4EEMA

Crystal structure of human m340h-beta-1,4-galactosyltransferase-1 (m340h-b4gal-t1) in complex with glcnac-beta1,6-man-alpha-methyl
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
273
structure length
273
Chain Sequence
SLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGTTRHIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-1,4-galactosyltransferase 1
publication title Binding of N-acetylglucosamine (GlcNAc) beta 1-6-branched oligosaccharide acceptors to beta 4-galactosyltransferase I reveals a new ligand binding mode.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 273
sequence length 273
chains with identical sequence B, C
ec nomenclature ec 2.4.1.22: Lactose synthase.
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02709 Glyco_transf_7C N-terminal domain of galactosyltransferase
A PF13733 Glyco_transf_7N N-terminal region of glycosyl transferase group 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4eemA00
1IIMA 1H7LA 1FR9A 2WVLA 1H7FA 2XWLA 3IOHA 1VH1A 4B42A 2XWMA 1G3LA 2VD4A 2GGOA 5CQOA 3CKOA 2JCJA 4FRPA 1GX4A 3I0LA 1ZJOA 2BO6A 1NWGB 3F1YA 4M2BA 3JUJA 1FG5N 3RMVA 5FUHA 3SX8A 1H5TB 1GA8A 1H7HA 2I7BA 2Y4MA 1LZ7A 2W0VA 2FYAA 1VGZA 4Y6UA 3RSBA 4EE3A 3I0KA 1QWJA 2ICYA 2XMHA 4KPZA 4LW6A 4P02A 1ZJ3A 5C4CA 1G8OA 3USQA 1QGQA 1G93A 1OQMB 2D0JA 4B3UA 4KNRA 1O0RA 4NAIA 3R3IA 3ZGGA 2RITA 1G95A 5AJOA 4KC4A 3Q4SA 4EEMA 3U2VA 5FTVA 2VS3A 5C4BA 2YC5A 3SX3A 4HO5A 3KIAA 3CKNA 4Y63A 2WAWA 4IRPA 1VH3A 2DPWA 1R80A 3V0MA 3DUVA 2O1FA 2OI7A 3R2WA 1NF5B 4FRHA 4G87A 1R7TA 5C3AA 1ZJ2A 4ASJA 1GWWA 3POLA 1ZJ0A 2V0JA 2D7IA 1XZ6A 2W0WA 4B2XA 4DE7A 1HM9A 4B5BA 3SXGA 2X5ZA 3ZGFA 2RIYA 4FREA 2OI5A 4B4MA 5C36A 1O7QA 4M28A 4ASYA 2QKXA 2RJ1A 2AM4A 1H5RB 3U2XA 4FCUA 1ZIZA 2MZBA 4Y7GA 5IFYA 3TQDA 3CGXA 2VS4A 4KC1A 1FGGA 4KC2A 1VGTA 1H5TA 1G0RA 3K8DA 4Y7FA 2PX7A 2FYDB 4FRLA 5CMIA 4HO9A 1FWYA 3CKQA 3SXAA 1HM8A 1VZXA 2ZU8A 1ZJPA 4KT7A 1JV3A 5J49A 5EIYA 1SS9A 1XHBA 4G3QA 4JISA 1HJLA 3OH3A 4R7PA 1ZJ1A 3O3PA 1S4NA 2FFUA 2ZU7A 1HM0A 3SXBA 2JCKA 3NGWA 2O1GA 1FOAA 3PKQA 2PA4A 2VXLA 5C4DA 1QGSA 4HCQA 4KRVA 5HS2A 2Y4JA 1H7GA 2AESA 3CKVA 5IDSA 2RIZA 2AECA 3I0FA 4AAWA 1OMZA 1VGWA 4G3SA 1FRWA 4Y64A 1KWSA 1H4DA 1LZ0A 1Z90A 1PZYB 4NANA 1NMMB 2OEFA 1TW5A 2RJ5A 1YP2A 4LW3A 3U2TA 2RJ8A 3I0CA 3SXCA 2RJ0A 1ZI5A 4BQHA 3OKRA 4HO3A 5FU0A 1GX0A 4M2AA 2NXVA 4CJ8A 3IOJA 3V0LA 4Y7TA 2VSHA 2RJ9A 1H5RA 1VGUA 1LZJA 1S4PA 4NAKA 1G23A 5EJZA 1ZCYA 2FY7A 1YP4A 2VSIA 2VXMA 3USRA 1H3MA 5CMHA 2YQJA 5DDVA 4AC3A 3T7MA 1LL2A 4FROA 2WGZA 3D98A 2XMEA 3JTJA 3ZLLA 4FRBA 4J18A 2Z86A 4K6RA 1ZDGA 2I5KA 2JCLA 2WEEA 4BMAA 4GBPA 3V8YA 3FOQA 1R82A 3ZLKA 2X5SA 5C48A 5I1FA 1R7UA 4HG6A 4FCEA 2Q4JA 3EE5A 4KXOA 3HL3A 3OH4A 1FXJA 1PZTA 2WE9A 1E5KA 1WVCA 4M4KA 3SXEA 2GGQA 1FZWA 1V84A 4CVHA 4KPXA 3GUEA 1TVYA 4D11A 4ARWA 2FFVA 2E8BA 4D11C 1ZI4A 2RIXA 2V0IA 3V0QA 1ZDFA 1FR8A 1O7OA 1HV9A 1V83A 4HOCA 4AYJA 4HO0A 3IOIA 5JQQA 3SPTA 1HJJA 4FRAA 4NALA 4XWIA 2YQHA 3T7NA 5DDTA 3V91A 4Y6NA 1JVDA 1I52A 2Y4LA 3ST8A 3ZF8A 2RJ6A 2AM3A 2YCMA 1FGXA 3LW6A 3SX5A 1ZCUA 2X60A 2D7RA 1GQCA 1VPAA 2A8UA 3F1CA 4Y7VA 3CKJA 2RJ7A 1H4CA 2Y4KA 1WT2A 5C3DA 2UX8A 4G3PA 4ECMA 1LZIA 2VS5A 1WSZA 2FYCB 1H7TA 1FO8A 1G97A 1YP3A 3I0IX 2YQSA 2JCOA 5AJNA 3K8EA 4DECA 1ZI3A 2P72A 1ON6A 3OAMA 4EVWA 1ZCTA 1JVGA 4MNDA 1MP3A 2P6WA 2ICXA 1EZIA 1O23B 3RMWA 5CMGX 5CQPA 2AM5A 2Y6PA 5BXCA 4HO2A 1TW1A 5FTSA 3V8ZA 4FQWA 1G9RA 1NKHB 1VICA 1VZTA 1IINA 2ZU9A 4HO6A 5C1LA 1QG8A 5CMFX 2BO8A 2O1HA 5FV9A 3DK5A 2Y7AA 4Y7UA 3V0PA 3DJ4A 4KNXA 5CQNX 3U2WA 4L41C 4EEOA 2V0KA 3V0NA 2QGIA 