1K4VA

1.53 a crystal structure of the beta-galactoside-alpha-1,3-galactosyltransferase in complex with udp
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
287
structure length
287
Chain Sequence
KLKLSDWFNPFKRPEVVTMTKWKAPVVWEGTYNRAVLDNYYAKQKITVGLTVFAVGRYIEHYLEEFLTSANKHFMVGHPVIFYIMVDDVSRMPLIELGPLRSFKVFKIKPEKRWQDISMMRMKTIGEHIVAHIQHEVDFLFCMDVDQVFQDKFGVETLGESVAQLQAWWYKADPNDFTYERRKESAAYIPFGEGDFYYHAAIFGGTPTQVLNITQECFKGILKDKKNDIEAQWHDESHLNKYFLLNKPTKILSPEYCWDYHIGLPADIKLVKMSWQTKEYNVVRNNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N-ACETYLLACTOSAMINIDE ALPHA-1,3-GALACTOSYLTRANSFERASE
publication title Structure of UDP complex of UDP-galactose:beta-galactoside-alpha -1,3-galactosyltransferase at 1.53-A resolution reveals a conformational change in the catalytically important C terminus.
pubmed rcsb
source organism Bos taurus
total genus 108
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 2.4.1.87: N-acetyllactosaminide 3-alpha-galactosyltransferase.
pdb deposition date 2001-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1k4vA00
1NMMB 3RMWA 2APCA 4G3SA 1O7OA 2RJ9A 2P73A 2XWLA 4MNDA 1ZJ1A 3F1CA 4ARWA 1O7QA 1QWJA 3DUVA 3SPTA 3D98A 3OH1A 2FY7A 1FR8A 2X5SA 2Y4MA 2BO7A 2D7RA 4G3QA 4B2XA 3USQA 1G8OA 5FUHA 4HO2A 4IRQA 4FQWA 4M28A 4EEOA 3D8VA 2YC3A 2OEGA 2AM5A 2O1FA 5C3DA 2RJ8A 3U2VA 3CU0A 2UX8A 4D48A 5C4BA 1G3LA 2Y4LA 4ASJA 1H4EA 1H7HA 3CKQA 4MYBA 3SXAA 5JQQA 4FRMA 3SXGA 5FU8A 4HO0A 4C2SA 4E1KA 3IOIA 4UEGA 5FU0A 1MC3A 2OI6A 3CKNA 2D7IA 3K8EA 1ZI1A 4M2AA 4Y64A 3T7NA 1INIA 3E26A 1ZJ0A 1H5RA 2RIYA 1IIMA 3OH2A 5AJOA 1MP5A 2RJ6A 5C49A 1FG5N 4FRPA 4M4KA 2Y6PA 2W0WA 4CJBA 3Q7UA 1OQMB 1G1LA 2RJ0A 4HO8A 3V8ZA 2Q4JA 2XMEA 4FCEA 1QGQA 4ASYA 5DDVA 2WVLA 1FWYA 2YESA 3SXCA 2Z87A 4Y9XA 4NALA 1ON8A 1HV9A 1W55A 1IINA 1ZI3A 2I5KA 1GQ9A 4JISA 2Y7AA 1R7YA 3DK5A 4HO4A 3I0DA 3SX7A 1S4OA 1ZCVA 3CKOA 1SS9A 2FYAA 4CVHA 1V82A 1O0RA 1WT3A 4Y6NA 1WT2A 2JCJA 1WT0A 4G87A 4KQLA 4AYLA 2RJ5A 1FXJA 2WE9A 1W57A 1R7UA 3SXBA 1H5SC 1JYLA 1ZI5A 5C36A 1GQCA 3RMVA 4HO9A 4EVWA 3V90A 2A8UA 1ZIZA 2X5ZA 3IOJA 1OMZA 4K6RA 2V0JA 1TW1A 1H5TA 3V0PA 2ZU9A 3SXEA 1ZJ2A 4B3UA 2CU2A 5C47A 1PZYB 1VH3A 5C38A 2YCMA 4CJ8A 4P02A 4B4BA 4Y7UA 2VFZA 5J49A 2RIZA 4D11C 5C48A 1H5RB 5C8RA 3ZLLA 1R80A 2V0KA 5C4DA 3Q80A 1E5KA 1TZFA 1INJA 2YC5A 1ZHJA 3OH3A 2FFVA 4D0ZA 3SX8A 3SX3A 4L41C 4FROA 4KRVA 1H7GA 1ZCTA 2XWMA 4KC1A 3U2TA 5CQLX 1TVYA 4ZDQA 1O23B 2E3DA 1ZI4A 1Z90A 2VS5A 2WVMA 2JCLA 1G93A 2BO8A 2ZU7A 1VZXA 4B5BA 1R82A 5L6SA 3OH0A 4Y7VA 1GX0A 1LL3A 3GUEA 4HO5A 3JTJA 1JVGA 1G0RA 3V0MA 1H4DA 1H7LA 1H5SD 1VGTA 4HO3A 3N9WA 1LZIA 4BMAA 2X60A 2A8WA 3CKJA 1H7QA 4HO6A 5C4EA 3JUKA 5CMJA 3I0KA 1ZDFA 2JCKA 5IFYA 4G3PA 5FYEA 2AH9A 1H5TB 1S4PA 4CJCA 2WAWA 2OEFA 4Y6UA 1YP4A 3EE5A 2VD4A 1G95A 1YP2A 5FTVA 4JD0A 1EZIA 4Y63A 4EE5A 2P72A 2VSIA 4FRDA 1S4NA 2AESA 3ST8A 3U0XA 4FREA 1H7TA 1HM0A 4KPXA 3R3IA 3OGZA 1HJLA 1ZCYA 2Y4JA 3D5NA 1ZJOA 2AM4A 1FOAA 2V0LA 3ZF8A 4Y7GA 1R7TA 4HCQA 2PX7A 2BO6A 3Q4SA 