAWA 1QWJA 1JVDA 1PZTA 3JTJA 3U2TA 4AYLA 1JYKA 3I0LA 1H7TA 1ZCUA 1TZFA 2YCMA 5C47A 1R7YA 3CKNA 3ZLLA 3TQDA 1IINA 3N9WA 5EJ1A 1R7VA 5C1GA 3K8DA 4Y63A 1ZCTA 2BO4A 2MZBA 3QVBA 1OMXA 3CKOA 1H3MA 4D0TA 5FU8A 3ZF8A 1G2VA 3OH3A 1NMMB 1GA8A 1WVCA 2ICXA 4FREA 4HO2A 3E25A 2UX8A 3FWWA 3SXCA 2OI6A 1W55A 4G3PA 4JD0A 2V0HA 4HO4A 1LZJA 3DJ4A 2OI7A 2WVLA 2XWNA 3V0NA 3TZTA 2WEEA 2W0VA 4MYBA 1QGQA 3LW6A 5FUHA 3PNNA 3D8VA 2X60A 1R7TA 3OH1A 5BXCA 4EEGA 4CVHA 2XMHA 3NGWA 1VPAA 4EE5A 1G0RA 4DECA 1ZI5A 4Y7VA 2AGDA 1VZUA 2VFZA 2YC3A 4FIXA 1TW5A 5FU0A 1H7FA 1WT1A 3V0LA 3FOQA 5D91A 1GX4A 3USRA 2V0KA 1ZJ2A 2AH9A 4HO9A 5CQLX 3I0FA 1H4DA 3ZLKA 2V0IA 4J18A 1O7OA 4FRPA 4M2BA 1ZDGA 5CQOA 2J0AA 3T7MA 3I0IX 2RJ1A 1KWSA 5IDTA 1HJLA 5DDTA 1V84A 1R7UA 2DPWA 4YS8A 2VD4A 2X5SA 1H7LA 3OKRA 2AM4A 3I0JA 2RIYA 3SX5A 4FCUA 1R7XA 2D7IA 5JQQA 1XHBA 1QGSA 3CKQA 5C48A 2Q4JA 5C1HA 1VGWA 5C4DA 5FTSA 4BMAA 3KIAA 2AECA 4KNRA 4Y6NA 1O23B 4EE3A 3SXDA 3Q80A 1GX0A 2RIZA 4G3QA 4FCEA 3USQA 2JCKA 2X65A 1VGTA 3I0DA 2JCJA 1FG5N
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BQH A;  2FYA A;  3RMV A;  4D0Z A;  2FFU A;  1G3L A;  1ZDF A;  4KT7 A;  2PGV A;  2X5Z A;  1ZIZ A;  4FQW A;  1LL0 A;  3IOI A;  1LZ0 A;  5CMG X;  4B4B A;  2VXM A;  4IRQ A;  2VS4 A;  3HL3 A;  4KC4 A;  2YES A;  3ZGG A;  4NAN A;  5CMH A;  2AM5 A;  3DUV A;  2VXL A;  4NAI A;  5I1F A;  3CGX A;  1LZI A;  2WVK A;  2JCL A;  3POL A;  1YP3 A;  1YRO B;  2FYD B;  1G93 A;  1H5S B;  3ST8 A;  2ZU7 A;  2V0L A;  3U2X A;  1HV9 A;  1Z90 A;  5L6S A;  1JV3 A;  3EE5 A;  1NHE B;  2Y4M A;  4UEG A;  1SS9 A;  1H4C A;  2V0J A;  1LL3 A;  2RJ7 A;  1ZCY A;  2OI5 A;  4D48 A;  1I52 A;  1QG8 A;  5FYE A;  5C3D A;  5C38 A;  3GUE A;  4HOC A;  2RJ0 A;  4Y62 A;  4KQL A;  1VIC A;  4ZDQ A;  2GGQ A;  1JVG A;  2A8U A;  4M2A A;  1ZI4 A;  1G95 A;  4ASY A;  2OEG A;  5CMI A;  1FO9 A;  2JCO A;  2FYC B;  3JUJ A;  3SXG A;  1ZJ3 A;  4Y7T A;  3I0C A;  1INI A;  1ZJO A;  1FGX A;  1FWY A;  2XME A;  4Y7F A;  2P6W A;  4G3S A;  1YP4 A;  5AJN A;  1ZJP A;  2BO7 A;  1G8O A;  5C4F A;  2BO6 A;  1GQC A;  1ON8 A;  1OQM B;  1S4N A;  4P02 A;  1FZW A;  2RJ9 A;  3PKP A;  1H5S A;  3CKJ A;  3I0E A;  4DDZ A;  3OGZ A;  5AJO A;  3OC9 