3D8VA 5AJPA 2AGDA 5L6VA 4D48A 1JYLA 4Y62A 5C1GA 5L6SA 3I0EA 1TZFA 5FU8A 4DDZA 1MC3A 2P73A 3N9WA 1VZUA 5CMJA 1EYRA 1FXOA 1WT3A 3V0OA 3I0HA 4E1KA 3SXDA 4EEGA 1JV1A 2CU2A 4YS8A 4FRQA 4EEAA 1INIA 1WT1A 1LL3A 4ZDQA 3SX7A 5C49A 3OC9A 4B2WA 4AYLA 2WVMA 3I0JA 1ZHJA 3BCVA 1ON8A 3U0XA 4C2SA 2AH9A 1R7XA 2A8WA 1NQIB 2BO7A 1G2VA 1GQ9A 1R7VA 4B4BA 4D0TA 3PKPA 3V90A 3OH1A 2XWNA 4D0ZA 1H5SB 2OEGA 2WVKA 1K4VA 2PGYA 4FRDA 4CJCA 4EE4A 4EE5A 3CU0A 4P00A 5C38A 1INJA 4FRMA 2OI6A 1V82A 2BO4A 2FYBA 5EJ1A 4Y9XA 5C3BA 5IDTA 2PGVA 2X65A 5C4FA 1ZCVA 1VM8A 2QH5A 1LL0A 2V0LA 2YC3A 4HO8A 1MP5A 3Q80A 3FWWA 3I0GA 3PNNA 3TZTA 1W77A 1MP4A 1GWVA 2VFZA 5C47A 5C1HA 4CJBA 1H4EA 1JYKA 3QVBA 2RJ4A 2APCA 1OMXA 1R81A 3U0YA 5C4EA 3D5NA 1W55A 1NHEB 1H7EA 3JUKA 1W57A 2V0HA 1S4OA 3OH2A 3U2UA 3I0DA 3BRKX 1LVWA 1R7YA 1YROB 4B4GA 1H5SD 1G1LA 5CQMX 4HO4A 1ZI1A 4UEGA 4KQLA 3OH0A 2YQCA 4JD0A 3E26A 3OGZA 3E25A 5FYEA 2AE7A 4MYBA 3Q7UA 2E3DA 2YESA 5CQLX 1H5SA 2I5EA 1FO9A 4IRQA 1WT0A 1H7QA 1H5SC 5C8RA 3T7OA 2Z87A
chains in the Genus database with same CATH superfamily
1IIMA 1H7LA 1FR9A 2WVLA 1H7FA 2XWLA 3IOHA 1VH1A 4B42A 2XWMA 1G3LA 2VD4A 2GGOA 5CQOA 3CKOA 2JCJA 4FRPA 1GX4A 3I0LA 1ZJOA 2BO6A 1NWGB 3F1YA 4M2BA 3JUJA 1FG5N 3RMVA 5FUHA 3SX8A 1H5TB 1GA8A 1H7HA 2I7BA 2Y4MA 1LZ7A 2W0VA 2FYAA 4FIXA 1VGZA 4Y6UA 3RSBA 4EE3A 3I0KA 1QWJA 2ICYA 2XMHA 4KPZA 4LW6A 4P02A 1ZJ3A 5C4CA 1G8OA 3USQA 1QGQA 1G93A 1OQMB 2D0JA 4B3UA 4KNRA 1O0RA 4NAIA 3R3IA 3ZGGA 2RITA 1G95A 5AJOA 4KC4A 3Q4SA 4EEMA 3U2VA 5FTVA 2VS3A 5C4BA 2YC5A 3SX3A 4HO5A 3KIAA 3CKNA 4Y63A 2WAWA 4IRPA 1VH3A 2DPWA 1R80A 3V0MA 3DUVA 2O1FA 2OI7A 3R2WA 1NF5B 4FRHA 4G87A 1R7TA 5C3AA 1ZJ2A 4ASJA 1GWWA 3POLA 1ZJ0A 2V0JA 2D7IA 1XZ6A 2W0WA 4B2XA 4DE7A 1HM9A 4B5BA 3SXGA 2X5ZA 3ZGFA 2RIYA 4MIXA 4FREA 2OI5A 4B4MA 5C36A 1O7QA 4M28A 4ASYA 2QKXA 2RJ1A 2AM4A 1H5RB 3U2XA 4FCUA 1ZIZA 2MZBA 4Y7GA 5IFYA 3TQDA 3CGXA 2VS4A 4KC1A 1FGGA 4KC2A 1VGTA 1H5TA 1G0RA 3K8DA 4Y7FA 2PX7A 2FYDB 4FRLA 5CMIA 4HO9A 1FWYA 3CKQA 3SXAA 1HM8A 1VZXA 2ZU8A 1ZJPA 4KT7A 1JV3A 5J49A 5EIYA 1SS9A 1XHBA 4G3QA 4JISA 1HJLA 3OH3A 4R7PA 1ZJ1A 3O3PA 1S4NA 2FFUA 2ZU7A 1HM0A 3SXBA 2JCKA 3NGWA 2O1GA 1FOAA 3PKQA 2PA4A 2VXLA 5D91A 4Q7CA 5C4DA 1QGSA 4HCQA 4KRVA 5HS2A 2Y4JA 1H7GA 2AESA 3CKVA 5IDSA 2RIZA 2AECA 3I0FA 4AAWA 1OMZA 1VGWA 4G3SA 1FRWA 4Y64A 1KWSA 1H4DA 1LZ0A 1Z90A 1PZYB 4NANA 1NMMB 2OEFA 1TW5A 2RJ5A 1YP2A 4LW3A 3U2TA 2RJ8A 3I0CA 3SXCA 2RJ0A 1ZI5A 4BQHA 3OKRA 4HO3A 5FU0A 1GX0A 4M2AA 2NXVA 4O6MA 4FIYA 4CJ8A 3IOJA 3V0LA 4Y7TA 2VSHA 2RJ9A 1H5RA 1VGUA 1LZJA 1S4PA 4NAKA 1G23A 5EJZA 1ZCYA 2FY7A 1YP4A 2VSIA 2VXMA 3USRA 1H3MA 5CMHA 2YQJA 5DDVA 4AC3A 3T7MA 1LL2A 4FROA 2WGZA 3D98A 2XMEA 3JTJA 3ZLLA 4FRBA 4J18A 2J0BA 2Z86A 4K6RA 1ZDGA 2I5KA 2JCLA 2WEEA 4BMAA 4GBPA 3V8YA 3FOQA 1R82A 3ZLKA 2X5SA 5C48A 5I1FA 1R7UA 4HG6A 4FCEA 2Q4JA 3EE5A 4KXOA 3HL3A 3OH4A 1FXJA 1PZTA 2WE9A 1E5KA 1WVCA 4M4KA 3SXEA 2GGQA 1FZWA 1V84A 4CVHA 4KPXA 3GUEA 1TVYA 4D11A 4ARWA 2FFVA 2E8BA 4D11C 1ZI4A 2RIXA 2V0IA 2VK9A 1ZDFA 3V0QA 1FR8A 1O7OA 1HV9A 1V83A 4HOCA 4AYJA 4HO0A 3IOIA 5JQQA 3SPTA 1HJJA 4FRAA 4NALA 4XWIA 2YQHA 3T7NA 5DDTA 3V91A 4Y6NA 1JVDA 1I52A 2Y4LA 3ST8A 3ZF8A 2RJ6A 2AM3A 2J0AA 2YCMA 1FGXA 3LW6A 3SX5A 4O6NA 1ZCUA 2X60A 2D7RA 1GQCA 1VPAA 2A8UA 3F1CA 4Y7VA 3CKJA 2RJ7A 1H4CA 2Y4KA 1WT2A 5C3DA 2UX8A 4G3PA 4ECMA 1LZIA 2VS5A 1WSZA 2FYCB 1H7TA 1FO8A 1G97A 1YP3A 3I0IX 2YQSA 2JCOA 5AJNA 3K8EA 4DECA 1ZI3A 2P72A 1ON6A 3OAMA 4EVWA 1ZCTA 1JVGA 4MNDA 1MP3A 2P6WA 2ICXA 1EZIA 1O23B 3RMWA 5CMGX 5CQPA 2AM5A 2Y6PA 5BXCA 4HO2A 1TW1A 5FTSA 3V8ZA 4FQWA 1G9RA 1NKHB 1VICA 1VZTA 1IINA 