3I0CA 2RJ4A 4IRPA 2JCOA 3V91A 3V0NA 5CQPA 5DDTA 2X65A 3LW6A 2MZBA 2RJ1A 4B4GA 3V0OA 3F1YA 3NGWA 3JUJA 3U2WA 5AJPA 1YROB 1VGZA 5AJNA 3PKPA 1KWSA 1H7FA 1FGXA 3PNNA 1G97A 4KNRA 1FGGA 5CMIA 2AE7A 2FFUA 1ZJPA 1G9RA 1H4CA 4NAKA 2V0HA 4KC2A 5IDSA 5BXCA 3FOQA 1V84A 2O1HA 4P00A 2AGDA 1W77A 4FRQA 4KC4A 4LW6A 4FRAA 1LVWA 3TZTA 1JVDA 5EJ1A 1LZ7A 2QH5A 3I0FA 1QGSA 5EIYA 1HJJA 1MP4A 5I1FA 5IDTA 2AM3A 2E8BA 5CMHA 4DECA 4FRHA 1TW5A 1WSZA 3OKRA 1K4VA 4J18A 2YQJA 2WEEA 4NAIA 3U0YA 4EE4A 2XWNA 4B42A 1HM8A 2FYBA 4YS8A 4DE7A 3SX5A 2WVKA 4AC3A 3USRA 1JV3A 1V83A 4Y62A 4EE3A 3CGXA 1GA8A 1QG8A 5FV9A 5C3AA 1H7EA 3TQDA 3U2XA 5CQOA 3I0IX 2I5EA 3OH4A 3CKVA 4DDZA 3O3PA 3K8DA 1NWGB 5C1GA 1H5SA 1HM9A 2VSHA 2XMHA 2ICYA 1ON6A 1EYRA 2YQSA 2YQHA 2VXMA 2QKXA 1VICA 2Z86A 1VGWA 4FRBA 1YP3A 1ZDGA 1NKHB 1ZJ3A 3U2UA 3I0HA 3OAMA 1G2VA 3I0JA 1I52A 3V0QA 2PGVA 4HOCA 2ICXA 4M2BA 1H3MA 5CQMX 1G23A 2RIXA 5C1HA 4FCUA 2Y4KA 3FWWA 4D0TA 5CQNX 4D11A 5CMFX 1XHBA 1WT1A 2OI7A 5C4CA 1MP3A 1GWVA 2VS3A 1LZJA 2D0JA 4AAWA 1JV1A 2FYDB 1LL0A 1LZ0A 1VZUA 1FR9A 3RSBA 2PGYA 1XZ6A 2WGZA 3ZLKA 4Y7FA 3KIAA 4BQHA 2VXLA 3I0GA 1VPAA 2AECA 1VM8A 3BRKX 2DPWA 2FYCB 4B2WA 3IOHA 2BO4A 4KNXA 1VH1A 5L6VA 2P6WA 5C3BA 1WVCA 4KPZA 3HL3A 4FRLA 2I7BA 3T7OA 2GGQA 2GGOA 1FZWA 1R7XA 2RJ7A 2W0VA 4XWIA 5FTSA 2O1GA 4EEAA 2OI5A 1JYKA 1GX4A 1R7VA 2NXVA 5HS2A 2YQCA 3PKQA 3T7MA 1VZTA 2ZU8A 4KXOA 3BCVA 2PA4A 4Y7TA 1NF5B 3POLA 3R2WA 1NHEB 3I0EA 5EJZA 1NQIB 1H5SB 3I0LA 4HG6A 4R7PA 4EEMA 2VS4A 3DJ4A 2V0IA 1FO8A 4NANA 1FRWA 5C1LA 4AYJA 1R81A 3SXDA 4B4MA 5CMGX 4ECMA 1GWWA 3OC9A 4GBPA 3ZGGA 4KT7A 3ZGFA 4EEGA 1OMXA 1FXOA 2RITA 3E25A 3V8YA 3V0LA 1PZTA 1ZCUA 3QVBA 1VGUA 2QGIA 1LL2A 4LW3A 5C4FA 1FO9A
chains in the Genus database with same CATH superfamily
1NMMB 2J0BA 3RMWA 2APCA 4G3SA 1O7OA 2RJ9A 2P73A 2XWLA 4MNDA 1ZJ1A 3F1CA 4ARWA 1O7QA 1QWJA 3DUVA 3SPTA 3D98A 3OH1A 2FY7A 1FR8A 2X5SA 2Y4MA 2BO7A 2D7RA 4G3QA 4B2XA 3USQA 1G8OA 5FUHA 4HO2A 4IRQA 4FQWA 4M28A 4EEOA 3D8VA 2YC3A 2OEGA 2AM5A 2O1FA 5C3DA 2RJ8A 3U2VA 3CU0A 2UX8A 4D48A 5C4BA 1G3LA 2Y4LA 4ASJA 1H4EA 1H7HA 3CKQA 4MYBA 3SXAA 5JQQA 4FRMA 3SXGA 5FU8A 4HO0A 4C2SA 4E1KA 3IOIA 4UEGA 5FU0A 1MC3A 4O6MA 2OI6A 3CKNA 2D7IA 3K8EA 1ZI1A 4M2AA 4Y64A 3T7NA 1INIA 3E26A 1ZJ0A 1H5RA 2RIYA 1IIMA 3OH2A 5AJOA 1MP5A 2RJ6A 5C49A 1FG5N 4FRPA 4M4KA 2Y6PA 2W0WA 4CJBA 3Q7UA 5D91A 1OQMB 1G1LA 2RJ0A 4HO8A 3V8ZA 2Q4JA 2XMEA 4FCEA 1QGQA 4ASYA 5DDVA 2WVLA 1FWYA 2YESA 3SXCA 2Z87A 4Y9XA 4NALA 1ON8A 1HV9A 1W55A 1IINA 1ZI3A 2I5KA 1GQ9A 4JISA 2Y7AA 1R7YA 3DK5A 4HO4A 3I0DA 3SX7A 1S4OA 1ZCVA 3CKOA 1SS9A 2FYAA 4CVHA 1V82A 1O0RA 1WT3A 4Y6NA 1WT2A 2JCJA 1WT0A 4G87A 4KQLA 4AYLA 2RJ5A 1FXJA 2WE9A 1W57A 1R7UA 3SXBA 1H5SC 1JYLA 1ZI5A 5C36A 1GQCA 3RMVA 4HO9A 4EVWA 3V90A 2A8UA 1ZIZA 2X5ZA 3IOJA 1OMZA 4K6RA 2V0JA 1TW1A 1H5TA 3V0PA 2ZU9A 3SXEA 1ZJ2A 4B3UA 2CU2A 4FIYA 5C47A 1PZYB 1VH3A 5C38A 2YCMA 4CJ8A 4P02A 4B4BA 4Y7UA 2VFZA 5J49A 2RIZA 4D11C 5C48A 1H5RB 5C8RA 3ZLLA 1R80A 2V0KA 5C4DA 3Q80A 1E5KA 1TZFA 1INJA 