4EEMA

Crystal structure of human m340h-beta-1,4-galactosyltransferase-1 (m340h-b4gal-t1) in complex with glcnac-beta1,6-man-alpha-methyl
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
273
structure length
273
Chain Sequence
SLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGTTRHIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Beta-1,4-galactosyltransferase 1
publication title Binding of N-acetylglucosamine (GlcNAc) beta 1-6-branched oligosaccharide acceptors to beta 4-galactosyltransferase I reveals a new ligand binding mode.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 273
sequence length 273
chains with identical sequence B, C
ec nomenclature ec 2.4.1.22: Lactose synthase.
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02709 Glyco_transf_7C N-terminal domain of galactosyltransferase
A PF13733 Glyco_transf_7N N-terminal region of glycosyl transferase group 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4eemA00
1W77A 1VZUA 1HM0A 1ZI3A 2O1HA 2BO6A 2P72A 1NF5B 1ZCUA 1ZJOA 2YCMA 2YESA 3OH2A 3U0YA 2RJ4A 3CKJA 2I7BA 1LZIA 3RMWA 2P6WA 3SXBA 1G2VA 1H5SB 4D11C 4HO0A 3V0PA 3ZF8A 4LW3A 2X5SA 2JCLA 1YROB 3R2WA 2BO7A 1FXOA 3RMVA 1FXJA 1G9RA 2VS4A 3DJ4A 3V0OA 3NGWA 3LW6A 5BXCA 2WEEA 4HO6A 4Y6UA 3U0XA 2FY7A 3V90A 1MP5A 1GX4A 5C47A 3CKQA 4R7PA 3ZLKA 3BRKX 1G8OA 4AYLA 2Y4LA 2WE9A 2YQSA 1IIMA 2OI6A 1FR9A 1YP3A 3CGXA 1JYKA 2NXVA 3ST8A 4L41C 4B2XA 4KNRA 5EJ1A 5AJPA 1ZCTA 1MC3A 2I5EA 3U2XA 1TW1A 1ZDGA 2QKXA 1S4OA 2X60A 2QH5A 3OH3A 1WSZA 5IFYA 1GA8A 4KC1A 1XZ6A 1YP2A 4XWIA 1ZJ2A 1VM8A 4KC2A 4G3SA 2RIYA 3F1CA 1LZ7A 1FRWA 2JCOA 3N9WA 3I0JA 5AJOA 1R7TA 4FRHA 4D11A 3D98A 5AJNA 4KPXA 4P00A 4ASJA 5C3DA 3IOJA 5C4BA 2I5KA 1NQIB 4Y9XA 2X5ZA 2ZU9A 3V0LA 1H7FA 4JD0A 1VGTA 2Q4JA 3O3PA 3I0EA 2Y4MA 1S4PA 3DUVA 3I0KA 1KWSA 4FREA 4JISA 4ZDQA 1H3MA 3ZGGA 4B4MA 2Y6PA 3I0CA 4FQWA 1VH3A 5I1FA 4EE5A 4HG6A 1W55A 1H5SA 2P73A 1GQCA 2WGZA 2APCA 1EZIA 1FZWA 1LL3A 1VH1A 1H5SD 1NHEB 4NAIA 2GGQA 5L6SA 1ZDFA 3RSBA 3OAMA 1O7OA 2RIZA 4LW6A 2FYBA 2AM5A 3U2TA 5C1GA 2CU2A 4CJCA 4E1KA 4BMAA 4M4KA 2JCJA 4GBPA 4CJBA 4B4BA 1OQMB 1HM9A 4G87A 3PKQA 5FUHA 3Q7UA 4K6RA 3FOQA 2ZU8A 4Y64A 5C49A 1H7TA 1ZI1A 1OMZA 2X65A 1PZYB 2FYDB 5FTVA 1LZJA 3F1YA 3V0MA 2RJ9A 1WT3A 3U2WA 3V0NA 2VD4A 4MYBA 2VS3A 2AESA 5FU8A 5C4DA 4D0ZA 1VPAA 2VSHA 5JQQA 2OI5A 5CMGX 2AM3A 4ARWA 3SXEA 3V0QA 1H4EA 4Y7UA 1JV1A 2ICYA 1V83A 1H4CA 2YQJA 1LZ0A 4FRAA 4DECA 4FCUA 1WT1A 5C38A 5FV9A 1VGUA 1G3LA 5DDTA 4DE7A 1R7VA 1I52A 4C2SA 2RJ6A 1JVGA 1H5SC 4NALA 3PKPA 1JV3A 3E26A 4FRQA 5C3AA 2O1FA 4KPZA 4KRVA 3CKOA 5IDSA 4FRPA 2VS5A 1FOAA 5CQLX 1FGXA 3I0GA 3I0DA 1GQ9A 2Z87A 1ZJ1A 2XWMA 1K4VA 1R81A 2YC3A 3JUKA 4YS8A 4EEMA 4NAKA 5EIYA 4Y7VA 4B3UA 1VGWA 4AAWA 1FGGA 2BO4A 1G95A 1NKHB 1H7GA 2PA4A 3BCVA 3I0LA 1H7HA 1Z90A 3JUJA 3OKRA 4EE3A 5CMIA 2A8UA 3KIAA 1G97A 1O23B 1LL0A 2RJ8A 4UEGA 1WVCA 1MP4A 5C4FA 2DPWA 5CMFX 3PNNA 3DK5A 1ZCVA 5L6VA 1ZHJA 4HO9A 1QGQA 4B42A 2E3DA 4Y63A 1INIA 1GWWA 1ZI5A 2A8WA 2XMEA 1HJLA 2Z86A 3K8DA 2VXMA 3SX3A 4HOCA 3T7NA 5HS2A 1HM8A 1LL2A 3OH1A 3HL3A 3IOHA 4M28A 2PX7A 1ON8A 1O7QA 4FRDA 3V91A 2Y7AA 2FFUA 2Y4JA 1FO8A 1H5TA 4IRQA 3E25A 4HO3A 3USRA 3TQDA 1ZJPA 4CVHA 5C48A 2YQHA 3TZTA 1VZTA 4FRBA 1G23A 2AH9A 2AE7A 4EEOA 2V0LA 2RJ1A 2VFZA 3V8YA 2XMHA 4Y7GA 1R7XA 3U2UA 3EE5A 2AM4A 3R3IA 1H7EA 3SXAA 3CKNA 2XWNA 3USQA 3SX5A 4AC3A 4EE4A 5C8RA 1FWYA 4HO5A 1ZCYA 4Y62A 3GUEA 3JTJA 1V82A 1SS9A 2BO8A 4J18A 4IRPA 1R7YA 2FFVA 3I0FA 4NANA 5FTSA 5IDTA 5C1HA 1OMXA 1R80A 2V0HA 1O0RA 4M2AA 5FU0A 2VXLA 1JVDA 1VGZA 3SXDA 4DDZA 1H4DA 3V8ZA 1H5TB 