A;  2O1F A;  3OAM A;  4FRA A;  1XZ6 A;  4B2X A;  1INJ A;  2Y4L A;  1W77 A;  4KNX A;  2ZU9 A;  2RJ8 A;  2PA4 A;  4DE7 A;  1G23 A;  2QH5 A;  1TW1 A;  4KRV A;  3IOH A;  1H4E A;  4FRO A;  1FR9 A;  2Y4K A;  4XWI A;  4Y9X A;  4B5B A;  2O1G A;  5CMJ A;  3RSB A;  5C4E A;  1H7E A;  1MP3 A;  4EVW A;  1V83 A;  5CMF X;  2OEF A;  1TVY A;  3O3P A;  4FRL A;  3SPT A;  2E8B A;  4ARW A;  2VSI A;  4B3U A;  4ECM A;  5C36 A;  3K8E A;  2QKX A;  3BRK X;  5C4B A;  5HS2 A;  3V0O A;  4FRH A;  1R80 A;  4NAK A;  4B4M A;  4MND A;  2I5E A;  4EEA A;  4CJ8 A;  1FXO A;  4KC1 A;  4LW6 A;  2XWM A;  3SXE A;  1NQI B;  4HO0 A;  4FRQ A;  3IOJ A;  1H5S D;  1WSZ A;  2RIX A;  1GWW A;  4NAL A;  1YP2 A;  2D0J A;  1PZY B;  4IRP A;  5EJZ A;  5CQP A;  3PKQ A;  3T7O A;  3I0H A;  1MC3 A;  2W0W A;  1NWG B;  4E1K A;  1H5T B;  1ZI1 A;  4KPX A;  2ICY A;  3ZGF A;  4KPZ A;  1MP4 A;  2Z86 A;  5FTV A;  3SX8 A;  3I0G A;  4EEO A;  3U0X A;  4KXO A;  4CJB A;  2YQJ A;  1FOA A;  3SX7 A;  2YQH A;  1ZI3 A;  4KC2 A;  5C3A A;  4Y64 A;  4ASJ A;  1VGU A;  4B2W A;  1JYL A;  1ZHJ A;  2Y7A A;  4GBP A;  3V8Z A;  4FRD A;  2APC A;  3BCV A;  3SXB A;  3U2U A;  2PGY A;  2Y4J A;  3V90 A;  5IFY A;  1ON6 A;  2P73 A;  1NKH B;  2AE7 A;  4Y7U A;  1FR8 A;  1JV1 A;  3U0Y A;  1HJJ A;  4HO5 A;  1O7Q A;  1WT3 A;  1G1L A;  2AES A;  2P72 A;  3SX3 A;  1FGG A;  3CKV A;  4FRB A;  2NXV A;  2O1H A;  2Z87 A;  1W57 A;  4HG6 A;  4Y6U A;  4EE4 A;  4P00 A;  4HO8 A;  4K6R A;  1H5R B;  2QGI A;  4EEM A;  1ZCV A;  2RJ6 A;  3CU0 A;  4HCQ A;  5C4C A;  3JUK A;  4D11 C;  3V91 A;  1O0R A;  3OH0 A;  3V8Y A;  2RJ5 A;  3I0K A;  4D11 A;  2GGO A;  2YC5 A;  3U2V A;  1GWV A;  4JIS A;  1H5S C;  3V0M A;  3D5N A;  1VH1 A;  5J49 A;  5CQN X;  1G97 A;  4LW3 A;  1H5T A;  1ZJ1 A;  3DK5 A;  1S4P A;  2ZU8 A;  3F1Y A;  3E26 A;  1H7G A;  4M4K A;  4CJC A;  2FY7 A;  4AC3 A;  1GQ9 A;  3Q7U A;  4B42 A;  3D98 A;  2BO8 A;  2AM3 A;  4HO3 A;  5C3B A;  4HO6 A;  5C49 A;  1EYR A;  1G9R A;  1VH3 A;  1K4V A;  5C8R A;  5EIY A;  3OH4 A;  1LL2 A;  4FRM A;  5L6V A;  2WVM A;  2RJ4 A;  1S4O A;  1H7H A;  2A8W A;  1V82 A;  4G87 A;  1FRW A;  2VS5 A;  4B4G A;  5FV9 A;  3T7N A;  2FFV A;  5DDV A;  4R7P A;  1E5K A;  1VGZ A;  