2YC5A 1ZHJA 3OH3A 2FFVA 4D0ZA 3SX8A 3SX3A 4L41C 4FROA 4KRVA 1H7GA 1ZCTA 2XWMA 4KC1A 3U2TA 5CQLX 1TVYA 4ZDQA 1O23B 2E3DA 1ZI4A 1Z90A 2VS5A 2WVMA 2JCLA 1G93A 2BO8A 2ZU7A 1VZXA 4B5BA 1R82A 5L6SA 3OH0A 4Y7VA 1GX0A 1LL3A 3GUEA 4HO5A 3JTJA 1JVGA 1G0RA 3V0MA 1H4DA 1H7LA 1H5SD 4FIXA 1VGTA 4HO3A 3N9WA 1LZIA 4BMAA 4MIXA 2X60A 2A8WA 3CKJA 1H7QA 4HO6A 5C4EA 3JUKA 5CMJA 3I0KA 1ZDFA 2JCKA 5IFYA 4G3PA 5FYEA 2AH9A 1H5TB 1S4PA 4CJCA 2WAWA 2OEFA 4Y6UA 2C0NA 1YP4A 4Q7CA 3EE5A 2VD4A 1G95A 1YP2A 5FTVA 4JD0A 1EZIA 4Y63A 4EE5A 2P72A 2VSIA 4FRDA 1S4NA 2AESA 3ST8A 3U0XA 4FREA 1H7TA 1HM0A 4KPXA 3R3IA 3OGZA 1HJLA 1ZCYA 2Y4JA 3D5NA 1ZJOA 2AM4A 1FOAA 2V0LA 3ZF8A 4Y7GA 1R7TA 4HCQA 2PX7A 2BO6A 3Q4SA 2VK9A 4O6NA 3I0CA 2RJ4A 4IRPA 2JCOA 3V91A 3V0NA 5CQPA 5DDTA 2X65A 3LW6A 2MZBA 2RJ1A 4B4GA 3V0OA 3F1YA 3NGWA 3JUJA 3U2WA 5AJPA 1YROB 1VGZA 5AJNA 3PKPA 1KWSA 1H7FA 1FGXA 3PNNA 1G97A 4KNRA 1FGGA 5CMIA 2AE7A 2FFUA 1ZJPA 1G9RA 1H4CA 4NAKA 2V0HA 4KC2A 5IDSA 5BXCA 3FOQA 1V84A 2O1HA 4P00A 2AGDA 1W77A 4FRQA 4KC4A 4LW6A 4FRAA 1LVWA 3TZTA 1JVDA 5EJ1A 1LZ7A 2QH5A 3I0FA 1QGSA 5EIYA 1HJJA 1MP4A 5I1FA 5IDTA 2AM3A 2E8BA 5CMHA 4DECA 4FRHA 1TW5A 1WSZA 3OKRA 1K4VA 4J18A 2YQJA 2WEEA 4NAIA 3U0YA 4EE4A 2XWNA 4B42A 1HM8A 2FYBA 4YS8A 4DE7A 3SX5A 2WVKA 4AC3A 3USRA 1JV3A 1V83A 4Y62A 4EE3A 3CGXA 1GA8A 1QG8A 5FV9A 5C3AA 1H7EA 3TQDA 3U2XA 5CQOA 3I0IX 2I5EA 3OH4A 3CKVA 4DDZA 3O3PA 3K8DA 1NWGB 5C1GA 1H5SA 1HM9A 2VSHA 2XMHA 2ICYA 1ON6A 1EYRA 2YQSA 2YQHA 2VXMA 2QKXA 1VICA 2Z86A 1VGWA 4FRBA 1YP3A 1ZDGA 1NKHB 1ZJ3A 3U2UA 3I0HA 3OAMA 1G2VA 3I0JA 1I52A 3V0QA 2PGVA 4HOCA 2ICXA 4M2BA 1H3MA 5CQMX 1G23A 2RIXA 5C1HA 4FCUA 2Y4KA 3FWWA 4D0TA 5CQNX 4D11A 5CMFX 1XHBA 1WT1A 2OI7A 5C4CA 1MP3A 1GWVA 2VS3A 1LZJA 2D0JA 4AAWA 1JV1A 2FYDB 1LL0A 1LZ0A 1VZUA 1FR9A 3RSBA 2PGYA 1XZ6A 2WGZA 3ZLKA 4Y7FA 3KIAA 4BQHA 5D92A 2VXLA 3I0GA 1VPAA 2AECA 1VM8A 3BRKX 2DPWA 2FYCB 4B2WA 3IOHA 2BO4A 4KNXA 1VH1A 5L6VA 2P6WA 5C3BA 1WVCA 4KPZA 3HL3A 4FRLA 2I7BA 2J0AA 3T7OA 2GGQA 2GGOA 1FZWA 1R7XA 2RJ7A 2W0VA 4XWIA 5FTSA 2O1GA 4EEAA 2OI5A 1JYKA 1GX4A 1R7VA 2NXVA 5HS2A 2YQCA 3PKQA 3T7MA 1VZTA 2ZU8A 4KXOA 3BCVA 2PA4A 4Y7TA 1NF5B 3POLA 3R2WA 1NHEB 3I0EA 5EJZA 1NQIB 1H5SB 3I0LA 4HG6A 4R7PA 4EEMA 2VS4A 3DJ4A 2V0IA 1FO8A 4NANA 1FRWA 5C1LA 4AYJA 1R81A 3SXDA 4B4MA 5CMGX 4ECMA 1GWWA 3OC9A 4GBPA 3ZGGA 4KT7A 3ZGFA 4EEGA 1OMXA 1FXOA 2RITA 3E25A 3V8YA 3V0LA 1PZTA 1ZCUA 3QVBA 1VGUA 2QGIA 1LL2A 4LW3A 5C4FA 1FO9A
chains in the Genus database with same CATH topology
1NMMB 2J0BA 3RMWA 2APCA 4G3SA 1O7OA 2RJ9A 2P73A 2XWLA 4MNDA 1ZJ1A 3F1CA 4ARWA 1O7QA 1QWJA 3DUVA 3SPTA 3D98A 3OH1A 2FY7A 1FR8A 2X5SA 2Y4MA 2BO7A 2D7RA 4G3QA 4B2XA 3USQA 1G8OA 5FUHA 4HO2A 4IRQA 4FQWA 4M28A 4EEOA 3D8VA 2YC3A 2OEGA 2AM5A 2O1FA 5C3DA 2RJ8A 3U2VA 3CU0A 2UX8A 4D48A 5C4BA 1G3LA 2Y4LA 4ASJA 1H4EA 1H7HA 3CKQA 4MYBA 3SXAA 5JQQA 4FRMA 3SXGA 5FU8A 4HO0A 4C2SA 4E1KA 3IOIA 4UEGA 5FU0A 1MC3A 4O6MA 2OI6A 3CKNA 2D7IA 3K8EA 1ZI1A 4M2AA 4Y64A 3T7NA 1INIA 3E26A 1ZJ0A 1H5RA 2RIYA 1IIMA 