2ZU9A 4HO6A 5C1LA 1QG8A 5CMFX 2BO8A 2O1HA 5FV9A 3DK5A 2Y7AA 4Y7UA 3V0PA 3DJ4A 4KNXA 5CQNX 3U2WA 4L41C 4EEOA 2V0KA 2C0NA 3V0NA 2QGIA 3D8VA 5AJPA 2AGDA 5L6VA 4D48A 1JYLA 4Y62A 5C1GA 5L6SA 3I0EA 1TZFA 5FU8A 4DDZA 1MC3A 2P73A 3N9WA 1VZUA 5CMJA 1EYRA 1FXOA 1WT3A 3V0OA 3I0HA 4E1KA 3SXDA 4EEGA 1JV1A 2CU2A 4YS8A 4FRQA 4EEAA 1INIA 1WT1A 1LL3A 4ZDQA 3SX7A 5C49A 3OC9A 4B2WA 4AYLA 2WVMA 3I0JA 1ZHJA 3BCVA 1ON8A 3U0XA 4C2SA 2AH9A 1R7XA 2A8WA 1NQIB 2BO7A 1G2VA 1GQ9A 1R7VA 4B4BA 4D0TA 3PKPA 3V90A 3OH1A 2XWNA 4D0ZA 1H5SB 2OEGA 2WVKA 1K4VA 2PGYA 4FRDA 4CJCA 4EE4A 4EE5A 3CU0A 4P00A 5C38A 1INJA 4FRMA 2OI6A 1V82A 2BO4A 2FYBA 5EJ1A 4Y9XA 5C3BA 5IDTA 2PGVA 2X65A 5C4FA 1ZCVA 1VM8A 2QH5A 1LL0A 2V0LA 2YC3A 4HO8A 1MP5A 3Q80A 3FWWA 3I0GA 3PNNA 3TZTA 1W77A 1MP4A 1GWVA 2VFZA 5C47A 5C1HA 4CJBA 1H4EA 1JYKA 3QVBA 2RJ4A 2APCA 1OMXA 1R81A 3U0YA 5C4EA 3D5NA 1W55A 1NHEB 1H7EA 3JUKA 1W57A 2V0HA 1S4OA 3OH2A 3U2UA 3I0DA 3BRKX 1LVWA 1R7YA 1YROB 4B4GA 1H5SD 1G1LA 5CQMX 4HO4A 1ZI1A 4UEGA 4KQLA 3OH0A 2YQCA 4JD0A 3E26A 3OGZA 5D92A 3E25A 5FYEA 2AE7A 4MYBA 3Q7UA 2E3DA 2YESA 5CQLX 1H5SA 2I5EA 1FO9A 4IRQA 1WT0A 1H7QA 1H5SC 5C8RA 3T7OA 2Z87A
chains in the Genus database with same CATH topology
1IIMA 1H7LA 1FR9A 2WVLA 1H7FA 2XWLA 3IOHA 1VH1A 4B42A 2XWMA 1G3LA 2VD4A 2GGOA 5CQOA 3CKOA 2JCJA 4FRPA 1GX4A 3I0LA 1ZJOA 2BO6A 1NWGB 3F1YA 4M2BA 3JUJA 1FG5N 3RMVA 5FUHA 3SX8A 1H5TB 1GA8A 1H7HA 2I7BA 2Y4MA 1LZ7A 2W0VA 2FYAA 4FIXA 1VGZA 4Y6UA 3RSBA 4EE3A 3I0KA 1QWJA 2ICYA 2XMHA 4KPZA 4LW6A 4P02A 1ZJ3A 5C4CA 1G8OA 3USQA 1QGQA 1G93A 1OQMB 2D0JA 4B3UA 4KNRA 1O0RA 4NAIA 3R3IA 3ZGGA 2RITA 1G95A 5AJOA 4KC4A 3Q4SA 4EEMA 3U2VA 5FTVA 2VS3A 5C4BA 2YC5A 3SX3A 4HO5A 3KIAA 3CKNA 4Y63A 2WAWA 4IRPA 1VH3A 2DPWA 1R80A 3V0MA 3DUVA 2O1FA 2OI7A 3R2WA 1NF5B 4FRHA 4G87A 1R7TA 5C3AA 1ZJ2A 4ASJA 1GWWA 3POLA 1ZJ0A 2V0JA 2D7IA 1XZ6A 2W0WA 4B2XA 4DE7A 1HM9A 4B5BA 3SXGA 2X5ZA 3ZGFA 2RIYA 4MIXA 4FREA 2OI5A 4B4MA 5C36A 1O7QA 4M28A 4ASYA 2QKXA 2RJ1A 2AM4A 1H5RB 3U2XA 4FCUA 1ZIZA 2MZBA 4Y7GA 5IFYA 3TQDA 3CGXA 2VS4A 4KC1A 1FGGA 4KC2A 1VGTA 1H5TA 1G0RA 3K8DA 4Y7FA 2PX7A 2FYDB 4FRLA 5CMIA 4HO9A 1FWYA 3CKQA 3SXAA 1HM8A 1VZXA 2ZU8A 1ZJPA 4KT7A 1JV3A 5J49A 5EIYA 1SS9A 1XHBA 4G3QA 4JISA 1HJLA 3OH3A 4R7PA 1ZJ1A 3O3PA 1S4NA 2FFUA 2ZU7A 1HM0A 3SXBA 2JCKA 3NGWA 2O1GA 1FOAA 3PKQA 2PA4A 2VXLA 5D91A 4Q7CA 5C4DA 1QGSA 4HCQA 4KRVA 5HS2A 2Y4JA 1H7GA 2AESA 3CKVA 5IDSA 2RIZA 2AECA 3I0FA 4AAWA 1OMZA 1VGWA 4G3SA 1FRWA 4Y64A 1KWSA 1H4DA 1LZ0A 1Z90A 1PZYB 4NANA 1NMMB 2OEFA 1TW5A 2RJ5A 1YP2A 4LW3A 3U2TA 2RJ8A 3I0CA 3SXCA 2RJ0A 1ZI5A 4BQHA 3OKRA 4HO3A 5FU0A 1GX0A 4M2AA 2NXVA 4O6MA 4FIYA 4CJ8A 3IOJA 3V0LA 4Y7TA 2VSHA 2RJ9A 1H5RA 1VGUA 1LZJA 1S4PA 4NAKA 1G23A 5EJZA 1ZCYA 2FY7A 1YP4A 2VSIA 2VXMA 3USRA 1H3MA 5CMHA 2YQJA 5DDVA 4AC3A 3T7MA 1LL2A 4FROA 2WGZA 3D98A 2XMEA 3JTJA 3ZLLA 4FRBA 4J18A 2J0BA 2Z86A 4K6RA 1ZDGA 2I5KA 2JCLA 2WEEA 4BMAA 4GBPA 3V8YA 3FOQA 1R82A 3ZLKA 2X5SA 5C48A 5I1FA 1R7UA 4HG6A 4FCEA 2Q4JA 3EE5A 4KXOA 3HL3A 3OH4A 1FXJA 1PZTA 2WE9A 1E5KA 1WVCA 4M4KA 3SXEA 2GGQA 1FZWA 1V84A 4CVHA 4KPXA 3GUEA 1TVYA 4D11A 4ARWA 2FFVA 2E8BA 4D11C 1ZI4A 2RIXA 2V0IA 2VK9A 1ZDFA 3V0QA 1FR8A 1O7OA 1HV9A 1V83A 4HOCA 4AYJA 4HO0A 3IOIA 5JQQA 3SPTA 1HJJA 4FRAA 4NALA 4XWIA 2YQHA 3T7NA 5DDTA 3V91A 4Y6NA 1JVDA 1I52A 2Y4LA 3ST8A 3ZF8A 2RJ6A 2AM3A 2J0AA 2YCMA 1FGXA 3LW6A 3SX5A 4O6NA 1ZCUA 2X60A 2D7RA 1GQCA 1VPAA 2A8UA 3F1CA 4Y7VA 3CKJA 2RJ7A 1H4CA 2Y4KA 1WT2A 5C3DA 2UX8A 4G3PA 4ECMA 1LZIA 2VS5A 1WSZA 2FYCB 1H7TA 1FO8A 1G97A 1YP3A 3I0IX 2YQSA 2JCOA 5AJNA 3K8EA 4DECA 1ZI3A 2P72A 1ON6A 3OAMA 4EVWA 1ZCTA 1JVGA 