1NF5 B;  1ZJ0 A;  2Y6P A;  1LZ7 A;  2VSH A;  1H5R A;  3V0P A;  3F1C A;  2E3D A;  3R2W A;  3R3I A;  1VZT A;  1HM0 A;  4M28 A;  1WT0 A;  2XWL A;  4Y7G A;  2PX7 A;  2WGZ A;  1IIM A;  1FXJ A;  2D7R A;  1VM8 A;  1H7Q A;  5AJP A;  1EZI A;  3SXA A;  1R82 A;  2YQS A;  2I7B A;  2FYB A;  5C1L A;  4C2S A;  1OMZ A;  1VZX A;  2RIT A;  1R81 A;  2WE9 A;  2CU2 A;  3RMW A;  2VS3 A;  1WT2 A;  3V0Q A;  1FO8 A;  1HM8 A;  3OH2 A;  5CQM X;  5IDS A;  1HM9 A;  1LVW A;  2I5K A;  3U2W A;  3Q4S A;  4AYJ A;  1MP5 A;  2YQC A;  4L41 C;  4AAW A;  2WAW A;  1QWJ A;  1JVD A;  1PZT A;  3JTJ A;  3U2T A;  4AYL A;  1JYK A;  3I0L A;  1H7T A;  1ZCU A;  1TZF A;  2YCM A;  5C47 A;  1R7Y A;  3CKN A;  3ZLL A;  3TQD A;  1IIN A;  3N9W A;  5EJ1 A;  1R7V A;  5C1G A;  3K8D A;  4Y63 A;  1ZCT A;  2BO4 A;  2MZB A;  3QVB A;  1OMX A;  3CKO A;  1H3M A;  4D0T A;  5FU8 A;  3ZF8 A;  1G2V A;  3OH3 A;  1NMM B;  1GA8 A;  1WVC A;  2ICX A;  4FRE A;  4HO2 A;  3E25 A;  2UX8 A;  3FWW A;  3SXC A;  2OI6 A;  1W55 A;  4G3P A;  4JD0 A;  2V0H A;  4HO4 A;  1LZJ A;  3DJ4 A;  2OI7 A;  2WVL A;  2XWN A;  3V0N A;  3TZT A;  2WEE A;  2W0V A;  4MYB A;  1QGQ A;  3LW6 A;  5FUH A;  3PNN A;  3D8V A;  2X60 A;  1R7T A;  3OH1 A;  5BXC A;  4EEG A;  4CVH A;  2XMH A;  3NGW A;  1VPA A;  4EE5 A;  1G0R A;  4DEC A;  1ZI5 A;  4Y7V A;  2AGD A;  1VZU A;  2VFZ A;  2YC3 A;  1TW5 A;  5FU0 A;  1H7F A;  1WT1 A;  3V0L A;  3FOQ A;  1GX4 A;  3USR A;  2V0K A;  1ZJ2 A;  2AH9 A;  4HO9 A;  5CQL X;  3I0F A;  1H4D A;  3ZLK A;  2V0I A;  4J18 A;  1O7O A;  4FRP A;  4M2B A;  1ZDG A;  5CQO A;  3T7M A;  3I0I X;  2RJ1 A;  1KWS A;  5IDT A;  1HJL A;  5DDT A;  1V84 A;  1R7U A;  2DPW A;  4YS8 A;  2VD4 A;  2X5S A;  1H7L A;  3OKR A;  2AM4 A;  3I0J A;  2RIY A;  3SX5 A;  4FCU A;  1R7X A;  2D7I A;  5JQQ A;  1XHB A;  1QGS A;  3CKQ A;  5C48 A;  2Q4J A;  5C1H A;  1VGW A;  5C4D A;  5FTS A;  4BMA A;  3KIA A;  2AEC A;  4KNR A;  4Y6N A;  1O23 B;  4EE3 A;  3SXD A;  3Q80 A;  1GX0 A;  2RIZ A;  4G3Q A;  4FCE A;  3USQ A;  2JCK A;  2X65 A;  1VGT A;  3I0D A;  2JCJ A;  1FG5 N; 
#chains in the Genus database with same CATH topology