3OH2A 5AJOA 1MP5A 2RJ6A 5C49A 1FG5N 4FRPA 4M4KA 2Y6PA 2W0WA 4CJBA 3Q7UA 5D91A 1OQMB 1G1LA 2RJ0A 4HO8A 3V8ZA 2Q4JA 2XMEA 4FCEA 1QGQA 4ASYA 5DDVA 2WVLA 1FWYA 2YESA 3SXCA 2Z87A 4Y9XA 4NALA 1ON8A 1HV9A 1W55A 1IINA 1ZI3A 2I5KA 1GQ9A 4JISA 2Y7AA 1R7YA 3DK5A 4HO4A 3I0DA 3SX7A 1S4OA 1ZCVA 3CKOA 1SS9A 2FYAA 4CVHA 1V82A 1O0RA 1WT3A 4Y6NA 1WT2A 2JCJA 1WT0A 4G87A 4KQLA 4AYLA 2RJ5A 1FXJA 2WE9A 1W57A 1R7UA 3SXBA 1H5SC 1JYLA 1ZI5A 5C36A 1GQCA 3RMVA 4HO9A 4EVWA 3V90A 2A8UA 1ZIZA 2X5ZA 3IOJA 1OMZA 4K6RA 2V0JA 1TW1A 1H5TA 3V0PA 2ZU9A 3SXEA 1ZJ2A 4B3UA 2CU2A 4FIYA 5C47A 1PZYB 1VH3A 5C38A 2YCMA 4CJ8A 4P02A 4B4BA 4Y7UA 2VFZA 5J49A 2RIZA 4D11C 5C48A 1H5RB 5C8RA 3ZLLA 1R80A 2V0KA 5C4DA 3Q80A 1E5KA 1TZFA 1INJA 2YC5A 1ZHJA 3OH3A 2FFVA 4D0ZA 3SX8A 3SX3A 4L41C 4FROA 4KRVA 1H7GA 1ZCTA 2XWMA 4KC1A 3U2TA 5CQLX 1TVYA 4ZDQA 1O23B 2E3DA 1ZI4A 1Z90A 2VS5A 2WVMA 2JCLA 1G93A 2BO8A 2ZU7A 1VZXA 4B5BA 1R82A 5L6SA 3OH0A 4Y7VA 1GX0A 1LL3A 3GUEA 4HO5A 3JTJA 1JVGA 1G0RA 3V0MA 1H4DA 1H7LA 1H5SD 4FIXA 1VGTA 4HO3A 3N9WA 1LZIA 4BMAA 4MIXA 2X60A 2A8WA 3CKJA 1H7QA 4HO6A 5C4EA 3JUKA 5CMJA 3I0KA 1ZDFA 2JCKA 5IFYA 4G3PA 5FYEA 2AH9A 1H5TB 1S4PA 4CJCA 2WAWA 2OEFA 4Y6UA 2C0NA 1YP4A 4Q7CA 3EE5A 2VD4A 1G95A 1YP2A 5FTVA 4JD0A 1EZIA 4Y63A 4EE5A 2P72A 2VSIA 4FRDA 1S4NA 2AESA 3ST8A 3U0XA 4FREA 1H7TA 1HM0A 4KPXA 3R3IA 3OGZA 1HJLA 1ZCYA 2Y4JA 3D5NA 1ZJOA 2AM4A 1FOAA 2V0LA 3ZF8A 4Y7GA 1R7TA 4HCQA 2PX7A 2BO6A 3Q4SA 2VK9A 4O6NA 3I0CA 2RJ4A 4IRPA 2JCOA 3V91A 3V0NA 5CQPA 5DDTA 2X65A 3LW6A 2MZBA 2RJ1A 4B4GA 3V0OA 3F1YA 3NGWA 3JUJA 3U2WA 5AJPA 1YROB 1VGZA 5AJNA 3PKPA 1KWSA 1H7FA 1FGXA 3PNNA 1G97A 4KNRA 1FGGA 5CMIA 2AE7A 2FFUA 1ZJPA 1G9RA 1H4CA 4NAKA 2V0HA 4KC2A 5IDSA 5BXCA 3FOQA 1V84A 2O1HA 4P00A 2AGDA 1W77A 4FRQA 4KC4A 4LW6A 4FRAA 1LVWA 3TZTA 1JVDA 5EJ1A 1LZ7A 2QH5A 3I0FA 1QGSA 5EIYA 1HJJA 1MP4A 5I1FA 5IDTA 2AM3A 2E8BA 5CMHA 4DECA 4FRHA 1TW5A 1WSZA 3OKRA 1K4VA 4J18A 2YQJA 2WEEA 4NAIA 3U0YA 4EE4A 2XWNA 4B42A 1HM8A 2FYBA 4YS8A 4DE7A 3SX5A 2WVKA 4AC3A 3USRA 1JV3A 1V83A 4Y62A 4EE3A 3CGXA 1GA8A 1QG8A 5FV9A 5C3AA 1H7EA 3TQDA 3U2XA 5CQOA 3I0IX 2I5EA 3OH4A 3CKVA 4DDZA 3O3PA 3K8DA 1NWGB 5C1GA 1H5SA 1HM9A 2VSHA 2XMHA 2ICYA 1ON6A 1EYRA 2YQSA 2YQHA 2VXMA 2QKXA 1VICA 2Z86A 1VGWA 4FRBA 1YP3A 1ZDGA 1NKHB 1ZJ3A 3U2UA 3I0HA 3OAMA 1G2VA 3I0JA 1I52A 3V0QA 2PGVA 4HOCA 2ICXA 4M2BA 1H3MA 5CQMX 1G23A 2RIXA 5C1HA 4FCUA 2Y4KA 3FWWA 4D0TA 5CQNX 4D11A 5CMFX 1XHBA 1WT1A 2OI7A 5C4CA 1MP3A 1GWVA 2VS3A 1LZJA 2D0JA 4AAWA 1JV1A 2FYDB 1LL0A 1LZ0A 1VZUA 1FR9A 3RSBA 2PGYA 1XZ6A 2WGZA 3ZLKA 4Y7FA 3KIAA 4BQHA 5D92A 2VXLA 3I0GA 1VPAA 2AECA 1VM8A 3BRKX 2DPWA 2FYCB 4B2WA 3IOHA 2BO4A 4KNXA 1VH1A 5L6VA 2P6WA 5C3BA 1WVCA 4KPZA 3HL3A 4FRLA 2I7BA 2J0AA 3T7OA 2GGQA 2GGOA 1FZWA 1R7XA 2RJ7A 2W0VA 4XWIA 5FTSA 2O1GA 4EEAA 2OI5A 1JYKA 1GX4A 1R7VA 2NXVA 5HS2A 2YQCA 3PKQA 3T7MA 1VZTA 2ZU8A 4KXOA 3BCVA 2PA4A 4Y7TA 1NF5B 3POLA 3R2WA 1NHEB 3I0EA 5EJZA 1NQIB 1H5SB 3I0LA 4HG6A 4R7PA 4EEMA 2VS4A 3DJ4A 2V0IA 1FO8A 4NANA 1FRWA 5C1LA 4AYJA 1R81A 