4FCEA 1W57A 2WVLA 4D0TA 2VSIA 4HO8A 4G3QA 4KT7A 1FR8A 1H7QA 1H7LA 4D48A 1MP3A 4KXOA 1INJA 2AECA 2D0JA 4KQLA 5FYEA 2GGOA 3SXCA 4B5BA 4ASYA 4MNDA 2UX8A 3T7MA 5J49A 5C4CA 1TZFA 3U2VA 4FRMA 3CU0A 2XWLA 3OGZA 3SXGA 2E8BA 4EVWA 1WT2A 1HJJA 3POLA 4P02A 1ZJ3A 4G3PA 4KNXA 2RIXA 1VICA 2MZBA 1ZI4A 3Q4SA 2W0VA 1H5RA 1QG8A 2V0JA 1LVWA 4EEGA 3K8EA 1XHBA 2WVMA 2OI7A 2Y4KA 1WT0A 2RJ5A 3Q80A 1EYRA 1IINA 1ZIZA 2WAWA 3QVBA 1G93A 4HO2A 2O1GA 2RJ0A 5C36A 3FWWA 2QGIA 3SX8A 4HCQA 1YP4A 3OC9A 3CKVA 2OEFA 1NWGB 4EEAA 5C1LA 3ZLLA 1HV9A 5CQOA 3SPTA 4ECMA 1GX0A 1JYLA 1PZTA 4Y7FA 4B2WA 2D7RA 5CMJA 1G1LA 2RITA 2RJ7A 4Y6NA 1GWVA 1FG5N 3I0IX 3D5NA 5C4EA 1S4NA 1VZXA 2W0WA 4M2BA 1H5RB 1TW5A 2FYAA 4BQHA 2AGDA 5DDVA 5CMHA 1NMMB 2D7IA 5C3BA 1QGSA 2YC5A 1G0RA 1FO9A 5CQNX 2V0IA 4HO4A 3OH0A 1TVYA 2V0KA 3IOIA 1QWJA 1ON6A 4CJ8A 2ZU7A 3ZGFA 2ICXA 4Y7TA 2PGYA 2OEGA 2WVKA 4FRLA 3T7OA 5CQMX 2PGVA 5CQPA 1R7UA 1R82A 3SX7A 3D8VA 1E5KA 3OH4A 2FYCB 2YQCA 5EJZA 3I0HA 1ZJ0A 4B4GA 4KC4A 4FROA 1V84A 4AYJA 2JCKA
chains in the Genus database with same CATH superfamily
1W77A 1VZUA 1HM0A 1ZI3A 2O1HA 2BO6A 2P72A 1NF5B 1ZCUA 1ZJOA 2YCMA 2YESA 3OH2A 3U0YA 2RJ4A 3CKJA 2I7BA 1LZIA 3RMWA 2P6WA 3SXBA 1G2VA 1H5SB 4D11C 4HO0A 3V0PA 2C0NA 3ZF8A 4LW3A 2X5SA 2JCLA 1YROB 3R2WA 2BO7A 1FXOA 3RMVA 1FXJA 1G9RA 2VS4A 3DJ4A 3V0OA 3NGWA 3LW6A 5BXCA 2WEEA 4HO6A 4Y6UA 3U0XA 2FY7A 3V90A 1MP5A 1GX4A 5C47A 3CKQA 4R7PA 3ZLKA 3BRKX 1G8OA 4AYLA 2Y4LA 2WE9A 2YQSA 1IIMA 2OI6A 1FR9A 1YP3A 3CGXA 1JYKA 2NXVA 3ST8A 4L41C 4B2XA 4KNRA 5EJ1A 5AJPA 1ZCTA 1MC3A 2I5EA 3U2XA 1TW1A 1ZDGA 4FIXA 2QKXA 1S4OA 2X60A 2QH5A 3OH3A 1WSZA 5IFYA 1GA8A 4KC1A 1XZ6A 1YP2A 4XWIA 1ZJ2A 1VM8A 4FIYA 4KC2A 4G3SA 2RIYA 3F1CA 1LZ7A 1FRWA 2JCOA 3N9WA 3I0JA 5AJOA 1R7TA 4FRHA 4D11A 3D98A 5AJNA 4KPXA 4P00A 4ASJA 5C3DA 3IOJA 5C4BA 2I5KA 1NQIB 4Y9XA 2X5ZA 2ZU9A 3V0LA 1H7FA 4JD0A 1VGTA 2Q4JA 3O3PA 3I0EA 2Y4MA 1S4PA 3DUVA 3I0KA 1KWSA 4FREA 4JISA 4ZDQA 1H3MA 3ZGGA 4O6MA 4B4MA 2Y6PA 3I0CA 4FQWA 1VH3A 5I1FA 4EE5A 4HG6A 1W55A 1H5SA 2P73A 1GQCA 2WGZA 2APCA 1EZIA 1FZWA 1LL3A 1VH1A 1H5SD 1NHEB 4NAIA 2GGQA 5L6SA 1ZDFA 3RSBA 3OAMA 1O7OA 2RIZA 4LW6A 2FYBA 2AM5A 3U2TA 5C1GA 2CU2A 4CJCA 4E1KA 4BMAA 4M4KA 2JCJA 4GBPA 4CJBA 4B4BA 1OQMB 1HM9A 4G87A 3PKQA 5FUHA 3Q7UA 4K6RA 3FOQA 2ZU8A 4Y64A 5C49A 1H7TA 1ZI1A 1OMZA 2X65A 1PZYB 2FYDB 5FTVA 1LZJA 3F1YA 3V0MA 2RJ9A 1WT3A 3U2WA 3V0NA 2VD4A 4MYBA 2VS3A 2AESA 5FU8A 5C4DA 4D0ZA 1VPAA 2VSHA 5JQQA 2OI5A 5D91A 5CMGX 2AM3A 4ARWA 3SXEA 3V0QA 1H4EA 4Y7UA 1JV1A 2ICYA 1V83A 1H4CA 2YQJA 1LZ0A 4FRAA 2J0AA 4DECA 4FCUA 1WT1A 5C38A 5FV9A 1VGUA 1G3LA 5DDTA 4DE7A 1R7VA 1I52A 4C2SA 2RJ6A 1JVGA 1H5SC 4NALA 3PKPA 1JV3A 3E26A 4FRQA 5C3AA 2O1FA 4KPZA 4KRVA 3CKOA 5IDSA 4FRPA 2VS5A 1FOAA 5CQLX 1FGXA 3I0GA 3I0DA 1GQ9A 2Z87A 1ZJ1A 2XWMA 1K4VA 1R81A 2YC3A 3JUKA 4YS8A 4EEMA 4NAKA 5EIYA 4Y7VA 4B3UA 1VGWA 4AAWA 1FGGA 2BO4A 1G95A 1NKHB 1H7GA 2PA4A 3BCVA 3I0LA 1H7HA 1Z90A 3JUJA 3OKRA 4EE3A 5CMIA 2A8UA 3KIAA 1G97A 1O23B 1LL0A 2RJ8A 4UEGA 1WVCA 1MP4A 5C4FA 2DPWA 5CMFX 3PNNA 3DK5A 1ZCVA 5L6VA 1ZHJA 4HO9A 1QGQA 4B42A 2E3DA 4Y63A 1INIA 1GWWA 1ZI5A 2A8WA 2XMEA 1HJLA 2Z86A 3K8DA 2VXMA 3SX3A 4HOCA 5D92A 3T7NA 5HS2A 1HM8A 1LL2A 3OH1A 3HL3A 3IOHA 4M28A 2PX7A 1ON8A 1O7QA 4FRDA 3V91A 2Y7AA 2FFUA 2Y4JA 1FO8A 1H5TA 4IRQA 3E25A 4HO3A 3USRA 3TQDA 1ZJPA 4CVHA 5C48A 2YQHA 3TZTA 1VZTA 4FRBA 1G23A 2AH9A 2AE7A 4EEOA 2V0LA 2RJ1A 2VFZA 3V8YA 2XMHA 4Y7GA 1R7XA 3U2UA 3EE5A 2AM4A 3R3IA 1H7EA 3SXAA 3CKNA 2XWNA 3USQA 3SX5A 4AC3A 4EE4A 5C8RA 1FWYA 4HO5A 1ZCYA 4Y62A 3GUEA 3JTJA 1V82A 4O6NA 1SS9A 2BO8A 4J18A 4IRPA 1R7YA 2FFVA 