4MNDA 1MP3A 2P6WA 2ICXA 1EZIA 1O23B 3RMWA 5CMGX 5CQPA 2AM5A 2Y6PA 5BXCA 4HO2A 1TW1A 5FTSA 3V8ZA 4FQWA 1G9RA 1NKHB 1VICA 1VZTA 1IINA 2ZU9A 4HO6A 5C1LA 1QG8A 5CMFX 2BO8A 2O1HA 5FV9A 3DK5A 2Y7AA 4Y7UA 3V0PA 3DJ4A 4KNXA 5CQNX 3U2WA 4L41C 4EEOA 2V0KA 2C0NA 3V0NA 2QGIA 3D8VA 5AJPA 2AGDA 5L6VA 4D48A 1JYLA 4Y62A 5C1GA 5L6SA 3I0EA 1TZFA 5FU8A 4DDZA 1MC3A 2P73A 3N9WA 1VZUA 5CMJA 1EYRA 1FXOA 1WT3A 3V0OA 3I0HA 4E1KA 3SXDA 4EEGA 1JV1A 2CU2A 4YS8A 4FRQA 4EEAA 1INIA 1WT1A 1LL3A 4ZDQA 3SX7A 5C49A 3OC9A 4B2WA 4AYLA 2WVMA 3I0JA 1ZHJA 3BCVA 1ON8A 3U0XA 4C2SA 2AH9A 1R7XA 2A8WA 1NQIB 2BO7A 1G2VA 1GQ9A 1R7VA 4B4BA 4D0TA 3PKPA 3V90A 3OH1A 2XWNA 4D0ZA 1H5SB 2OEGA 2WVKA 1K4VA 2PGYA 4FRDA 4CJCA 4EE4A 4EE5A 3CU0A 4P00A 5C38A 1INJA 4FRMA 2OI6A 1V82A 2BO4A 2FYBA 5EJ1A 4Y9XA 5C3BA 5IDTA 2PGVA 2X65A 5C4FA 1ZCVA 1VM8A 2QH5A 1LL0A 2V0LA 2YC3A 4HO8A 1MP5A 3Q80A 3FWWA 3I0GA 3PNNA 3TZTA 1W77A 1MP4A 1GWVA 2VFZA 5C47A 5C1HA 4CJBA 1H4EA 1JYKA 3QVBA 2RJ4A 2APCA 1OMXA 1R81A 3U0YA 5C4EA 3D5NA 1W55A 1NHEB 1H7EA 3JUKA 1W57A 2V0HA 1S4OA 3OH2A 3U2UA 3I0DA 3BRKX 1LVWA 1R7YA 1YROB 4B4GA 1H5SD 1G1LA 5CQMX 4HO4A 1ZI1A 4UEGA 4KQLA 3OH0A 2YQCA 4JD0A 3E26A 3OGZA 5D92A 3E25A 5FYEA 2AE7A 4MYBA 3Q7UA 2E3DA 2YESA 5CQLX 1H5SA 2I5EA 1FO9A 4IRQA 1WT0A 1H7QA 1H5SC 5C8RA 3T7OA 2Z87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IIM A;  1H7L A;  1FR9 A;  2WVL A;  1H7F A;  2XWL A;  3IOH A;  1VH1 A;  4B42 A;  2XWM A;  1G3L A;  2VD4 A;  2GGO A;  5CQO A;  3CKO A;  2JCJ A;  4FRP A;  1GX4 A;  3I0L A;  1ZJO A;  2BO6 A;  1NWG B;  3F1Y A;  4M2B A;  3JUJ A;  1FG5 N;  3RMV A;  5FUH A;  3SX8 A;  1H5T B;  1GA8 A;  1H7H A;  2I7B A;  2Y4M A;  1LZ7 A;  2W0V A;  2FYA A;  1VGZ A;  4Y6U A;  3RSB A;  4EE3 A;  3I0K A;  1QWJ A;  2ICY A;  2XMH A;  4KPZ A;  4LW6 A;  4P02 A;  1ZJ3 A;  5C4C A;  1G8O A;  3USQ A;  1QGQ A;  1G93 A;  1OQM B;  2D0J A;  4B3U A;  4KNR A;  1O0R A;  4NAI A;  3R3I A;  3ZGG A;  2RIT A;  1G95 A;  5AJO A;  4KC4 A;  3Q4S A;  4EEM A;  3U2V A;  5FTV A;  2VS3 A;  5C4B A;  2YC5 A;  3SX3 A;  4HO5 A;  3KIA A;  3CKN A;  4Y63 A;  2WAW A;  4IRP A;  1VH3 A;  2DPW A;  1R80 A;  3V0M A;  3DUV A;  2O1F A;  2OI7 A;  3R2W A;  1NF5 B;  4FRH A;  4G87 A;  1R7T A;  5C3A A;  1ZJ2 A;  4ASJ A;  1GWW A;  3POL A;  1ZJ0 A;  2V0J A;  2D7I A;  1XZ6 A;  2W0W A;  4B2X A;  4DE7 A;  1HM9 A;  4B5B A;  3SXG A;  2X5Z A;  3ZGF A;  2RIY A;  4FRE A;  2OI5 A;  4B4M A;  5C36 A;  1O7Q A;  4M28 A;  4ASY A;  2QKX A;  2RJ1 A;  2AM4 A;  1H5R B;  3U2X A;  4FCU A;  1ZIZ A;  2MZB A;  4Y7G A;  5IFY A;  3TQD A;  3CGX A;  2VS4 A;  4KC1 A;  1FGG A;  4KC2 A;  1VGT A;  1H5T A;  1G0R A;  3K8D A;  4Y7F A;  2PX7 A;  2FYD B;  4FRL A;  5CMI A;  4HO9 A;  1FWY A;  3CKQ A;  3SXA A;  1HM8 A;  1VZX A;  2ZU8 A;  1ZJP A;  4KT7 A;  1JV3 A;  5J49 A;  5EIY A;  1SS9 A;  1XHB A;  4G3Q A;  4JIS A;  1HJL A;  3OH3 A;  4R7P A;  1ZJ1 A;  3O3P A;  1S4N A;  2FFU A;  2ZU7 A;  1HM0 A;  3SXB A;  2JCK A;  3NGW A;  2O1G A;  1FOA A;  3PKQ A;  2PA4 A;  2VXL A;  5C4D A;  1QGS A;  4HCQ A;  4KRV A;  5HS2 A;  2Y4J A;  1H7G A;  2AES A;  3CKV A;  5IDS A;  2RIZ A;  2AEC A;  3I0F A;  4AAW A;  1OMZ A;  1VGW A;  4G3S A;  1FRW A;  4Y64 A;  1KWS A;  1H4D A;  1LZ0 A;  1Z90 A;  1PZY B;  4NAN A;  1NMM B;  2OEF A;  1TW5 A;  2RJ5 A;  1YP2 A;  4LW3 A;  3U2T A;  2RJ8 A;  3I0C A;  3SXC A;  2RJ0 A;  1ZI5 A;  4BQH A;  3OKR A;  4HO3 A;  5FU0 A;  1GX0 A;  4M2A A;  2NXV A;  4CJ8 A;  3IOJ A;  3V0L A;  4Y7T A;  2VSH A;  2RJ9 A;  1H5R A;  1VGU A;  1LZJ A;  1S4P A;  4NAK A;  1G23 A;  5EJZ A;  1ZCY A;  2FY7 A;  1YP4 A;  2VSI A;  2VXM A;  3USR