 4BQH A;  2FYA A;  3RMV A;  4D0Z A;  2FFU A;  1G3L A;  1ZDF A;  4KT7 A;  2PGV A;  2X5Z A;  1ZIZ A;  4FQW A;  1LL0 A;  3IOI A;  1LZ0 A;  5CMG X;  4B4B A;  2VXM A;  4IRQ A;  2VS4 A;  3HL3 A;  4KC4 A;  2YES A;  3ZGG A;  4NAN A;  5CMH A;  2AM5 A;  3DUV A;  2VXL A;  4NAI A;  5I1F A;  3CGX A;  1LZI A;  2WVK A;  2JCL A;  3POL A;  1YP3 A;  1YRO B;  2FYD B;  2C0N A;  1G93 A;  1H5S B;  3ST8 A;  2ZU7 A;  2V0L A;  3U2X A;  1HV9 A;  1Z90 A;  5L6S A;  1JV3 A;  3EE5 A;  1NHE B;  2Y4M A;  4UEG A;  1SS9 A;  1H4C A;  2V0J A;  1LL3 A;  2RJ7 A;  1ZCY A;  2OI5 A;  4MIX A;  4D48 A;  1I52 A;  1QG8 A;  5FYE A;  5C3D A;  5C38 A;  3GUE A;  4HOC A;  2RJ0 A;  4Y62 A;  4KQL A;  1VIC A;  4ZDQ A;  2GGQ A;  1JVG A;  2A8U A;  4M2A A;  1ZI4 A;  1G95 A;  4ASY A;  2OEG A;  5CMI A;  1FO9 A;  2JCO A;  2FYC B;  3JUJ A;  3SXG A;  1ZJ3 A;  4Y7T A;  3I0C A;  1INI A;  1ZJO A;  1FGX A;  1FWY A;  2XME A;  4Y7F A;  2P6W A;  4G3S A;  1YP4 A;  5AJN A;  1ZJP A;  2BO7 A;  1G8O A;  5C4F A;  2BO6 A;  1GQC A;  1ON8 A;  1OQM B;  1S4N A;  4P02 A;  1FZW A;  2RJ9 A;  3PKP A;  1H5S A;  3CKJ A;  3I0E A;  4DDZ A;  3OGZ A;  5AJO A;  3OC9 A;  2O1F A;  3OAM A;  4FRA A;  1XZ6 A;  4B2X A;  1INJ A;  2Y4L A;  1W77 A;  4KNX A;  2ZU9 A;  2RJ8 A;  2PA4 A;  4DE7 A;  1G23 A;  2QH5 A;  1TW1 A;  4KRV A;  3IOH A;  4O6N A;  1H4E A;  4FRO A;  1FR9 A;  2Y4K A;  4XWI A;  4Y9X A;  4B5B A;  2O1G A;  5CMJ A;  3RSB A;  5C4E A;  1H7E A;  1MP3 A;  4EVW A;  1V83 A;  5CMF X;  2OEF A;  1TVY A;  3O3P A;  4FRL A;  3SPT A;  2E8B A;  4ARW A;  2VSI A;  4B3U A;  4ECM A;  5C36 A;  3K8E A;  2QKX A;  3BRK X;  5C4B A;  5HS2 A;  3V0O A;  4FRH A;  1R80 A;  4NAK A;  4B4M A;  4MND A;  2I5E A;  4EEA A;  4CJ8 A;  1FXO A;  4KC1 A;  4LW6 A;  2XWM A;  3SXE A;  1NQI B;  4HO0 A;  4FRQ A;  3IOJ A;  1H5S D;  1WSZ A;  2RIX A;  1GWW A;  4NAL A;  1YP2 A;  2D0J A;  1PZY B;  4IRP A;  5EJZ A;  5CQP A;  3PKQ A;  3T7O A;  3I0H A;  1MC3 A;  2W0W A;  1NWG B;  4E1K A;  1H5T B;  1ZI1 A;  4KPX A;  2ICY A;  3ZGF A;  4KPZ A;  1MP4 A;  2Z86 A;  5FTV A;  3SX8 A;  3I0G A;  4EEO A;  3U0X A;  4KXO A;  4CJB A;  2YQJ A;  1FOA A;  3SX7 A;  2YQH A;  1ZI3 A;  4KC2 A;  5C3A A;  4Y64 A;  4ASJ A;  1VGU A;  4B2W A;  1JYL A;  1ZHJ A;  2Y7A A;  4GBP A;  3V8Z A;  4FRD A;  4O6M A;  2APC A;  3BCV A;  