3I0FA 4NANA 5FTSA 5IDTA 5C1HA 1OMXA 1R80A 2V0HA 1O0RA 4M2AA 5FU0A 2VXLA 1JVDA 1VGZA 3SXDA 4DDZA 1H4DA 3V8ZA 1H5TB 4FCEA 1W57A 2WVLA 4D0TA 2VSIA 4HO8A 4G3QA 4KT7A 1FR8A 1H7QA 1H7LA 4D48A 1MP3A 4KXOA 1INJA 2AECA 2D0JA 4KQLA 5FYEA 2GGOA 3SXCA 4B5BA 4ASYA 4MNDA 2UX8A 3T7MA 5J49A 5C4CA 1TZFA 3U2VA 4FRMA 3CU0A 2XWLA 3OGZA 3SXGA 2E8BA 4EVWA 1WT2A 1HJJA 3POLA 4P02A 1ZJ3A 4G3PA 4KNXA 2RIXA 1VICA 2MZBA 1ZI4A 3Q4SA 2W0VA 1H5RA 1QG8A 2V0JA 1LVWA 4EEGA 3K8EA 1XHBA 2WVMA 2OI7A 2Y4KA 4Q7CA 1WT0A 2RJ5A 3Q80A 1EYRA 1IINA 1ZIZA 2WAWA 3QVBA 2VK9A 1G93A 4HO2A 2O1GA 2RJ0A 5C36A 3FWWA 2QGIA 3SX8A 4HCQA 1YP4A 3OC9A 3CKVA 2OEFA 1NWGB 4EEAA 5C1LA 3ZLLA 1HV9A 5CQOA 3SPTA 4ECMA 1GX0A 1JYLA 1PZTA 4Y7FA 4B2WA 2D7RA 4MIXA 5CMJA 1G1LA 2RITA 2RJ7A 4Y6NA 1GWVA 1FG5N 3I0IX 3D5NA 5C4EA 1S4NA 1VZXA 2W0WA 4M2BA 1H5RB 1TW5A 2FYAA 4BQHA 2AGDA 5DDVA 5CMHA 1NMMB 2D7IA 5C3BA 1QGSA 2YC5A 1G0RA 1FO9A 5CQNX 2V0IA 4HO4A 3OH0A 1TVYA 2V0KA 3IOIA 1QWJA 1ON6A 4CJ8A 2ZU7A 3ZGFA 2ICXA 4Y7TA 2PGYA 2OEGA 2WVKA 4FRLA 3T7OA 5CQMX 2PGVA 5CQPA 1R7UA 1R82A 3SX7A 3D8VA 1E5KA 3OH4A 2FYCB 2YQCA 5EJZA 3I0HA 1ZJ0A 2J0BA 4B4GA 4KC4A 4FROA 1V84A 4AYJA 2JCKA
chains in the Genus database with same CATH topology
1W77A 1VZUA 1HM0A 1ZI3A 2O1HA 2BO6A 2P72A 1NF5B 1ZCUA 1ZJOA 2YCMA 2YESA 3OH2A 3U0YA 2RJ4A 3CKJA 2I7BA 1LZIA 3RMWA 2P6WA 3SXBA 1G2VA 1H5SB 4D11C 4HO0A 3V0PA 2C0NA 3ZF8A 4LW3A 2X5SA 2JCLA 1YROB 3R2WA 2BO7A 1FXOA 3RMVA 1FXJA 1G9RA 2VS4A 3DJ4A 3V0OA 3NGWA 3LW6A 5BXCA 2WEEA 4HO6A 4Y6UA 3U0XA 2FY7A 3V90A 1MP5A 1GX4A 5C47A 3CKQA 4R7PA 3ZLKA 3BRKX 1G8OA 4AYLA 2Y4LA 2WE9A 2YQSA 1IIMA 2OI6A 1FR9A 1YP3A 3CGXA 1JYKA 2NXVA 3ST8A 4L41C 4B2XA 4KNRA 5EJ1A 5AJPA 1ZCTA 1MC3A 2I5EA 3U2XA 1TW1A 1ZDGA 4FIXA 2QKXA 1S4OA 2X60A 2QH5A 3OH3A 1WSZA 5IFYA 1GA8A 4KC1A 1XZ6A 1YP2A 4XWIA 1ZJ2A 1VM8A 4FIYA 4KC2A 4G3SA 2RIYA 3F1CA 1LZ7A 1FRWA 2JCOA 3N9WA 3I0JA 5AJOA 1R7TA 4FRHA 4D11A 3D98A 5AJNA 4KPXA 4P00A 4ASJA 5C3DA 3IOJA 5C4BA 2I5KA 1NQIB 4Y9XA 2X5ZA 2ZU9A 3V0LA 1H7FA 4JD0A 1VGTA 2Q4JA 3O3PA 3I0EA 2Y4MA 1S4PA 3DUVA 3I0KA 1KWSA 4FREA 4JISA 4ZDQA 1H3MA 3ZGGA 4O6MA 4B4MA 2Y6PA 3I0CA 4FQWA 1VH3A 5I1FA 4EE5A 4HG6A 1W55A 1H5SA 2P73A 1GQCA 2WGZA 2APCA 1EZIA 1FZWA 1LL3A 1VH1A 1H5SD 1NHEB 4NAIA 2GGQA 5L6SA 1ZDFA 3RSBA 3OAMA 1O7OA 2RIZA 4LW6A 2FYBA 2AM5A 3U2TA 5C1GA 2CU2A 4CJCA 4E1KA 4BMAA 4M4KA 2JCJA 4GBPA 4CJBA 4B4BA 1OQMB 1HM9A 4G87A 3PKQA 5FUHA 3Q7UA 4K6RA 3FOQA 2ZU8A 4Y64A 5C49A 1H7TA 1ZI1A 1OMZA 2X65A 1PZYB 2FYDB 5FTVA 1LZJA 3F1YA 3V0MA 2RJ9A 1WT3A 3U2WA 3V0NA 2VD4A 4MYBA 2VS3A 2AESA 5FU8A 5C4DA 4D0ZA 1VPAA 2VSHA 5JQQA 2OI5A 5D91A 5CMGX 2AM3A 4ARWA 3SXEA 3V0QA 1H4EA 4Y7UA 1JV1A 2ICYA 1V83A 1H4CA 2YQJA 1LZ0A 4FRAA 2J0AA 4DECA 4FCUA 1WT1A 5C38A 5FV9A 1VGUA 1G3LA 5DDTA 4DE7A 1R7VA 1I52A 4C2SA 2RJ6A 1JVGA 1H5SC 4NALA 3PKPA 1JV3A 3E26A 4FRQA 5C3AA 2O1FA 4KPZA 4KRVA 3CKOA 5IDSA 4FRPA 2VS5A 1FOAA 5CQLX 1FGXA 3I0GA 3I0DA 1GQ9A 2Z87A 1ZJ1A 2XWMA 1K4VA 1R81A 2YC3A 3JUKA 4YS8A 4EEMA 4NAKA 5EIYA 4Y7VA 4B3UA 1VGWA 4AAWA 1FGGA 2BO4A 1G95A 1NKHB 1H7GA 2PA4A 3BCVA 3I0LA 1H7HA 1Z90A 3JUJA 3OKRA 4EE3A 5CMIA 2A8UA 3KIAA 1G97A 1O23B 1LL0A 2RJ8A 4UEGA 1WVCA 1MP4A 5C4FA 2DPWA 5CMFX 3PNNA 3DK5A 1ZCVA 5L6VA 1ZHJA 4HO9A 1QGQA 4B42A 2E3DA 4Y63A 1INIA 1GWWA 1ZI5A 2A8WA 2XMEA 1HJLA 2Z86A 3K8DA 2VXMA 3SX3A 4HOCA 5D92A 3T7NA 5HS2A 1HM8A 1LL2A 3OH1A 3HL3A 3IOHA 4M28A 2PX7A 1ON8A 1O7QA 4FRDA 3V91A 2Y7AA 2FFUA 2Y4JA 1FO8A 1H5TA 4IRQA 3E25A 4HO3A 3USRA 3TQDA 1ZJPA 4CVHA 5C48A 2YQHA 3TZTA 1VZTA 4FRBA 1G23A 2AH9A 2AE7A 4EEOA 2V0LA 2RJ1A 2VFZA 3V8YA 2XMHA 4Y7GA 1R7XA 3U2UA 3EE5A 2AM4A 3R3IA 