A;  1H3M A;  5CMH A;  2YQJ A;  5DDV A;  4AC3 A;  3T7M A;  1LL2 A;  4FRO A;  2WGZ A;  3D98 A;  2XME A;  3JTJ A;  3ZLL A;  4FRB A;  4J18 A;  2Z86 A;  4K6R A;  1ZDG A;  2I5K A;  2JCL A;  2WEE A;  4BMA A;  4GBP A;  3V8Y A;  3FOQ A;  1R82 A;  3ZLK A;  2X5S A;  5C48 A;  5I1F A;  1R7U A;  4HG6 A;  4FCE A;  2Q4J A;  3EE5 A;  4KXO A;  3HL3 A;  3OH4 A;  1FXJ A;  1PZT A;  2WE9 A;  1E5K A;  1WVC A;  4M4K A;  3SXE A;  2GGQ A;  1FZW A;  1V84 A;  4CVH A;  4KPX A;  3GUE A;  1TVY A;  4D11 A;  4ARW A;  2FFV A;  2E8B A;  4D11 C;  1ZI4 A;  2RIX A;  2V0I A;  3V0Q A;  1ZDF A;  1FR8 A;  1O7O A;  1HV9 A;  1V83 A;  4HOC A;  4AYJ A;  4HO0 A;  3IOI A;  5JQQ A;  3SPT A;  1HJJ A;  4FRA A;  4NAL A;  4XWI A;  2YQH A;  3T7N A;  5DDT A;  3V91 A;  4Y6N A;  1JVD A;  1I52 A;  2Y4L A;  3ST8 A;  3ZF8 A;  2RJ6 A;  2AM3 A;  2YCM A;  1FGX A;  3LW6 A;  3SX5 A;  1ZCU A;  2X60 A;  2D7R A;  1GQC A;  1VPA A;  2A8U A;  3F1C A;  4Y7V A;  3CKJ A;  2RJ7 A;  1H4C A;  2Y4K A;  1WT2 A;  5C3D A;  2UX8 A;  4G3P A;  4ECM A;  1LZI A;  2VS5 A;  1WSZ A;  2FYC B;  1H7T A;  1FO8 A;  1G97 A;  1YP3 A;  3I0I X;  2YQS A;  2JCO A;  5AJN A;  3K8E A;  4DEC A;  1ZI3 A;  2P72 A;  1ON6 A;  3OAM A;  4EVW A;  1ZCT A;  1JVG A;  4MND A;  1MP3 A;  2P6W A;  2ICX A;  1EZI A;  1O23 B;  3RMW A;  5CMG X;  5CQP A;  2AM5 A;  2Y6P A;  5BXC A;  4HO2 A;  1TW1 A;  5FTS A;  3V8Z A;  4FQW A;  1G9R A;  1NKH B;  1VIC A;  1VZT A;  1IIN A;  2ZU9 A;  4HO6 A;  5C1L A;  1QG8 A;  5CMF X;  2BO8 A;  2O1H A;  5FV9 A;  3DK5 A;  2Y7A A;  4Y7U A;  3V0P A;  3DJ4 A;  4KNX A;  5CQN X;  3U2W A;  4L41 C;  4EEO A;  2V0K A;  3V0N A;  2QGI A;  3D8V A;  5AJP A;  2AGD A;  5L6V A;  4D48 A;  1JYL A;  4Y62 A;  5C1G A;  5L6S A;  3I0E A;  1TZF A;  5FU8 A;  4DDZ A;  1MC3 A;  2P73 A;  3N9W A;  1VZU A;  5CMJ A;  1EYR A;  1FXO A;  1WT3 A;  3V0O A;  3I0H A;  4E1K A;  3SXD A;  4EEG A;  1JV1 A;  2CU2 A;  4YS8 A;  4FRQ A;  4EEA A;  1INI A;  1WT1 A;  1LL3 A;  4ZDQ A;  3SX7 A;  5C49 A;  3OC9 A;  4B2W A;  4AYL A;  2WVM A;  3I0J A;  1ZHJ A;  3BCV A;  1ON8 A;  3U0X A;  4C2S A;  2AH9 A;  1R7X A;  2A8W A;  1NQI B;  2BO7 A;  1G2V A;  1GQ9 A;  1R7V A;  4B4B A;  4D0T A;  3PKP A;  3V90 A;  3OH1 A;  2XWN A;  4D0Z A;  1H5S B;  2OEG A;  2WVK A;  1K4V A;  2PGY A;  4FRD A;  4CJC A;  4EE4 A;  4EE5 A;  3CU0 A;  4P00 A;  5C38 A;  1INJ A;  4FRM A;  2OI6 A;  1V82 A;  2BO4 A;  2FYB A;  5EJ1 A;  4Y9X A;  5C3B A;  5IDT A;  2PGV A;  2X65 A;  5C4F A;  1ZCV A;  1VM8 A;  2QH5 A;  1LL0 A;  2V0L A;  2YC3 A;  4HO8 A;  1MP5 A;  3Q80 A;  3FWW A;  3I0G A;  3PNN A;  3TZT A;  1W77 A;  1MP4 A;  1GWV A;  2VFZ A;  5C47 A;  5C1H A;  4CJB A;  1H4E A;  1JYK A;  3QVB A;  2RJ4 A;  2APC A;  1OMX A;  1R81 A;  3U0Y A;  5C4E A;  3D5N A;  1W55 A;  1NHE B;  1H7E A;  3JUK A;  1W57 A;  2V0H A;  1S4O A;  3OH2 A;  3U2U A;  3I0D A;  3BRK X;  1LVW A;  1R7Y A;  1YRO B;  4B4G A;  1H5S D;  1G1L A;  5CQM X;  4HO4 A;  1ZI1 A;  4UEG A;  4KQL A;  3OH0 A;  2YQC A;  4JD0 A;  3E26 A;  3OGZ A;  3E25 A;  5FYE A;  2AE7 A;  4MYB A;  3Q7U A;  2E3D A;  2YES A;  5CQL X;  1H5S A;  2I5E A;  1FO9 A;  4IRQ A;  1WT0 A;  1H7Q A;  1H5S C;  5C8R A;  3T7O A;  2Z87 A; 
#chains in the Genus database with same CATH topology