3SXB A;  3U2U A;  2PGY A;  2Y4J A;  3V90 A;  5IFY A;  1ON6 A;  2P73 A;  1NKH B;  2AE7 A;  4Y7U A;  1FR8 A;  1JV1 A;  3U0Y A;  1HJJ A;  4HO5 A;  1O7Q A;  1WT3 A;  1G1L A;  2AES A;  2P72 A;  3SX3 A;  4FIY A;  1FGG A;  3CKV A;  4FRB A;  2NXV A;  2O1H A;  2Z87 A;  1W57 A;  4HG6 A;  4Y6U A;  4EE4 A;  4P00 A;  4HO8 A;  4K6R A;  1H5R B;  2QGI A;  4EEM A;  1ZCV A;  2RJ6 A;  3CU0 A;  4HCQ A;  5C4C A;  3JUK A;  4D11 C;  3V91 A;  1O0R A;  3OH0 A;  3V8Y A;  2RJ5 A;  3I0K A;  4D11 A;  2GGO A;  2YC5 A;  3U2V A;  1GWV A;  4JIS A;  1H5S C;  3V0M A;  3D5N A;  1VH1 A;  5J49 A;  5CQN X;  1G97 A;  4LW3 A;  1H5T A;  1ZJ1 A;  3DK5 A;  1S4P A;  2ZU8 A;  3F1Y A;  3E26 A;  1H7G A;  4M4K A;  4CJC A;  2FY7 A;  4AC3 A;  1GQ9 A;  3Q7U A;  4B42 A;  3D98 A;  2BO8 A;  2AM3 A;  4HO3 A;  5C3B A;  4HO6 A;  5C49 A;  1EYR A;  1G9R A;  1VH3 A;  1K4V A;  5C8R A;  5EIY A;  3OH4 A;  1LL2 A;  4FRM A;  5L6V A;  2WVM A;  2RJ4 A;  1S4O A;  1H7H A;  2A8W A;  1V82 A;  4G87 A;  1FRW A;  2VS5 A;  4B4G A;  5FV9 A;  3T7N A;  2FFV A;  5DDV A;  4R7P A;  1E5K A;  1VGZ A;  1NF5 B;  1ZJ0 A;  2Y6P A;  1LZ7 A;  2VSH A;  1H5R A;  3V0P A;  2VK9 A;  3F1C A;  2E3D A;  3R2W A;  3R3I A;  1VZT A;  1HM0 A;  4M28 A;  1WT0 A;  2XWL A;  4Y7G A;  2PX7 A;  2WGZ A;  1IIM A;  1FXJ A;  2D7R A;  1VM8 A;  1H7Q A;  5AJP A;  5D92 A;  1EZI A;  3SXA A;  1R82 A;  2YQS A;  2I7B A;  2FYB A;  5C1L A;  4C2S A;  1OMZ A;  1VZX A;  2RIT A;  1R81 A;  2WE9 A;  2CU2 A;  3RMW A;  2VS3 A;  1WT2 A;  3V0Q A;  1FO8 A;  1HM8 A;  3OH2 A;  5CQM X;  5IDS A;  1HM9 A;  1LVW A;  2I5K A;  3U2W A;  2J0B A;  4Q7C A;  3Q4S A;  4AYJ A;  1MP5 A;  2YQC A;  4L41 C;  4AAW A;  2WAW A;  1QWJ A;  1JVD A;  1PZT A;  3JTJ A;  3U2T A;  4AYL A;  1JYK A;  3I0L A;  1H7T A;  1ZCU A;  1TZF A;  2YCM A;  5C47 A;  1R7Y A;  3CKN A;  3ZLL A;  3TQD A;  1IIN A;  3N9W A;  5EJ1 A;  1R7V A;  5C1G A;  3K8D A;  4Y63 A;  1ZCT A;  2BO4 A;  2MZB A;  3QVB A;  1OMX A;  3CKO A;  1H3M A;  4D0T A;  5FU8 A;  3ZF8 A;  1G2V A;  3OH3 A;  1NMM B;  1GA8 A;  1WVC A;  2ICX A;  4FRE A;  4HO2 A;  3E25 A;  2UX8 A;  3FWW A;  3SXC A;  2OI6 A;  1W55 A;  4G3P A;  4JD0 A;  2V0H A;  4HO4 A;  1LZJ A;  3DJ4 A;  2OI7 A;  2WVL A;  2XWN