1H7EA 3SXAA 3CKNA 2XWNA 3USQA 3SX5A 4AC3A 4EE4A 5C8RA 1FWYA 4HO5A 1ZCYA 4Y62A 3GUEA 3JTJA 1V82A 4O6NA 1SS9A 2BO8A 4J18A 4IRPA 1R7YA 2FFVA 3I0FA 4NANA 5FTSA 5IDTA 5C1HA 1OMXA 1R80A 2V0HA 1O0RA 4M2AA 5FU0A 2VXLA 1JVDA 1VGZA 3SXDA 4DDZA 1H4DA 3V8ZA 1H5TB 4FCEA 1W57A 2WVLA 4D0TA 2VSIA 4HO8A 4G3QA 4KT7A 1FR8A 1H7QA 1H7LA 4D48A 1MP3A 4KXOA 1INJA 2AECA 2D0JA 4KQLA 5FYEA 2GGOA 3SXCA 4B5BA 4ASYA 4MNDA 2UX8A 3T7MA 5J49A 5C4CA 1TZFA 3U2VA 4FRMA 3CU0A 2XWLA 3OGZA 3SXGA 2E8BA 4EVWA 1WT2A 1HJJA 3POLA 4P02A 1ZJ3A 4G3PA 4KNXA 2RIXA 1VICA 2MZBA 1ZI4A 3Q4SA 2W0VA 1H5RA 1QG8A 2V0JA 1LVWA 4EEGA 3K8EA 1XHBA 2WVMA 2OI7A 2Y4KA 4Q7CA 1WT0A 2RJ5A 3Q80A 1EYRA 1IINA 1ZIZA 2WAWA 3QVBA 2VK9A 1G93A 4HO2A 2O1GA 2RJ0A 5C36A 3FWWA 2QGIA 3SX8A 4HCQA 1YP4A 3OC9A 3CKVA 2OEFA 1NWGB 4EEAA 5C1LA 3ZLLA 1HV9A 5CQOA 3SPTA 4ECMA 1GX0A 1JYLA 1PZTA 4Y7FA 4B2WA 2D7RA 4MIXA 5CMJA 1G1LA 2RITA 2RJ7A 4Y6NA 1GWVA 1FG5N 3I0IX 3D5NA 5C4EA 1S4NA 1VZXA 2W0WA 4M2BA 1H5RB 1TW5A 2FYAA 4BQHA 2AGDA 5DDVA 5CMHA 1NMMB 2D7IA 5C3BA 1QGSA 2YC5A 1G0RA 1FO9A 5CQNX 2V0IA 4HO4A 3OH0A 1TVYA 2V0KA 3IOIA 1QWJA 1ON6A 4CJ8A 2ZU7A 3ZGFA 2ICXA 4Y7TA 2PGYA 2OEGA 2WVKA 4FRLA 3T7OA 5CQMX 2PGVA 5CQPA 1R7UA 1R82A 3SX7A 3D8VA 1E5KA 3OH4A 2FYCB 2YQCA 5EJZA 3I0HA 1ZJ0A 2J0BA 4B4GA 4KC4A 4FROA 1V84A 4AYJA 2JCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W77 A;  1VZU A;  1HM0 A;  1ZI3 A;  2O1H A;  2BO6 A;  2P72 A;  1NF5 B;  1ZCU A;  1ZJO A;  2YCM A;  2YES A;  3OH2 A;  3U0Y A;  2RJ4 A;  3CKJ A;  2I7B A;  1LZI A;  3RMW A;  2P6W A;  3SXB A;  1G2V A;  1H5S B;  4D11 C;  4HO0 A;  3V0P A;  3ZF8 A;  4LW3 A;  2X5S A;  2JCL A;  1YRO B;  3R2W A;  2BO7 A;  1FXO A;  3RMV A;  1FXJ A;  1G9R A;  2VS4 A;  3DJ4 A;  3V0O A;  3NGW A;  3LW6 A;  5BXC A;  2WEE A;  4HO6 A;  4Y6U A;  3U0X A;  2FY7 A;  3V90 A;  1MP5 A;  1GX4 A;  5C47 A;  3CKQ A;  4R7P A;  3ZLK A;  3BRK X;  1G8O A;  4AYL A;  2Y4L A;  2WE9 A;  2YQS A;  1IIM A;  2OI6 A;  1FR9 A;  1YP3 A;  3CGX A;  1JYK A;  2NXV A;  3ST8 A;  4L41 C;  4B2X A;  4KNR A;  5EJ1 A;  5AJP A;  1ZCT A;  1MC3 A;  2I5E A;  3U2X A;  1TW1 A;  1ZDG A;  2QKX A;  1S4O A;  2X60 A;  2QH5 A;  3OH3 A;  1WSZ A;  5IFY A;  1GA8 A;  4KC1 A;  1XZ6 A;  1YP2 A;  4XWI A;  1ZJ2 A;  1VM8 A;  4KC2 A;  4G3S A;  2RIY A;  3F1C A;  1LZ7 A;  1FRW A;  2JCO A;  3N9W A;  3I0J A;  5AJO A;  1R7T A;  4FRH A;  4D11 A;  3D98 A;  5AJN A;  4KPX A;  4P00 A;  4ASJ A;  5C3D A;  3IOJ A;  5C4B A;  2I5K A;  1NQI B;  4Y9X A;  2X5Z A;  2ZU9 A;  3V0L A;  1H7F A;  4JD0 A;  1VGT A;  2Q4J A;  3O3P A;  3I0E A;  2Y4M A;  1S4P A;  3DUV A;  3I0K A;  1KWS A;  4FRE A;  4JIS A;  4ZDQ A;  1H3M A;  3ZGG A;  4B4M A;  2Y6P A;  3I0C A;  4FQW A;  1VH3 A;  5I1F A;  4EE5 A;  4HG6 A;  1W55 A;  1H5S A;  2P73 A;  1GQC A;  2WGZ A;  2APC A;  1EZI A;  1FZW A;  1LL3 A;  1VH1 A;  1H5S D;  1NHE B;  4NAI A;  2GGQ A;  5L6S A;  1ZDF A;  3RSB A;  3OAM A;  1O7O A;  2RIZ A;  4LW6 A;  2FYB A;  2AM5 A;  3U2T A;  5C1G A;  2CU2 A;  4CJC A;  4E1K A;  4BMA A;  4M4K A;  2JCJ A;  4GBP A;  4CJB A;  4B4B A;  1OQM B;  1HM9 A;  4G87 A;  3PKQ A;  5FUH A;  3Q7U A;  4K6R A;  3FOQ A;  2ZU8 A;  4Y64 A;  5C49 A;  1H7T A;  1ZI1 A;  1OMZ A;  2X65 A;  1PZY B;  2FYD B;  5FTV A;  1LZJ A;  3F1Y A;  3V0M A;  2RJ9 A;  1WT3 A;  3U2W A;  3V0N A;  2VD4 A;  4MYB A;  2VS3 A;  2AES A;  5FU8 A;  5C4D A;  4D0Z A;  1VPA A;  2VSH A;  5JQQ A;  2OI5 A;  5CMG X;  2AM3 A;  4ARW A;  3SXE A;  3V0Q A;  1H4E A;  4Y7U A;  1JV1 A;  2ICY A;  1V83 A;  1H4C A;  2YQJ A;  1LZ0 A;  4FRA A;  4DEC A;  4FCU A;  1WT1 A;  5C38 A;  5FV9 A;  1VGU A;  1G3L A;  5DDT A;  