 1IIM A;  1H7L A;  1FR9 A;  2WVL A;  1H7F A;  2XWL A;  3IOH A;  1VH1 A;  4B42 A;  2XWM A;  1G3L A;  2VD4 A;  2GGO A;  5CQO A;  3CKO A;  2JCJ A;  4FRP A;  1GX4 A;  3I0L A;  1ZJO A;  2BO6 A;  1NWG B;  3F1Y A;  4M2B A;  3JUJ A;  1FG5 N;  3RMV A;  5FUH A;  3SX8 A;  1H5T B;  1GA8 A;  1H7H A;  2I7B A;  2Y4M A;  1LZ7 A;  2W0V A;  2FYA A;  4FIX A;  1VGZ A;  4Y6U A;  3RSB A;  4EE3 A;  3I0K A;  1QWJ A;  2ICY A;  2XMH A;  4KPZ A;  4LW6 A;  4P02 A;  1ZJ3 A;  5C4C A;  1G8O A;  3USQ A;  1QGQ A;  1G93 A;  1OQM B;  2D0J A;  4B3U A;  4KNR A;  1O0R A;  4NAI A;  3R3I A;  3ZGG A;  2RIT A;  1G95 A;  5AJO A;  4KC4 A;  3Q4S A;  4EEM A;  3U2V A;  5FTV A;  2VS3 A;  5C4B A;  2YC5 A;  3SX3 A;  4HO5 A;  3KIA A;  3CKN A;  4Y63 A;  2WAW A;  4IRP A;  1VH3 A;  2DPW A;  1R80 A;  3V0M A;  3DUV A;  2O1F A;  2OI7 A;  3R2W A;  1NF5 B;  4FRH A;  4G87 A;  1R7T A;  5C3A A;  1ZJ2 A;  4ASJ A;  1GWW A;  3POL A;  1ZJ0 A;  2V0J A;  2D7I A;  1XZ6 A;  2W0W A;  4B2X A;  4DE7 A;  1HM9 A;  4B5B A;  3SXG A;  2X5Z A;  3ZGF A;  2RIY A;  4MIX A;  4FRE A;  2OI5 A;  4B4M A;  5C36 A;  1O7Q A;  4M28 A;  4ASY A;  2QKX A;  2RJ1 A;  2AM4 A;  1H5R B;  3U2X A;  4FCU A;  1ZIZ A;  2MZB A;  4Y7G A;  5IFY A;  3TQD A;  3CGX A;  2VS4 A;  4KC1 A;  1FGG A;  4KC2 A;  1VGT A;  1H5T A;  1G0R A;  3K8D A;  4Y7F A;  2PX7 A;  2FYD B;  4FRL A;  5CMI A;  4HO9 A;  1FWY A;  3CKQ A;  3SXA A;  1HM8 A;  1VZX A;  2ZU8 A;  1ZJP A;  4KT7 A;  1JV3 A;  5J49 A;  5EIY A;  1SS9 A;  1XHB A;  4G3Q A;  4JIS A;  1HJL A;  3OH3 A;  4R7P A;  1ZJ1 A;  3O3P A;  1S4N A;  2FFU A;  2ZU7 A;  1HM0 A;  3SXB A;  2JCK A;  3NGW A;  2O1G A;  1FOA A;  3PKQ A;  2PA4 A;  2VXL A;  5D91 A;  4Q7C A;  5C4D A;  1QGS A;  4HCQ A;  4KRV A;  5HS2 A;  2Y4J A;  1H7G A;  2AES A;  3CKV A;  5IDS A;  2RIZ A;  2AEC A;  3I0F A;  4AAW A;  1OMZ A;  1VGW A;  4G3S A;  1FRW A;  4Y64 A;  1KWS A;  1H4D A;  1LZ0 A;  1Z90 A;  1PZY B;  4NAN A;  1NMM B;  2OEF A;  1TW5 A;  2RJ5 A;  1YP2 A;  4LW3 A;  3U2T A;  2RJ8 A;  3I0C A;  3SXC A;  2RJ0 A;  1ZI5 A;  4BQH A;  3OKR A;  4HO3 A;  5FU0 A;  1GX0 A;  4M2A A;  2NXV A;  4O6M A;  4FIY A;  4CJ8 A;  3IOJ A;  3V0L A;  4Y7T A;  2VSH A;  2RJ9 A;  1H5R A;  1VGU A;  1LZJ A;  1S4P A;  4NAK A;  1G23 A;  5EJZ A;  1ZCY A;  2FY7 A;  1YP4 A;  2VSI A;  2VXM A;  3USR A;  1H3M A;  5CMH A;  2YQJ A;  5DDV A;  4AC3 A;  3T7M A;  1LL2 A;  4FRO A;  2WGZ A;  3D98 A;  2XME A;  3JTJ A;  3ZLL A;  4FRB A;  4J18 A;  2J0B A;  2Z86 A;  4K6R A;  1ZDG A;  2I5K A;  2JCL A;  2WEE A;  4BMA A;  4GBP A;  3V8Y A;  3FOQ A;  1R82 A;  3ZLK A;  2X5S A;  5C48 A;  5I1F A;  1R7U A;  4HG6 A;  4FCE A;  2Q4J A;  3EE5 A;  4KXO A;  3HL3 A;  3OH4 A;  1FXJ A;  1PZT A;  2WE9 A;  1E5K A;  1WVC A;  4M4K A;  3SXE A;  2GGQ A;  1FZW A;  1V84 A;  4CVH A;  4KPX A;  3GUE A;  1TVY A;  4D11 A;  4ARW A;  2FFV A;  2E8B A;  4D11 C;  1ZI4 A;  2RIX A;  2V0I A;  2VK9 A;  1ZDF A;  3V0Q A;  1FR8 A;  1O7O A;  1HV9 A;  1V83 A;  4HOC A;  4AYJ A;  4HO0 A;  3IOI A;  5JQQ A;  3SPT A;  1HJJ A;  4FRA A;  4NAL A;  4XWI A;  2YQH A;  3T7N A;  5DDT A;  3V91 A;  4Y6N A;  1JVD A;  1I52 A;  2Y4L A;  3ST8 A;  3ZF8 A;  2RJ6 A;  2AM3 A;  2J0A A;  2YCM A;  1FGX A;  3LW6 A;  3SX5 A;  4O6N A;  1ZCU A;  2X60 A;  2D7R A;  1GQC A;  1VPA A;  2A8U A;  3F1C A;  4Y7V A;  3CKJ A;  2RJ7 A;  1H4C A;  2Y4K A;  1WT2 A;  5C3D A;  2UX8 A;  4G3P A;  4ECM A;  1LZI A;  2VS5 A;  1WSZ A;  2FYC B;  1H7T A;  1FO8 A;  1G97 A;  1YP3 A;  3I0I X;  2YQS A;  2JCO A;  5AJN A;  3K8E A;  4DEC A;  1ZI3 A;  2P72 A;  1ON6 A;  3OAM A;  4EVW A;  1ZCT A;  1JVG A;  4MND A;  1MP3 A;  2P6W A;  2ICX A;  1EZI A;  1O23 B;  3RMW A;  5CMG X;  5CQP A;  2AM5 A;  2Y6P A;  5BXC A;  4HO2 A;  1TW1 A;  5FTS A;  3V8Z A;  4FQW A;  1G9R A;  1NKH B;  1VIC A;  1VZT A;  1IIN A;  2ZU9 A;  4HO6 A;  5C1L A;  1QG8 A;  5CMF X;  2BO8 A;  2O1H A;  5FV9 A;  3DK5 A;  2Y7A A;  4Y7U A;  3V0P A;  3DJ4 A;  4KNX A;  5CQN X;  3U2W A;  4L41 C;  4EEO A;  2V0K A;  2C0N A;  