3SXDA 4B4MA 5CMGX 4ECMA 1GWWA 3OC9A 4GBPA 3ZGGA 4KT7A 3ZGFA 4EEGA 1OMXA 1FXOA 2RITA 3E25A 3V8YA 3V0LA 1PZTA 1ZCUA 3QVBA 1VGUA 2QGIA 1LL2A 4LW3A 5C4FA 1FO9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NMM B;  3RMW A;  2APC A;  4G3S A;  1O7O A;  2RJ9 A;  2P73 A;  2XWL A;  4MND A;  1ZJ1 A;  3F1C A;  4ARW A;  1O7Q A;  1QWJ A;  3DUV A;  3SPT A;  3D98 A;  3OH1 A;  2FY7 A;  1FR8 A;  2X5S A;  2Y4M A;  2BO7 A;  2D7R A;  4G3Q A;  4B2X A;  3USQ A;  1G8O A;  5FUH A;  4HO2 A;  4IRQ A;  4FQW A;  4M28 A;  4EEO A;  3D8V A;  2YC3 A;  2OEG A;  2AM5 A;  2O1F A;  5C3D A;  2RJ8 A;  3U2V A;  3CU0 A;  2UX8 A;  4D48 A;  5C4B A;  1G3L A;  2Y4L A;  4ASJ A;  1H4E A;  1H7H A;  3CKQ A;  4MYB A;  3SXA A;  5JQQ A;  4FRM A;  3SXG A;  5FU8 A;  4HO0 A;  4C2S A;  4E1K A;  3IOI A;  4UEG A;  5FU0 A;  1MC3 A;  2OI6 A;  3CKN A;  2D7I A;  3K8E A;  1ZI1 A;  4M2A A;  4Y64 A;  3T7N A;  1INI A;  3E26 A;  1ZJ0 A;  1H5R A;  2RIY A;  1IIM A;  3OH2 A;  5AJO A;  1MP5 A;  2RJ6 A;  5C49 A;  1FG5 N;  4FRP A;  4M4K A;  2Y6P A;  2W0W A;  4CJB A;  3Q7U A;  1OQM B;  1G1L A;  2RJ0 A;  4HO8 A;  3V8Z A;  2Q4J A;  2XME A;  4FCE A;  1QGQ A;  4ASY A;  5DDV A;  2WVL A;  1FWY A;  2YES A;  3SXC A;  2Z87 A;  4Y9X A;  4NAL A;  1ON8 A;  1HV9 A;  1W55 A;  1IIN A;  1ZI3 A;  2I5K A;  1GQ9 A;  4JIS A;  2Y7A A;  1R7Y A;  3DK5 A;  4HO4 A;  3I0D A;  3SX7 A;  1S4O A;  1ZCV A;  3CKO A;  1SS9 A;  2FYA A;  4CVH A;  1V82 A;  1O0R A;  1WT3 A;  4Y6N A;  1WT2 A;  2JCJ A;  1WT0 A;  4G87 A;  4KQL A;  4AYL A;  2RJ5 A;  1FXJ A;  2WE9 A;  1W57 A;  1R7U A;  3SXB A;  1H5S C;  1JYL A;  1ZI5 A;  5C36 A;  1GQC A;  3RMV A;  4HO9 A;  4EVW A;  3V90 A;  2A8U A;  1ZIZ A;  2X5Z A;  3IOJ A;  1OMZ A;  4K6R A;  2V0J A;  1TW1 A;  1H5T A;  3V0P A;  2ZU9 A;  3SXE A;  1ZJ2 A;  4B3U A;  2CU2 A;  5C47 A;  1PZY B;  1VH3 A;  5C38 A;  2YCM A;  4CJ8 A;  4P02 A;  4B4B A;  4Y7U A;  2VFZ A;  5J49 A;  2RIZ A;  4D11 C;  5C48 A;  1H5R B;  5C8R A;  3ZLL A;  1R80 A;  2V0K A;  5C4D A;  3Q80 A;  1E5K A;  1TZF A;  1INJ A;  2YC5 A;  1ZHJ A;  3OH3 A;  2FFV A;  4D0Z A;  3SX8 A;  3SX3 A;  4L41 C;  4FRO A;  4KRV A;  1H7G A;  1ZCT A;  2XWM A;  4KC1 A;  3U2T A;  5CQL X;  1TVY A;  4ZDQ A;  1O23 B;  2E3D A;  1ZI4 A;  1Z90 A;  2VS5 A;  2WVM A;  2JCL A;  1G93 A;  2BO8 A;  2ZU7 A;  1VZX A;  4B5B A;  1R82 A;  5L6S A;  3OH0 A;  4Y7V A;  1GX0 A;  1LL3 A;  3GUE A;  4HO5 A;  3JTJ A;  1JVG A;  1G0R A;  3V0M A;  1H4D A;  1H7L A;  1H5S D;  1VGT A;  4HO3 A;  3N9W A;  1LZI A;  4BMA A;  2X60 A;  2A8W A;  3CKJ A;  1H7Q A;  4HO6 A;  5C4E A;  3JUK A;  5CMJ A;  3I0K A;  1ZDF A;  2JCK A;  5IFY A;  4G3P A;  5FYE A;  2AH9 A;  1H5T B;  1S4P A;  4CJC A;  2WAW A;  2OEF A;  4Y6U A;  1YP4 A;  3EE5 A;  2VD4 A;  1G95 A;  1YP2 A;  5FTV A;  4JD0 A;  1EZI A;  4Y63 A;  4EE5 A;  2P72 A;  2VSI A;  4FRD A;  1S4N A;  2AES A;  3ST8 A;  3U0X A;  4FRE A;  1H7T A;  1HM0 A;  4KPX A;  3R3I A;  3OGZ A;  1HJL A;  1ZCY A;  2Y4J A;  3D5N A;  1ZJO A;  2AM4 A;  1FOA A;  2V0L A;  3ZF8 A;  