4DE7 A;  1R7V A;  1I52 A;  4C2S A;  2RJ6 A;  1JVG A;  1H5S C;  4NAL A;  3PKP A;  1JV3 A;  3E26 A;  4FRQ A;  5C3A A;  2O1F A;  4KPZ A;  4KRV A;  3CKO A;  5IDS A;  4FRP A;  2VS5 A;  1FOA A;  5CQL X;  1FGX A;  3I0G A;  3I0D A;  1GQ9 A;  2Z87 A;  1ZJ1 A;  2XWM A;  1K4V A;  1R81 A;  2YC3 A;  3JUK A;  4YS8 A;  4EEM A;  4NAK A;  5EIY A;  4Y7V A;  4B3U A;  1VGW A;  4AAW A;  1FGG A;  2BO4 A;  1G95 A;  1NKH B;  1H7G A;  2PA4 A;  3BCV A;  3I0L A;  1H7H A;  1Z90 A;  3JUJ A;  3OKR A;  4EE3 A;  5CMI A;  2A8U A;  3KIA A;  1G97 A;  1O23 B;  1LL0 A;  2RJ8 A;  4UEG A;  1WVC A;  1MP4 A;  5C4F A;  2DPW A;  5CMF X;  3PNN A;  3DK5 A;  1ZCV A;  5L6V A;  1ZHJ A;  4HO9 A;  1QGQ A;  4B42 A;  2E3D A;  4Y63 A;  1INI A;  1GWW A;  1ZI5 A;  2A8W A;  2XME A;  1HJL A;  2Z86 A;  3K8D A;  2VXM A;  3SX3 A;  4HOC A;  3T7N A;  5HS2 A;  1HM8 A;  1LL2 A;  3OH1 A;  3HL3 A;  3IOH A;  4M28 A;  2PX7 A;  1ON8 A;  1O7Q A;  4FRD A;  3V91 A;  2Y7A A;  2FFU A;  2Y4J A;  1FO8 A;  1H5T A;  4IRQ A;  3E25 A;  4HO3 A;  3USR A;  3TQD A;  1ZJP A;  4CVH A;  5C48 A;  2YQH A;  3TZT A;  1VZT A;  4FRB A;  1G23 A;  2AH9 A;  2AE7 A;  4EEO A;  2V0L A;  2RJ1 A;  2VFZ A;  3V8Y A;  2XMH A;  4Y7G A;  1R7X A;  3U2U A;  3EE5 A;  2AM4 A;  3R3I A;  1H7E A;  3SXA A;  3CKN A;  2XWN A;  3USQ A;  3SX5 A;  4AC3 A;  4EE4 A;  5C8R A;  1FWY A;  4HO5 A;  1ZCY A;  4Y62 A;  3GUE A;  3JTJ A;  1V82 A;  1SS9 A;  2BO8 A;  4J18 A;  4IRP A;  1R7Y A;  2FFV A;  3I0F A;  4NAN A;  5FTS A;  5IDT A;  5C1H A;  1OMX A;  1R80 A;  2V0H A;  1O0R A;  4M2A A;  5FU0 A;  2VXL A;  1JVD A;  1VGZ A;  3SXD A;  4DDZ A;  1H4D A;  3V8Z A;  1H5T B;  4FCE A;  1W57 A;  2WVL A;  4D0T A;  2VSI A;  4HO8 A;  4G3Q A;  4KT7 A;  1FR8 A;  1H7Q A;  1H7L A;  4D48 A;  1MP3 A;  4KXO A;  1INJ A;  2AEC A;  2D0J A;  4KQL A;  5FYE A;  2GGO A;  3SXC A;  4B5B A;  4ASY A;  4MND A;  2UX8 A;  3T7M A;  5J49 A;  5C4C A;  1TZF A;  3U2V A;  4FRM A;  3CU0 A;  2XWL A;  3OGZ A;  3SXG A;  2E8B A;  4EVW A;  1WT2 A;  1HJJ A;  3POL A;  4P02 A;  1ZJ3 A;  4G3P A;  4KNX A;  2RIX A;  1VIC A;  2MZB A;  1ZI4 A;  3Q4S A;  2W0V A;  1H5R A;  1QG8 A;  2V0J A;  1LVW A;  4EEG A;  3K8E A;  1XHB A;  2WVM A;  2OI7 A;  2Y4K A;  1WT0 A;  2RJ5 A;  3Q80 A;  1EYR A;  1IIN A;  1ZIZ A;  2WAW A;  3QVB A;  1G93 A;  4HO2 A;  2O1G A;  2RJ0 A;  5C36 A;  3FWW A;  2QGI A;  3SX8 A;  4HCQ A;  1YP4 A;  3OC9 A;  3CKV A;  2OEF A;  1NWG B;  4EEA A;  5C1L A;  3ZLL A;  1HV9 A;  5CQO A;  3SPT A;  4ECM A;  1GX0 A;  1JYL A;  1PZT A;  4Y7F A;  4B2W A;  2D7R A;  5CMJ A;  1G1L A;  2RIT A;  2RJ7 A;  4Y6N A;  1GWV A;  1FG5 N;  3I0I X;  3D5N A;  5C4E A;  1S4N A;  1VZX A;  2W0W A;  4M2B A;  1H5R B;  1TW5 A;  2FYA A;  4BQH A;  2AGD A;  5DDV A;  5CMH A;  1NMM B;  2D7I A;  5C3B A;  1QGS A;  2YC5 A;  1G0R A;  1FO9 A;  5CQN X;  2V0I A;  4HO4 A;  3OH0 A;  1TVY A;  2V0K A;  3IOI A;  1QWJ A;  1ON6 A;  4CJ8 A;  2ZU7 A;  3ZGF A;  2ICX A;  4Y7T A;  2PGY A;  2OEG A;  2WVK A;  4FRL A;  3T7O A;  5CQM X;  2PGV A;  5CQP A;  1R7U A;  1R82 A;  3SX7 A;  3D8V A;  1E5K A;  3OH4 A;  2FYC B;  2YQC A;  5EJZ A;  3I0H A;  1ZJ0 A;  4B4G A;  4KC4 A;  4FRO A;  1V84 A;  4AYJ A;  2JCK A; 
#chains in the Genus database with same CATH topology