3V0N A;  2QGI A;  3D8V A;  5AJP A;  2AGD A;  5L6V A;  4D48 A;  1JYL A;  4Y62 A;  5C1G A;  5L6S A;  3I0E A;  1TZF A;  5FU8 A;  4DDZ A;  1MC3 A;  2P73 A;  3N9W A;  1VZU A;  5CMJ A;  1EYR A;  1FXO A;  1WT3 A;  3V0O A;  3I0H A;  4E1K A;  3SXD A;  4EEG A;  1JV1 A;  2CU2 A;  4YS8 A;  4FRQ A;  4EEA A;  1INI A;  1WT1 A;  1LL3 A;  4ZDQ A;  3SX7 A;  5C49 A;  3OC9 A;  4B2W A;  4AYL A;  2WVM A;  3I0J A;  1ZHJ A;  3BCV A;  1ON8 A;  3U0X A;  4C2S A;  2AH9 A;  1R7X A;  2A8W A;  1NQI B;  2BO7 A;  1G2V A;  1GQ9 A;  1R7V A;  4B4B A;  4D0T A;  3PKP A;  3V90 A;  3OH1 A;  2XWN A;  4D0Z A;  1H5S B;  2OEG A;  2WVK A;  1K4V A;  2PGY A;  4FRD A;  4CJC A;  4EE4 A;  4EE5 A;  3CU0 A;  4P00 A;  5C38 A;  1INJ A;  4FRM A;  2OI6 A;  1V82 A;  2BO4 A;  2FYB A;  5EJ1 A;  4Y9X A;  5C3B A;  5IDT A;  2PGV A;  2X65 A;  5C4F A;  1ZCV A;  1VM8 A;  2QH5 A;  1LL0 A;  2V0L A;  2YC3 A;  4HO8 A;  1MP5 A;  3Q80 A;  3FWW A;  3I0G A;  3PNN A;  3TZT A;  1W77 A;  1MP4 A;  1GWV A;  2VFZ A;  5C47 A;  5C1H A;  4CJB A;  1H4E A;  1JYK A;  3QVB A;  2RJ4 A;  2APC A;  1OMX A;  1R81 A;  3U0Y A;  5C4E A;  3D5N A;  1W55 A;  1NHE B;  1H7E A;  3JUK A;  1W57 A;  2V0H A;  1S4O A;  3OH2 A;  3U2U A;  3I0D A;  3BRK X;  1LVW A;  1R7Y A;  1YRO B;  4B4G A;  1H5S D;  1G1L A;  5CQM X;  4HO4 A;  1ZI1 A;  4UEG A;  4KQL A;  3OH0 A;  2YQC A;  4JD0 A;  3E26 A;  3OGZ A;  5D92 A;  3E25 A;  5FYE A;  2AE7 A;  4MYB A;  3Q7U A;  2E3D A;  2YES A;  5CQL X;  1H5S A;  2I5E A;  1FO9 A;  4IRQ A;  1WT0 A;  1H7Q A;  1H5S C;  5C8R A;  3T7O A;  2Z87 A; 
#chains in the Genus database with same CATH homology
 1IIM A;  1H7L A;  1FR9 A;  2WVL A;  1H7F A;  2XWL A;  3IOH A;  1VH1 A;  4B42 A;  2XWM A;  1G3L A;  2VD4 A;  2GGO A;  5CQO A;  3CKO A;  2JCJ A;  4FRP A;  1GX4 A;  3I0L A;  1ZJO A;  2BO6 A;  1NWG B;  3F1Y A;  4M2B A;  3JUJ A;  1FG5 N;  3RMV A;  5FUH A;  3SX8 A;  1H5T B;  1GA8 A;  1H7H A;  2I7B A;  2Y4M A;  1LZ7 A;  2W0V A;  2FYA A;  4FIX A;  1VGZ A;  4Y6U A;  3RSB A;  4EE3 A;  3I0K A;  1QWJ A;  2ICY A;  2XMH A;  4KPZ A;  4LW6 A;  4P02 A;  1ZJ3 A;  5C4C A;  1G8O A;  3USQ A;  1QGQ A;  1G93 A;  1OQM B;  2D0J A;  4B3U A;  4KNR A;  1O0R A;  4NAI A;  3R3I A;  3ZGG A;  2RIT A;  1G95 A;  5AJO A;  4KC4 A;  3Q4S A;  4EEM A;  3U2V A;  5FTV A;  2VS3 A;  5C4B A;  2YC5 A;  3SX3 A;  4HO5 A;  3KIA A;  3CKN A;  4Y63 A;  2WAW A;  4IRP A;  1VH3 A;  2DPW A;  1R80 A;  3V0M A;  3DUV A;  2O1F A;  2OI7 A;  3R2W A;  1NF5 B;  4FRH A;  4G87 A;  1R7T A;  5C3A A;  1ZJ2 A;  4ASJ A;  1GWW A;  3POL A;  1ZJ0 A;  2V0J A;  2D7I A;  1XZ6 A;  2W0W A;  4B2X A;  4DE7 A;  1HM9 A;  4B5B A;  3SXG A;  2X5Z A;  3ZGF A;  2RIY A;  4MIX A;  4FRE A;  2OI5 A;  4B4M A;  5C36 A;  1O7Q A;  4M28 A;  4ASY A;  2QKX A;  2RJ1 A;  2AM4 A;  1H5R B;  3U2X A;  4FCU A;  1ZIZ A;  2MZB A;  4Y7G A;  5IFY A;  3TQD A;  3CGX A;  2VS4 A;  4KC1 A;  1FGG A;  4KC2 A;  1VGT A;  1H5T A;  1G0R A;  3K8D A;  4Y7F A;  2PX7 A;  2FYD B;  4FRL A;  5CMI A;  4HO9 A;  1FWY A;  3CKQ A;  3SXA A;  1HM8 A;  1VZX A;  2ZU8 A;  1ZJP A;  4KT7 A;  1JV3 A;  5J49 A;  5EIY A;  1SS9 A;  1XHB A;  4G3Q A;  4JIS A;  1HJL A;  3OH3 A;  4R7P A;  1ZJ1 A;  3O3P A;  1S4N A;  2FFU A;  2ZU7 A;  1HM0 A;  3SXB A;  2JCK A;  3NGW A;  2O1G A;  1FOA A;  3PKQ A;  2PA4 A;  2VXL A;  5D91 A;  4Q7C A;  5C4D A;  1QGS A;  4HCQ A;  4KRV A;  5HS2 A;  2Y4J A;  1H7G A;  2AES A;  3CKV A;  5IDS A;  2RIZ A;  2AEC A;  3I0F A;  4AAW A;  1OMZ A;  1VGW A;  4G3S A;  1FRW A;  4Y64 A;  1KWS A;  1H4D A;  1LZ0 A;  1Z90 A;  1PZY B;  4NAN A;  1NMM B;  2OEF A;  1TW5 A;  2RJ5 A;  1YP2 A;  4LW3 