4Y7G A;  1R7T A;  4HCQ A;  2PX7 A;  2BO6 A;  3Q4S A;  3I0C A;  2RJ4 A;  4IRP A;  2JCO A;  3V91 A;  3V0N A;  5CQP A;  5DDT A;  2X65 A;  3LW6 A;  2MZB A;  2RJ1 A;  4B4G A;  3V0O A;  3F1Y A;  3NGW A;  3JUJ A;  3U2W A;  5AJP A;  1YRO B;  1VGZ A;  5AJN A;  3PKP A;  1KWS A;  1H7F A;  1FGX A;  3PNN A;  1G97 A;  4KNR A;  1FGG A;  5CMI A;  2AE7 A;  2FFU A;  1ZJP A;  1G9R A;  1H4C A;  4NAK A;  2V0H A;  4KC2 A;  5IDS A;  5BXC A;  3FOQ A;  1V84 A;  2O1H A;  4P00 A;  2AGD A;  1W77 A;  4FRQ A;  4KC4 A;  4LW6 A;  4FRA A;  1LVW A;  3TZT A;  1JVD A;  5EJ1 A;  1LZ7 A;  2QH5 A;  3I0F A;  1QGS A;  5EIY A;  1HJJ A;  1MP4 A;  5I1F A;  5IDT A;  2AM3 A;  2E8B A;  5CMH A;  4DEC A;  4FRH A;  1TW5 A;  1WSZ A;  3OKR A;  1K4V A;  4J18 A;  2YQJ A;  2WEE A;  4NAI A;  3U0Y A;  4EE4 A;  2XWN A;  4B42 A;  1HM8 A;  2FYB A;  4YS8 A;  4DE7 A;  3SX5 A;  2WVK A;  4AC3 A;  3USR A;  1JV3 A;  1V83 A;  4Y62 A;  4EE3 A;  3CGX A;  1GA8 A;  1QG8 A;  5FV9 A;  5C3A A;  1H7E A;  3TQD A;  3U2X A;  5CQO A;  3I0I X;  2I5E A;  3OH4 A;  3CKV A;  4DDZ A;  3O3P A;  3K8D A;  1NWG B;  5C1G A;  1H5S A;  1HM9 A;  2VSH A;  2XMH A;  2ICY A;  1ON6 A;  1EYR A;  2YQS A;  2YQH A;  2VXM A;  2QKX A;  1VIC A;  2Z86 A;  1VGW A;  4FRB A;  1YP3 A;  1ZDG A;  1NKH B;  1ZJ3 A;  3U2U A;  3I0H A;  3OAM A;  1G2V A;  3I0J A;  1I52 A;  3V0Q A;  2PGV A;  4HOC A;  2ICX A;  4M2B A;  1H3M A;  5CQM X;  1G23 A;  2RIX A;  5C1H A;  4FCU A;  2Y4K A;  3FWW A;  4D0T A;  5CQN X;  4D11 A;  5CMF X;  1XHB A;  1WT1 A;  2OI7 A;  5C4C A;  1MP3 A;  1GWV A;  2VS3 A;  1LZJ A;  2D0J A;  4AAW A;  1JV1 A;  2FYD B;  1LL0 A;  1LZ0 A;  1VZU A;  1FR9 A;  3RSB A;  2PGY A;  1XZ6 A;  2WGZ A;  3ZLK A;  4Y7F A;  3KIA A;  4BQH A;  2VXL A;  3I0G A;  1VPA A;  2AEC A;  1VM8 A;  3BRK X;  2DPW A;  2FYC B;  4B2W A;  3IOH A;  2BO4 A;  4KNX A;  1VH1 A;  5L6V A;  2P6W A;  5C3B A;  1WVC A;  4KPZ A;  3HL3 A;  4FRL A;  2I7B A;  3T7O A;  2GGQ A;  2GGO A;  1FZW A;  1R7X A;  2RJ7 A;  2W0V A;  4XWI A;  5FTS A;  2O1G A;  4EEA A;  2OI5 A;  1JYK A;  1GX4 A;  1R7V A;  2NXV A;  5HS2 A;  2YQC A;  3PKQ A;  3T7M A;  1VZT A;  2ZU8 A;  4KXO A;  3BCV A;  2PA4 A;  4Y7T A;  1NF5 B;  3POL A;  3R2W A;  1NHE B;  3I0E A;  5EJZ A;  1NQI B;  1H5S B;  3I0L A;  4HG6 A;  4R7P A;  4EEM A;  2VS4 A;  3DJ4 A;  2V0I A;  1FO8 A;  4NAN A;  1FRW A;  5C1L A;  4AYJ A;  1R81 A;  3SXD A;  4B4M A;  5CMG X;  4ECM A;  1GWW A;  3OC9 A;  4GBP A;  3ZGG A;  4KT7 A;  3ZGF A;  4EEG A;  1OMX A;  1FXO A;  2RIT A;  3E25 A;  3V8Y A;  3V0L A;  1PZT A;  1ZCU A;  3QVB A;  1VGU A;  2QGI A;  1LL2 A;  4LW3 A;  5C4F A;  1FO9 A; 
#chains in the Genus database with same CATH topology