 1W77 A;  1VZU A;  1HM0 A;  1ZI3 A;  2O1H A;  2BO6 A;  2P72 A;  1NF5 B;  1ZCU A;  1ZJO A;  2YCM A;  2YES A;  3OH2 A;  3U0Y A;  2RJ4 A;  3CKJ A;  2I7B A;  1LZI A;  3RMW A;  2P6W A;  3SXB A;  1G2V A;  1H5S B;  4D11 C;  4HO0 A;  3V0P A;  2C0N A;  3ZF8 A;  4LW3 A;  2X5S A;  2JCL A;  1YRO B;  3R2W A;  2BO7 A;  1FXO A;  3RMV A;  1FXJ A;  1G9R A;  2VS4 A;  3DJ4 A;  3V0O A;  3NGW A;  3LW6 A;  5BXC A;  2WEE A;  4HO6 A;  4Y6U A;  3U0X A;  2FY7 A;  3V90 A;  1MP5 A;  1GX4 A;  5C47 A;  3CKQ A;  4R7P A;  3ZLK A;  3BRK X;  1G8O A;  4AYL A;  2Y4L A;  2WE9 A;  2YQS A;  1IIM A;  2OI6 A;  1FR9 A;  1YP3 A;  3CGX A;  1JYK A;  2NXV A;  3ST8 A;  4L41 C;  4B2X A;  4KNR A;  5EJ1 A;  5AJP A;  1ZCT A;  1MC3 A;  2I5E A;  3U2X A;  1TW1 A;  1ZDG A;  4FIX A;  2QKX A;  1S4O A;  2X60 A;  2QH5 A;  3OH3 A;  1WSZ A;  5IFY A;  1GA8 A;  4KC1 A;  1XZ6 A;  1YP2 A;  4XWI A;  1ZJ2 A;  1VM8 A;  4FIY A;  4KC2 A;  4G3S A;  2RIY A;  3F1C A;  1LZ7 A;  1FRW A;  2JCO A;  3N9W A;  3I0J A;  5AJO A;  1R7T A;  4FRH A;  4D11 A;  3D98 A;  5AJN A;  4KPX A;  4P00 A;  4ASJ A;  5C3D A;  3IOJ A;  5C4B A;  2I5K A;  1NQI B;  4Y9X A;  2X5Z A;  2ZU9 A;  3V0L A;  1H7F A;  4JD0 A;  1VGT A;  2Q4J A;  3O3P A;  3I0E A;  2Y4M A;  1S4P A;  3DUV A;  3I0K A;  1KWS A;  4FRE A;  4JIS A;  4ZDQ A;  1H3M A;  3ZGG A;  4O6M A;  4B4M A;  2Y6P A;  3I0C A;  4FQW A;  1VH3 A;  5I1F A;  4EE5 A;  4HG6 A;  1W55 A;  1H5S A;  2P73 A;  1GQC A;  2WGZ A;  2APC A;  1EZI A;  1FZW A;  1LL3 A;  1VH1 A;  1H5S D;  1NHE B;  4NAI A;  2GGQ A;  5L6S A;  1ZDF A;  3RSB A;  3OAM A;  1O7O A;  2RIZ A;  4LW6 A;  2FYB A;  2AM5 A;  3U2T A;  5C1G A;  2CU2 A;  4CJC A;  4E1K A;  4BMA A;  4M4K A;  2JCJ A;  4GBP A;  4CJB A;  4B4B A;  1OQM B;  1HM9 A;  4G87 A;  3PKQ A;  5FUH A;  3Q7U A;  4K6R A;  3FOQ A;  2ZU8 A;  4Y64 A;  5C49 A;  1H7T A;  1ZI1 A;  1OMZ A;  2X65 A;  1PZY B;  2FYD B;  5FTV A;  1LZJ A;  3F1Y A;  3V0M A;  2RJ9 A;  1WT3 A;  3U2W A;  3V0N A;  2VD4 A;  4MYB A;  2VS3 A;  2AES A;  5FU8 A;  5C4D A;  4D0Z A;  1VPA A;  2VSH A;  5JQQ A;  2OI5 A;  5D91 A;  5CMG X;  2AM3 A;  4ARW A;  3SXE A;  3V0Q A;  1H4E A;  4Y7U A;  1JV1 A;  2ICY A;  1V83 A;  1H4C A;  2YQJ A;  1LZ0 A;  4FRA A;  2J0A A;  4DEC A;  4FCU A;  1WT1 A;  5C38 A;  5FV9 A;  1VGU A;  1G3L A;  5DDT A;  4DE7 A;  1R7V A;  1I52 A;  4C2S A;  2RJ6 A;  1JVG A;  1H5S C;  4NAL A;  3PKP A;  1JV3 A;  3E26 A;  4FRQ A;  5C3A A;  2O1F A;  4KPZ A;  4KRV A;  3CKO A;  5IDS A;  4FRP A;  2VS5 A;  1FOA A;  5CQL X;  1FGX A;  3I0G A;  3I0D A;  1GQ9 A;  2Z87 A;  1ZJ1 A;  2XWM A;  1K4V A;  1R81 A;  2YC3 A;  3JUK A;  4YS8 A;  4EEM A;  4NAK A;  5EIY A;  4Y7V A;  4B3U A;  1VGW A;  4AAW A;  1FGG A;  2BO4 A;  1G95 A;  1NKH B;  1H7G A;  2PA4 A;  3BCV A;  3I0L A;  1H7H A;  1Z90 A;  3JUJ A;  3OKR A;  4EE3 A;  5CMI A;  2A8U A;  3KIA A;  1G97 A;  1O23 B;  1LL0 A;  2RJ8 A;  4UEG A;  1WVC A;  1MP4 A;  5C4F A;  2DPW A;  5CMF X;  3PNN A;  3DK5 A;  1ZCV A;  5L6V A;  1ZHJ A;  4HO9 A;  1QGQ A;  4B42 A;  2E3D A;  4Y63 A;  1INI A;  1GWW A;  1ZI5 A;  2A8W A;  2XME A;  1HJL A;  2Z86 A;  3K8D A;  2VXM A;  3SX3 A;  4HOC A;  5D92 A;  3T7N A;  5HS2 A;  1HM8 A;  1LL2 A;  3OH1 A;  3HL3 A;  3IOH A;  4M28 A;  2PX7 A;  1ON8 A;  1O7Q A;  4FRD A;  3V91 A;  2Y7A A;  2FFU A;  2Y4J A;  1FO8 A;  1H5T A;  4IRQ A;  3E25 A;  4HO3 A;  3USR A;  3TQD A;  1ZJP A;  4CVH A;  5C48 A;  2YQH A;  3TZT A;  1VZT A;  4FRB A;  1G23 A;  2AH9 A;  2AE7 A;  4EEO A;  2V0L A;  2RJ1 A;  2VFZ A;  3V8Y A;  2XMH A;  4Y7G A;  1R7X A;  3U2U A;  3EE5 A;  2AM4 A;  3R3I A;  1H7E A;  3SXA A;  3CKN A;  2XWN A;  3USQ A;  3SX5 A;  4AC3 A;  4EE4 A;  5C8R A;  1FWY A;  4HO5 A;  1ZCY A;  4Y62 A;  3GUE A;  3JTJ A;  1V82 A;  4O6N A;  1SS9 A;  2BO8 A;  4J18 A;  4IRP A;  1R7Y A;  2FFV A;  3I0F A;  4NAN A;  5FTS A;  5IDT A;  5C1H A;  1OMX A;  1R80 A;  2V0H A;  1O0R A;  4M2A A;  5FU0 A;  2VXL A;  1JVD A;  1VGZ A;  3SXD A;  4DDZ A;  1H4D A;  3V8Z A;  1H5T B;  4FCE A;  