A;  3U2T A;  2RJ8 A;  3I0C A;  3SXC A;  2RJ0 A;  1ZI5 A;  4BQH A;  3OKR A;  4HO3 A;  5FU0 A;  1GX0 A;  4M2A A;  2NXV A;  4O6M A;  4FIY A;  4CJ8 A;  3IOJ A;  3V0L A;  4Y7T A;  2VSH A;  2RJ9 A;  1H5R A;  1VGU A;  1LZJ A;  1S4P A;  4NAK A;  1G23 A;  5EJZ A;  1ZCY A;  2FY7 A;  1YP4 A;  2VSI A;  2VXM A;  3USR A;  1H3M A;  5CMH A;  2YQJ A;  5DDV A;  4AC3 A;  3T7M A;  1LL2 A;  4FRO A;  2WGZ A;  3D98 A;  2XME A;  3JTJ A;  3ZLL A;  4FRB A;  4J18 A;  2J0B A;  2Z86 A;  4K6R A;  1ZDG A;  2I5K A;  2JCL A;  2WEE A;  4BMA A;  4GBP A;  3V8Y A;  3FOQ A;  1R82 A;  3ZLK A;  2X5S A;  5C48 A;  5I1F A;  1R7U A;  4HG6 A;  4FCE A;  2Q4J A;  3EE5 A;  4KXO A;  3HL3 A;  3OH4 A;  1FXJ A;  1PZT A;  2WE9 A;  1E5K A;  1WVC A;  4M4K A;  3SXE A;  2GGQ A;  1FZW A;  1V84 A;  4CVH A;  4KPX A;  3GUE A;  1TVY A;  4D11 A;  4ARW A;  2FFV A;  2E8B A;  4D11 C;  1ZI4 A;  2RIX A;  2V0I A;  2VK9 A;  1ZDF A;  3V0Q A;  1FR8 A;  1O7O A;  1HV9 A;  1V83 A;  4HOC A;  4AYJ A;  4HO0 A;  3IOI A;  5JQQ A;  3SPT A;  1HJJ A;  4FRA A;  4NAL A;  4XWI A;  2YQH A;  3T7N A;  5DDT A;  3V91 A;  4Y6N A;  1JVD A;  1I52 A;  2Y4L A;  3ST8 A;  3ZF8 A;  2RJ6 A;  2AM3 A;  2J0A A;  2YCM A;  1FGX A;  3LW6 A;  3SX5 A;  4O6N A;  1ZCU A;  2X60 A;  2D7R A;  1GQC A;  1VPA A;  2A8U A;  3F1C A;  4Y7V A;  3CKJ A;  2RJ7 A;  1H4C A;  2Y4K A;  1WT2 A;  5C3D A;  2UX8 A;  4G3P A;  4ECM A;  1LZI A;  2VS5 A;  1WSZ A;  2FYC B;  1H7T A;  1FO8 A;  1G97 A;  1YP3 A;  3I0I X;  2YQS A;  2JCO A;  5AJN A;  3K8E A;  4DEC A;  1ZI3 A;  2P72 A;  1ON6 A;  3OAM A;  4EVW A;  1ZCT A;  1JVG A;  4MND A;  1MP3 A;  2P6W A;  2ICX A;  1EZI A;  1O23 B;  3RMW A;  5CMG X;  5CQP A;  2AM5 A;  2Y6P A;  5BXC A;  4HO2 A;  1TW1 A;  5FTS A;  3V8Z A;  4FQW A;  1G9R A;  1NKH B;  1VIC A;  1VZT A;  1IIN A;  2ZU9 A;  4HO6 A;  5C1L A;  1QG8 A;  5CMF X;  2BO8 A;  2O1H A;  5FV9 A;  3DK5 A;  2Y7A A;  4Y7U A;  3V0P A;  3DJ4 A;  4KNX A;  5CQN X;  3U2W A;  4L41 C;  4EEO A;  2V0K A;  2C0N A;  3V0N A;  2QGI A;  3D8V A;  5AJP A;  2AGD A;  5L6V A;  4D48 A;  1JYL A;  4Y62 A;  5C1G A;  5L6S A;  3I0E A;  1TZF A;  5FU8 A;  4DDZ A;  1MC3 A;  2P73 A;  3N9W A;  1VZU A;  5CMJ A;  1EYR A;  1FXO A;  1WT3 A;  3V0O A;  3I0H A;  4E1K A;  3SXD A;  4EEG A;  1JV1 A;  2CU2 A;  4YS8 A;  4FRQ A;  4EEA A;  1INI A;  1WT1 A;  1LL3 A;  4ZDQ A;  3SX7 A;  5C49 A;  3OC9 A;  4B2W A;  4AYL A;  2WVM A;  3I0J A;  1ZHJ A;  3BCV A;  1ON8 A;  3U0X A;  4C2S A;  2AH9 A;  1R7X A;  2A8W A;  1NQI B;  2BO7 A;  1G2V A;  1GQ9 A;  1R7V A;  4B4B A;  4D0T A;  3PKP A;  3V90 A;  3OH1 A;  2XWN A;  4D0Z A;  1H5S B;  2OEG A;  2WVK A;  1K4V A;  2PGY A;  4FRD A;  4CJC A;  4EE4 A;  4EE5 A;  3CU0 A;  4P00 A;  5C38 A;  1INJ A;  4FRM A;  2OI6 A;  1V82 A;  2BO4 A;  2FYB A;  5EJ1 A;  4Y9X A;  5C3B A;  5IDT A;  2PGV A;  2X65 A;  5C4F A;  1ZCV A;  1VM8 A;  2QH5 A;  1LL0 A;  2V0L A;  2YC3 A;  4HO8 A;  1MP5 A;  3Q80 A;  3FWW A;  3I0G A;  3PNN A;  3TZT A;  1W77 A;  1MP4 A;  1GWV A;  2VFZ A;  5C47 A;  5C1H A;  4CJB A;  1H4E A;  1JYK A;  3QVB A;  2RJ4 A;  2APC A;  1OMX A;  1R81 A;  3U0Y A;  5C4E A;  3D5N A;  1W55 A;  1NHE B;  1H7E A;  3JUK A;  1W57 A;  2V0H A;  1S4O A;  3OH2 A;  3U2U A;  3I0D A;  3BRK X;  1LVW A;  1R7Y A;  1YRO B;  4B4G A;  1H5S D;  1G1L A;  5CQM X;  4HO4 A;  1ZI1 A;  4UEG A;  4KQL A;  3OH0 A;  2YQC A;  4JD0 A;  3E26 A;  3OGZ A;  5D92 A;  3E25 A;  5FYE A;  2AE7 A;  4MYB A;  3Q7U A;  2E3D A;  2YES A;  5CQL X;  1H5S A;  2I5E A;  1FO9 A;  4IRQ A;  1WT0 A;  1H7Q A;  1H5S C;  5C8R A;  3T7O A;  2Z87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...