A;  3V0N A;  3TZT A;  2WEE A;  2W0V A;  4MYB A;  1QGQ A;  3LW6 A;  5FUH A;  3PNN A;  3D8V A;  2X60 A;  1R7T A;  3OH1 A;  5BXC A;  4EEG A;  4CVH A;  2XMH A;  3NGW A;  1VPA A;  4EE5 A;  1G0R A;  4DEC A;  1ZI5 A;  4Y7V A;  2AGD A;  1VZU A;  2VFZ A;  2YC3 A;  4FIX A;  1TW5 A;  5FU0 A;  1H7F A;  1WT1 A;  3V0L A;  3FOQ A;  5D91 A;  1GX4 A;  3USR A;  2V0K A;  1ZJ2 A;  2AH9 A;  4HO9 A;  5CQL X;  3I0F A;  1H4D A;  3ZLK A;  2V0I A;  4J18 A;  1O7O A;  4FRP A;  4M2B A;  1ZDG A;  5CQO A;  2J0A A;  3T7M A;  3I0I X;  2RJ1 A;  1KWS A;  5IDT A;  1HJL A;  5DDT A;  1V84 A;  1R7U A;  2DPW A;  4YS8 A;  2VD4 A;  2X5S A;  1H7L A;  3OKR A;  2AM4 A;  3I0J A;  2RIY A;  3SX5 A;  4FCU A;  1R7X A;  2D7I A;  5JQQ A;  1XHB A;  1QGS A;  3CKQ A;  5C48 A;  2Q4J A;  5C1H A;  1VGW A;  5C4D A;  5FTS A;  4BMA A;  3KIA A;  2AEC A;  4KNR A;  4Y6N A;  1O23 B;  4EE3 A;  3SXD A;  3Q80 A;  1GX0 A;  2RIZ A;  4G3Q A;  4FCE A;  3USQ A;  2JCK A;  2X65 A;  1VGT A;  3I0D A;  2JCJ A;  1FG5 N; 
#chains in the Genus database with same CATH homology
 4BQH A;  2FYA A;  3RMV A;  4D0Z A;  2FFU A;  1G3L A;  1ZDF A;  4KT7 A;  2PGV A;  2X5Z A;  1ZIZ A;  4FQW A;  1LL0 A;  3IOI A;  1LZ0 A;  5CMG X;  4B4B A;  2VXM A;  4IRQ A;  2VS4 A;  3HL3 A;  4KC4 A;  2YES A;  3ZGG A;  4NAN A;  5CMH A;  2AM5 A;  3DUV A;  2VXL A;  4NAI A;  5I1F A;  3CGX A;  1LZI A;  2WVK A;  2JCL A;  3POL A;  1YP3 A;  1YRO B;  2FYD B;  2C0N A;  1G93 A;  1H5S B;  3ST8 A;  2ZU7 A;  2V0L A;  3U2X A;  1HV9 A;  1Z90 A;  5L6S A;  1JV3 A;  3EE5 A;  1NHE B;  2Y4M A;  4UEG A;  1SS9 A;  1H4C A;  2V0J A;  1LL3 A;  2RJ7 A;  1ZCY A;  2OI5 A;  4MIX A;  4D48 A;  1I52 A;  1QG8 A;  5FYE A;  5C3D A;  5C38 A;  3GUE A;  4HOC A;  2RJ0 A;  4Y62 A;  4KQL A;  1VIC A;  4ZDQ A;  2GGQ A;  1JVG A;  2A8U A;  4M2A A;  1ZI4 A;  1G95 A;  4ASY A;  2OEG A;  5CMI A;  1FO9 A;  2JCO A;  2FYC B;  3JUJ A;  3SXG A;  1ZJ3 A;  4Y7T A;  3I0C A;  1INI A;  1ZJO A;  1FGX A;  1FWY A;  2XME A;  4Y7F A;  2P6W A;  4G3S A;  1YP4 A;  5AJN A;  1ZJP A;  2BO7 A;  1G8O A;  5C4F A;  2BO6 A;  1GQC A;  1ON8 A;  1OQM B;  1S4N A;  4P02 A;  1FZW A;  2RJ9 A;  3PKP A;  1H5S A;  3CKJ A;  3I0E A;  4DDZ A;  3OGZ A;  5AJO A;  3OC9 A;  