1W57 A;  2WVL A;  4D0T A;  2VSI A;  4HO8 A;  4G3Q A;  4KT7 A;  1FR8 A;  1H7Q A;  1H7L A;  4D48 A;  1MP3 A;  4KXO A;  1INJ A;  2AEC A;  2D0J A;  4KQL A;  5FYE A;  2GGO A;  3SXC A;  4B5B A;  4ASY A;  4MND A;  2UX8 A;  3T7M A;  5J49 A;  5C4C A;  1TZF A;  3U2V A;  4FRM A;  3CU0 A;  2XWL A;  3OGZ A;  3SXG A;  2E8B A;  4EVW A;  1WT2 A;  1HJJ A;  3POL A;  4P02 A;  1ZJ3 A;  4G3P A;  4KNX A;  2RIX A;  1VIC A;  2MZB A;  1ZI4 A;  3Q4S A;  2W0V A;  1H5R A;  1QG8 A;  2V0J A;  1LVW A;  4EEG A;  3K8E A;  1XHB A;  2WVM A;  2OI7 A;  2Y4K A;  4Q7C A;  1WT0 A;  2RJ5 A;  3Q80 A;  1EYR A;  1IIN A;  1ZIZ A;  2WAW A;  3QVB A;  2VK9 A;  1G93 A;  4HO2 A;  2O1G A;  2RJ0 A;  5C36 A;  3FWW A;  2QGI A;  3SX8 A;  4HCQ A;  1YP4 A;  3OC9 A;  3CKV A;  2OEF A;  1NWG B;  4EEA A;  5C1L A;  3ZLL A;  1HV9 A;  5CQO A;  3SPT A;  4ECM A;  1GX0 A;  1JYL A;  1PZT A;  4Y7F A;  4B2W A;  2D7R A;  4MIX A;  5CMJ A;  1G1L A;  2RIT A;  2RJ7 A;  4Y6N A;  1GWV A;  1FG5 N;  3I0I X;  3D5N A;  5C4E A;  1S4N A;  1VZX A;  2W0W A;  4M2B A;  1H5R B;  1TW5 A;  2FYA A;  4BQH A;  2AGD A;  5DDV A;  5CMH A;  1NMM B;  2D7I A;  5C3B A;  1QGS A;  2YC5 A;  1G0R A;  1FO9 A;  5CQN X;  2V0I A;  4HO4 A;  3OH0 A;  1TVY A;  2V0K A;  3IOI A;  1QWJ A;  1ON6 A;  4CJ8 A;  2ZU7 A;  3ZGF A;  2ICX A;  4Y7T A;  2PGY A;  2OEG A;  2WVK A;  4FRL A;  3T7O A;  5CQM X;  2PGV A;  5CQP A;  1R7U A;  1R82 A;  3SX7 A;  3D8V A;  1E5K A;  3OH4 A;  2FYC B;  2YQC A;  5EJZ A;  3I0H A;  1ZJ0 A;  2J0B A;  4B4G A;  4KC4 A;  4FRO A;  1V84 A;  4AYJ A;  2JCK A; 
#chains in the Genus database with same CATH homology
 1W77 A;  1VZU A;  1HM0 A;  1ZI3 A;  2O1H A;  2BO6 A;  2P72 A;  1NF5 B;  1ZCU A;  1ZJO A;  2YCM A;  2YES A;  3OH2 A;  3U0Y A;  2RJ4 A;  3CKJ A;  2I7B A;  1LZI A;  3RMW A;  2P6W A;  3SXB A;  1G2V A;  1H5S B;  4D11 C;  4HO0 A;  3V0P A;  2C0N A;  3ZF8 A;  4LW3 A;  2X5S A;  2JCL A;  1YRO B;  3R2W A;  2BO7 A;  1FXO A;  3RMV A;  1FXJ A;  1G9R A;  2VS4 A;  3DJ4 A;  3V0O A;  3NGW A;  3LW6 A;  5BXC A;  2WEE A;  4HO6 A;  4Y6U A;  3U0X A;  2FY7 A;  3V90 A;  1MP5 A;  1GX4 A;  5C47 A;  3CKQ A;  4R7P A;  3ZLK A;  3BRK X;  1G8O A;  4AYL A;  2Y4L A;  2WE9 A;  2YQS A;  1IIM A;  2OI6 A;  1FR9 A;  1YP3 A;  3CGX A;  1JYK A;  2NXV A;  3ST8 A;  4L41 C;  4B2X A;  4KNR A;  5EJ1 A;  5AJP A;  1ZCT A;  1MC3 A;  2I5E A;  3U2X A;  1TW1 A;  1ZDG A;  4FIX A;  2QKX A;  1S4O A;  2X60 A;  2QH5 A;  3OH3 A;  1WSZ A;  5IFY A;  1GA8 A;  4KC1 A;  1XZ6 A;  1YP2 A;  4XWI A;  1ZJ2 A;  1VM8 A;  4FIY A;  4KC2 A;  4G3S A;  2RIY A;  3F1C A;  1LZ7 A;  1FRW A;  2JCO A;  3N9W A;  3I0J A;  5AJO A;  1R7T A;  4FRH A;  4D11 A;  3D98 A;  5AJN A;  4KPX A;  4P00 A;  4ASJ A;  5C3D A;  3IOJ A;  5C4B A;  2I5K A;  1NQI B;  4Y9X A;  2X5Z A;  2ZU9 A;  3V0L A;  1H7F A;  4JD0 A;  1VGT A;  2Q4J A;  3O3P A;  3I0E A;  2Y4M A;  1S4P A;  3DUV A;  3I0K A;  1KWS A;  4FRE A;  4JIS A;  4ZDQ A;  1H3M A;  3ZGG A;  4O6M A;  4B4M A;  2Y6P A;  3I0C A;  4FQW A;  1VH3 A;  5I1F A;  4EE5 A;  4HG6 A;  1W55 A;  1H5S A;  2P73 A;  1GQC A;  2WGZ A;  2APC A;  1EZI A;  1FZW A;  1LL3 A;  1VH1 A;  1H5S D;  1NHE B;  4NAI A;  2GGQ A;  5L6S A;  1ZDF A;  3RSB A;  3OAM A;  1O7O A;  2RIZ A;  4LW6 A;  2FYB A;  2AM5 A;  3U2T A;  5C1G A;  2CU2 A;  4CJC A;  4E1K A;  4BMA A;  4M4K A;  2JCJ A;  4GBP A;  4CJB A;  4B4B A;  1OQM B;  1HM9 A;  4G87 A;  3PKQ A;  5FUH A;  3Q7U A;  4K6R A;  3FOQ A;  2ZU8 A;  4Y64 A;  5C49 A;  1H7T A;  1ZI1 A;  1OMZ A;  2X65 A;  1PZY B;  2FYD B;  5FTV A;  1LZJ A;  3F1Y A;  3V0M A;  2RJ9 A;  1WT3 A;  3U2W A;  3V0N A;  2VD4 A;  4MYB