 1NMM B;  2J0B A;  3RMW A;  2APC A;  4G3S A;  1O7O A;  2RJ9 A;  2P73 A;  2XWL A;  4MND A;  1ZJ1 A;  3F1C A;  4ARW A;  1O7Q A;  1QWJ A;  3DUV A;  3SPT A;  3D98 A;  3OH1 A;  2FY7 A;  1FR8 A;  2X5S A;  2Y4M A;  2BO7 A;  2D7R A;  4G3Q A;  4B2X A;  3USQ A;  1G8O A;  5FUH A;  4HO2 A;  4IRQ A;  4FQW A;  4M28 A;  4EEO A;  3D8V A;  2YC3 A;  2OEG A;  2AM5 A;  2O1F A;  5C3D A;  2RJ8 A;  3U2V A;  3CU0 A;  2UX8 A;  4D48 A;  5C4B A;  1G3L A;  2Y4L A;  4ASJ A;  1H4E A;  1H7H A;  3CKQ A;  4MYB A;  3SXA A;  5JQQ A;  4FRM A;  3SXG A;  5FU8 A;  4HO0 A;  4C2S A;  4E1K A;  3IOI A;  4UEG A;  5FU0 A;  1MC3 A;  4O6M A;  2OI6 A;  3CKN A;  2D7I A;  3K8E A;  1ZI1 A;  4M2A A;  4Y64 A;  3T7N A;  1INI A;  3E26 A;  1ZJ0 A;  1H5R A;  2RIY A;  1IIM A;  3OH2 A;  5AJO A;  1MP5 A;  2RJ6 A;  5C49 A;  1FG5 N;  4FRP A;  4M4K A;  2Y6P A;  2W0W A;  4CJB A;  3Q7U A;  5D91 A;  1OQM B;  1G1L A;  2RJ0 A;  4HO8 A;  3V8Z A;  2Q4J A;  2XME A;  4FCE A;  1QGQ A;  4ASY A;  5DDV A;  2WVL A;  1FWY A;  2YES A;  3SXC A;  2Z87 A;  4Y9X A;  4NAL A;  1ON8 A;  1HV9 A;  1W55 A;  1IIN A;  1ZI3 A;  2I5K A;  1GQ9 A;  4JIS A;  2Y7A A;  1R7Y A;  3DK5 A;  4HO4 A;  3I0D A;  3SX7 A;  1S4O A;  1ZCV A;  3CKO A;  1SS9 A;  2FYA A;  4CVH A;  1V82 A;  1O0R A;  1WT3 A;  4Y6N A;  1WT2 A;  2JCJ A;  1WT0 A;  4G87 A;  4KQL A;  4AYL A;  2RJ5 A;  1FXJ A;  2WE9 A;  1W57 A;  1R7U A;  3SXB A;  1H5S C;  1JYL A;  1ZI5 A;  5C36 A;  1GQC A;  3RMV A;  4HO9 A;  4EVW A;  3V90 A;  2A8U A;  1ZIZ A;  2X5Z A;  3IOJ A;  1OMZ A;  4K6R A;  2V0J A;  1TW1 A;  1H5T A;  3V0P A;  2ZU9 A;  3SXE A;  1ZJ2 A;  4B3U A;  2CU2 A;  4FIY A;  5C47 A;  1PZY B;  1VH3 A;  5C38 A;  2YCM A;  4CJ8 A;  4P02 A;  4B4B A;  4Y7U A;  2VFZ A;  5J49 A;  2RIZ A;  4D11 C;  5C48 A;  1H5R B;  5C8R A;  3ZLL A;  1R80 A;  2V0K A;  5C4D A;  3Q80 A;  1E5K A;  1TZF A;  1INJ A;  2YC5 A;  1ZHJ A;  3OH3 A;  2FFV A;  4D0Z A;  3SX8 A;  3SX3 A;  4L41 C;  4FRO A;  4KRV A;  1H7G A;  1ZCT A;  2XWM A;  4KC1 A;  3U2T A;  5CQL X;  1TVY A;  4ZDQ A;  1O23 B;  2E3D A;  1ZI4 A;  1Z90 A;  2VS5 A;  2WVM A;  2JCL A;  1G93 A;  2BO8 A;  2ZU7 A;  1VZX A;  4B5B A;  1R82 A;  5L6S A;  3OH0 A;  4Y7V A;  1GX0 A;  1LL3 A;  3GUE A;  4HO5 A;  3JTJ A;  1JVG A;  1G0R A;  3V0M A;  1H4D A;  1H7L A;  1H5S D;  4FIX A;  1VGT A;  4HO3 A;  3N9W A;  1LZI A;  4BMA A;  4MIX A;  2X60 A;  2A8W A;  3CKJ A;  1H7Q A;  4HO6 A;  5C4E A;  3JUK A;  5CMJ A;  3I0K A;  1ZDF A;  2JCK A;  5IFY A;  4G3P A;  5FYE A;  2AH9 A;  1H5T B;  1S4P A;  4CJC A;  2WAW A;  2OEF A;  4Y6U A;  2C0N A;  1YP4 A;  4Q7C A;  3EE5 A;  2VD4 A;  1G95 A;  1YP2 A;  5FTV A;  4JD0 A;  1EZI A;  4Y63 A;  4EE5 A;  2P72 A;  2VSI A;  4FRD A;  1S4N A;  2AES A;  3ST8 A;  3U0X A;  4FRE A;  1H7T A;  1HM0 A;  4KPX A;  3R3I A;  3OGZ A;  1HJL A;  1ZCY A;  2Y4J A;  3D5N A;  1ZJO A;  2AM4 A;  1FOA A;  2V0L A;  3ZF8 A;  4Y7G A;  1R7T A;  4HCQ A;  2PX7 A;  2BO6 A;  3Q4S A;  2VK9 A;  4O6N A;  3I0C A;  2RJ4 A;  4IRP A;  2JCO A;  3V91 A;  3V0N A;  5CQP A;  5DDT A;  2X65 A;  3LW6 A;  2MZB A;  2RJ1 A;  4B4G A;  3V0O A;  3F1Y A;  3NGW A;  3JUJ A;  3U2W A;  5AJP A;  1YRO B;  1VGZ A;  5AJN A;  3PKP A;  1KWS A;  1H7F A;  1FGX A;  3PNN A;  1G97 A;  4KNR A;  1FGG A;  5CMI A;  2AE7 A;  2FFU A;  1ZJP A;  1G9R A;  1H4C A;  4NAK A;  2V0H A;  4KC2 A;  5IDS A;  5BXC A;  3FOQ A;  1V84 