2O1F A;  3OAM A;  4FRA A;  1XZ6 A;  4B2X A;  1INJ A;  2Y4L A;  1W77 A;  4KNX A;  2ZU9 A;  2RJ8 A;  2PA4 A;  4DE7 A;  1G23 A;  2QH5 A;  1TW1 A;  4KRV A;  3IOH A;  4O6N A;  1H4E A;  4FRO A;  1FR9 A;  2Y4K A;  4XWI A;  4Y9X A;  4B5B A;  2O1G A;  5CMJ A;  3RSB A;  5C4E A;  1H7E A;  1MP3 A;  4EVW A;  1V83 A;  5CMF X;  2OEF A;  1TVY A;  3O3P A;  4FRL A;  3SPT A;  2E8B A;  4ARW A;  2VSI A;  4B3U A;  4ECM A;  5C36 A;  3K8E A;  2QKX A;  3BRK X;  5C4B A;  5HS2 A;  3V0O A;  4FRH A;  1R80 A;  4NAK A;  4B4M A;  4MND A;  2I5E A;  4EEA A;  4CJ8 A;  1FXO A;  4KC1 A;  4LW6 A;  2XWM A;  3SXE A;  1NQI B;  4HO0 A;  4FRQ A;  3IOJ A;  1H5S D;  1WSZ A;  2RIX A;  1GWW A;  4NAL A;  1YP2 A;  2D0J A;  1PZY B;  4IRP A;  5EJZ A;  5CQP A;  3PKQ A;  3T7O A;  3I0H A;  1MC3 A;  2W0W A;  1NWG B;  4E1K A;  1H5T B;  1ZI1 A;  4KPX A;  2ICY A;  3ZGF A;  4KPZ A;  1MP4 A;  2Z86 A;  5FTV A;  3SX8 A;  3I0G A;  4EEO A;  3U0X A;  4KXO A;  4CJB A;  2YQJ A;  1FOA A;  3SX7 A;  2YQH A;  1ZI3 A;  4KC2 A;  5C3A A;  4Y64 A;  4ASJ A;  1VGU A;  4B2W A;  1JYL A;  1ZHJ A;  2Y7A A;  4GBP A;  3V8Z A;  4FRD A;  4O6M A;  2APC A;  3BCV A;  3SXB A;  3U2U A;  2PGY A;  2Y4J A;  3V90 A;  5IFY A;  1ON6 A;  2P73 A;  1NKH B;  2AE7 A;  4Y7U A;  1FR8 A;  1JV1 A;  3U0Y A;  1HJJ A;  4HO5 A;  1O7Q A;  1WT3 A;  1G1L A;  2AES A;  2P72 A;  3SX3 A;  4FIY A;  1FGG A;  3CKV A;  4FRB A;  2NXV A;  2O1H A;  2Z87 A;  1W57 A;  4HG6 A;  4Y6U A;  4EE4 A;  4P00 A;  4HO8 A;  4K6R A;  1H5R B;  2QGI A;  4EEM A;  1ZCV A;  2RJ6 A;  3CU0 A;  4HCQ A;  5C4C A;  3JUK A;  4D11 C;  3V91 A;  1O0R A;  3OH0 A;  3V8Y A;  2RJ5 A;  3I0K A;  4D11 A;  2GGO A;  2YC5 A;  3U2V A;  1GWV A;  4JIS A;  1H5S C;  3V0M A;  3D5N A;  1VH1 A;  5J49 A;  5CQN X;  1G97 A;  4LW3 A;  1H5T A;  1ZJ1 A;  3DK5 A;  1S4P A;  2ZU8 A;  3F1Y A;  3E26 A;  1H7G A;  4M4K A;  4CJC A;  2FY7 A;  4AC3 A;  1GQ9 A;  3Q7U A;  4B42 A;  3D98 A;  2BO8 A;  2AM3 A;  4HO3 A;  5C3B A;  4HO6 A;  5C49 A;  1EYR A;  1G9R A;  1VH3 A;  1K4V A;  5C8R A;  5EIY A;  3OH4 A;  1LL2 A;  4FRM A;  5L6V A;  2WVM A;  2RJ4 A;  1S4O A;  1H7H A;  2A8W A;  1V82 A;  4G87 A;  1FRW A;  2VS5 A;  4B4G A;  5FV9 A;  3T7N A;  2FFV A;  5DDV A;  4R7P