A;  2VS3 A;  2AES A;  5FU8 A;  5C4D A;  4D0Z A;  1VPA A;  2VSH A;  5JQQ A;  2OI5 A;  5D91 A;  5CMG X;  2AM3 A;  4ARW A;  3SXE A;  3V0Q A;  1H4E A;  4Y7U A;  1JV1 A;  2ICY A;  1V83 A;  1H4C A;  2YQJ A;  1LZ0 A;  4FRA A;  2J0A A;  4DEC A;  4FCU A;  1WT1 A;  5C38 A;  5FV9 A;  1VGU A;  1G3L A;  5DDT A;  4DE7 A;  1R7V A;  1I52 A;  4C2S A;  2RJ6 A;  1JVG A;  1H5S C;  4NAL A;  3PKP A;  1JV3 A;  3E26 A;  4FRQ A;  5C3A A;  2O1F A;  4KPZ A;  4KRV A;  3CKO A;  5IDS A;  4FRP A;  2VS5 A;  1FOA A;  5CQL X;  1FGX A;  3I0G A;  3I0D A;  1GQ9 A;  2Z87 A;  1ZJ1 A;  2XWM A;  1K4V A;  1R81 A;  2YC3 A;  3JUK A;  4YS8 A;  4EEM A;  4NAK A;  5EIY A;  4Y7V A;  4B3U A;  1VGW A;  4AAW A;  1FGG A;  2BO4 A;  1G95 A;  1NKH B;  1H7G A;  2PA4 A;  3BCV A;  3I0L A;  1H7H A;  1Z90 A;  3JUJ A;  3OKR A;  4EE3 A;  5CMI A;  2A8U A;  3KIA A;  1G97 A;  1O23 B;  1LL0 A;  2RJ8 A;  4UEG A;  1WVC A;  1MP4 A;  5C4F A;  2DPW A;  5CMF X;  3PNN A;  3DK5 A;  1ZCV A;  5L6V A;  1ZHJ A;  4HO9 A;  1QGQ A;  4B42 A;  2E3D A;  4Y63 A;  1INI A;  1GWW A;  1ZI5 A;  2A8W A;  2XME A;  1HJL A;  2Z86 A;  3K8D A;  2VXM A;  3SX3 A;  4HOC A;  5D92 A;  3T7N A;  5HS2 A;  1HM8 A;  1LL2 A;  3OH1 A;  3HL3 A;  3IOH A;  4M28 A;  2PX7 A;  1ON8 A;  1O7Q A;  4FRD A;  3V91 A;  2Y7A A;  2FFU A;  2Y4J A;  1FO8 A;  1H5T A;  4IRQ A;  3E25 A;  4HO3 A;  3USR A;  3TQD A;  1ZJP A;  4CVH A;  5C48 A;  2YQH A;  3TZT A;  1VZT A;  4FRB A;  1G23 A;  2AH9 A;  2AE7 A;  4EEO A;  2V0L A;  2RJ1 A;  2VFZ A;  3V8Y A;  2XMH A;  4Y7G A;  1R7X A;  3U2U A;  3EE5 A;  2AM4 A;  3R3I A;  1H7E A;  3SXA A;  3CKN A;  2XWN A;  3USQ A;  3SX5 A;  4AC3 A;  4EE4 A;  5C8R A;  1FWY A;  4HO5 A;  1ZCY A;  4Y62 A;  3GUE A;  3JTJ A;  1V82 A;  4O6N A;  1SS9 A;  2BO8 A;  4J18 A;  4IRP A;  1R7Y A;  2FFV A;  3I0F A;  4NAN A;  5FTS A;  5IDT A;  5C1H A;  1OMX A;  1R80 A;  2V0H A;  1O0R A;  4M2A A;  5FU0 A;  2VXL A;  1JVD A;  1VGZ A;  3SXD A;  4DDZ A;  1H4D A;  3V8Z A;  1H5T B;  4FCE A;  1W57 A;  2WVL A;  4D0T A;  2VSI A;  4HO8 A;  4G3Q A;  4KT7 A;  1FR8 A;  1H7Q A;  1H7L A;  4D48 A;  1MP3 A;  4KXO A;  1INJ A;  2AEC A;  2D0J A;  4KQL A;  5FYE A;  2GGO A;  3SXC A;  4B5B A;  4ASY A;  4MND A;  2UX8 A;  3T7M A;  5J49 A;  5C4C A;  1TZF A;  3U2V A;  4FRM A;  3CU0 A;  2XWL A;  3OGZ A;  3SXG A;  2E8B A;  4EVW A;  1WT2 A;  1HJJ A;  3POL A;  4P02 A;  1ZJ3 A;  4G3P A;  4KNX A;  2RIX A;  1VIC A;  2MZB A;  1ZI4 A;  3Q4S A;  2W0V A;  1H5R A;  1QG8 A;  2V0J A;  1LVW A;  4EEG A;  3K8E A;  1XHB A;  2WVM A;  2OI7 A;  2Y4K A;  4Q7C A;  1WT0 A;  2RJ5 A;  3Q80 A;  1EYR A;  1IIN A;  1ZIZ A;  2WAW A;  3QVB A;  2VK9 A;  1G93 A;  4HO2 A;  2O1G A;  2RJ0 A;  5C36 A;  3FWW A;  2QGI A;  3SX8 A;  4HCQ A;  1YP4 A;  3OC9 A;  3CKV A;  2OEF A;  1NWG B;  4EEA A;  5C1L A;  3ZLL A;  1HV9 A;  5CQO A;  3SPT A;  4ECM A;  1GX0 A;  1JYL A;  1PZT A;  4Y7F A;  4B2W A;  2D7R A;  4MIX A;  5CMJ A;  1G1L A;  2RIT A;  2RJ7 A;  4Y6N A;  1GWV A;  1FG5 N;  3I0I X;  3D5N A;  5C4E A;  1S4N A;  1VZX A;  2W0W A;  4M2B A;  1H5R B;  1TW5 A;  2FYA A;  4BQH A;  2AGD A;  5DDV A;  5CMH A;  1NMM B;  2D7I A;  5C3B A;  1QGS A;  2YC5 A;  1G0R A;  1FO9 A;  5CQN X;  2V0I A;  4HO4 A;  3OH0 A;  1TVY A;  2V0K A;  3IOI A;  1QWJ A;  1ON6 A;  4CJ8 A;  2ZU7 A;  3ZGF A;  2ICX A;  4Y7T A;  2PGY A;  2OEG A;  2WVK A;  4FRL A;  3T7O A;  5CQM X;  2PGV A;  5CQP A;  1R7U A;  1R82 A;  3SX7 A;  3D8V A;  1E5K A;  3OH4 A;  2FYC B;  2YQC A;  5EJZ A;  3I0H A;  1ZJ0 A;  2J0B A;  4B4G A;  4KC4 A;  4FRO A;  1V84 A;  4AYJ A;  2JCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...