A;  1E5K A;  1VGZ A;  1NF5 B;  1ZJ0 A;  2Y6P A;  1LZ7 A;  2VSH A;  1H5R A;  3V0P A;  2VK9 A;  3F1C A;  2E3D A;  3R2W A;  3R3I A;  1VZT A;  1HM0 A;  4M28 A;  1WT0 A;  2XWL A;  4Y7G A;  2PX7 A;  2WGZ A;  1IIM A;  1FXJ A;  2D7R A;  1VM8 A;  1H7Q A;  5AJP A;  5D92 A;  1EZI A;  3SXA A;  1R82 A;  2YQS A;  2I7B A;  2FYB A;  5C1L A;  4C2S A;  1OMZ A;  1VZX A;  2RIT A;  1R81 A;  2WE9 A;  2CU2 A;  3RMW A;  2VS3 A;  1WT2 A;  3V0Q A;  1FO8 A;  1HM8 A;  3OH2 A;  5CQM X;  5IDS A;  1HM9 A;  1LVW A;  2I5K A;  3U2W A;  2J0B A;  4Q7C A;  3Q4S A;  4AYJ A;  1MP5 A;  2YQC A;  4L41 C;  4AAW A;  2WAW A;  1QWJ A;  1JVD A;  1PZT A;  3JTJ A;  3U2T A;  4AYL A;  1JYK A;  3I0L A;  1H7T A;  1ZCU A;  1TZF A;  2YCM A;  5C47 A;  1R7Y A;  3CKN A;  3ZLL A;  3TQD A;  1IIN A;  3N9W A;  5EJ1 A;  1R7V A;  5C1G A;  3K8D A;  4Y63 A;  1ZCT A;  2BO4 A;  2MZB A;  3QVB A;  1OMX A;  3CKO A;  1H3M A;  4D0T A;  5FU8 A;  3ZF8 A;  1G2V A;  3OH3 A;  1NMM B;  1GA8 A;  1WVC A;  2ICX A;  4FRE A;  4HO2 A;  3E25 A;  2UX8 A;  3FWW A;  3SXC A;  2OI6 A;  1W55 A;  4G3P A;  4JD0 A;  2V0H A;  4HO4 A;  1LZJ A;  3DJ4 A;  2OI7 A;  2WVL A;  2XWN A;  3V0N A;  3TZT A;  2WEE A;  2W0V A;  4MYB A;  1QGQ A;  3LW6 A;  5FUH A;  3PNN A;  3D8V A;  2X60 A;  1R7T A;  3OH1 A;  5BXC A;  4EEG A;  4CVH A;  2XMH A;  3NGW A;  1VPA A;  4EE5 A;  1G0R A;  4DEC A;  1ZI5 A;  4Y7V A;  2AGD A;  1VZU A;  2VFZ A;  2YC3 A;  4FIX A;  1TW5 A;  5FU0 A;  1H7F A;  1WT1 A;  3V0L A;  3FOQ A;  5D91 A;  1GX4 A;  3USR A;  2V0K A;  1ZJ2 A;  2AH9 A;  4HO9 A;  5CQL X;  3I0F A;  1H4D A;  3ZLK A;  2V0I A;  4J18 A;  1O7O A;  4FRP A;  4M2B A;  1ZDG A;  5CQO A;  2J0A A;  3T7M A;  3I0I X;  2RJ1 A;  1KWS A;  5IDT A;  1HJL A;  5DDT A;  1V84 A;  1R7U A;  2DPW A;  4YS8 A;  2VD4 A;  2X5S A;  1H7L A;  3OKR A;  2AM4 A;  3I0J A;  2RIY A;  3SX5 A;  4FCU A;  1R7X A;  2D7I A;  5JQQ A;  1XHB A;  1QGS A;  3CKQ A;  5C48 A;  2Q4J A;  5C1H A;  1VGW A;  5C4D A;  5FTS A;  4BMA A;  3KIA A;  2AEC A;  4KNR A;  4Y6N A;  1O23 B;  4EE3 A;  3SXD A;  3Q80 A;  1GX0 A;  2RIZ A;  4G3Q A;  4FCE A;  3USQ A;  2JCK A;  2X65 A;  1VGT A;  3I0D A;  2JCJ A;  1FG5 N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...