A;  2O1H A;  4P00 A;  2AGD A;  1W77 A;  4FRQ A;  4KC4 A;  4LW6 A;  4FRA A;  1LVW A;  3TZT A;  1JVD A;  5EJ1 A;  1LZ7 A;  2QH5 A;  3I0F A;  1QGS A;  5EIY A;  1HJJ A;  1MP4 A;  5I1F A;  5IDT A;  2AM3 A;  2E8B A;  5CMH A;  4DEC A;  4FRH A;  1TW5 A;  1WSZ A;  3OKR A;  1K4V A;  4J18 A;  2YQJ A;  2WEE A;  4NAI A;  3U0Y A;  4EE4 A;  2XWN A;  4B42 A;  1HM8 A;  2FYB A;  4YS8 A;  4DE7 A;  3SX5 A;  2WVK A;  4AC3 A;  3USR A;  1JV3 A;  1V83 A;  4Y62 A;  4EE3 A;  3CGX A;  1GA8 A;  1QG8 A;  5FV9 A;  5C3A A;  1H7E A;  3TQD A;  3U2X A;  5CQO A;  3I0I X;  2I5E A;  3OH4 A;  3CKV A;  4DDZ A;  3O3P A;  3K8D A;  1NWG B;  5C1G A;  1H5S A;  1HM9 A;  2VSH A;  2XMH A;  2ICY A;  1ON6 A;  1EYR A;  2YQS A;  2YQH A;  2VXM A;  2QKX A;  1VIC A;  2Z86 A;  1VGW A;  4FRB A;  1YP3 A;  1ZDG A;  1NKH B;  1ZJ3 A;  3U2U A;  3I0H A;  3OAM A;  1G2V A;  3I0J A;  1I52 A;  3V0Q A;  2PGV A;  4HOC A;  2ICX A;  4M2B A;  1H3M A;  5CQM X;  1G23 A;  2RIX A;  5C1H A;  4FCU A;  2Y4K A;  3FWW A;  4D0T A;  5CQN X;  4D11 A;  5CMF X;  1XHB A;  1WT1 A;  2OI7 A;  5C4C A;  1MP3 A;  1GWV A;  2VS3 A;  1LZJ A;  2D0J A;  4AAW A;  1JV1 A;  2FYD B;  1LL0 A;  1LZ0 A;  1VZU A;  1FR9 A;  3RSB A;  2PGY A;  1XZ6 A;  2WGZ A;  3ZLK A;  4Y7F A;  3KIA A;  4BQH A;  5D92 A;  2VXL A;  3I0G A;  1VPA A;  2AEC A;  1VM8 A;  3BRK X;  2DPW A;  2FYC B;  4B2W A;  3IOH A;  2BO4 A;  4KNX A;  1VH1 A;  5L6V A;  2P6W A;  5C3B A;  1WVC A;  4KPZ A;  3HL3 A;  4FRL A;  2I7B A;  2J0A A;  3T7O A;  2GGQ A;  2GGO A;  1FZW A;  1R7X A;  2RJ7 A;  2W0V A;  4XWI A;  5FTS A;  2O1G A;  4EEA A;  2OI5 A;  1JYK A;  1GX4 A;  1R7V A;  2NXV A;  5HS2 A;  2YQC A;  3PKQ A;  3T7M A;  1VZT A;  2ZU8 A;  4KXO A;  3BCV A;  2PA4 A;  4Y7T A;  1NF5 B;  3POL A;  3R2W A;  1NHE B;  3I0E A;  5EJZ A;  1NQI B;  1H5S B;  3I0L A;  4HG6 A;  4R7P A;  4EEM A;  2VS4 A;  3DJ4 A;  2V0I A;  1FO8 A;  4NAN A;  1FRW A;  5C1L A;  4AYJ A;  1R81 A;  3SXD A;  4B4M A;  5CMG X;  4ECM A;  1GWW A;  3OC9 A;  4GBP A;  3ZGG A;  4KT7 A;  3ZGF A;  4EEG A;  1OMX A;  1FXO A;  2RIT A;  3E25 A;  3V8Y A;  3V0L A;  1PZT A;  1ZCU A;  3QVB A;  1VGU A;  2QGI A;  1LL2 A;  4LW3 A;  5C4F A;  1FO9 A; 
#chains in the Genus database with same CATH homology
 1NMM B;  2J0B A;  3RMW A;  2APC A;  4G3S A;  1O7O A;  2RJ9 A;  2P73 A;  2XWL A;  4MND A;  1ZJ1 A;  3F1C A;  4ARW A;  1O7Q A;  1QWJ A;  3DUV A;  3SPT A;  3D98 A;  3OH1 A;  2FY7 A;  1FR8 A;  2X5S A;  2Y4M A;  2BO7 A;  2D7R A;  4G3Q A;  4B2X A;  3USQ A;  1G8O A;  5FUH A;  4HO2 A;  4IRQ A;  4FQW A;  4M28 A;  4EEO A;  3D8V A;  2YC3 A;  2OEG A;  2AM5 A;  2O1F A;  5C3D A;  2RJ8 A;  3U2V A;  3CU0 A;  2UX8 A;  4D48 A;  5C4B A;  1G3L A;  2Y4L A;  4ASJ A;  1H4E A;  1H7H A;  3CKQ A;  4MYB A;  3SXA A;  5JQQ A;  4FRM A;  3SXG A;  5FU8 A;  4HO0 A;  4C2S A;  4E1K A;  3IOI A;  4UEG A;  5FU0 A;  1MC3 A;  4O6M A;  2OI6 A;  3CKN A;  2D7I A;  3K8E A;  1ZI1 A;  4M2A A;  4Y64 A;  3T7N A;  1INI A;  3E26 A;  1ZJ0 A;  1H5R A;  2RIY A;  1IIM A;  3OH2 A;  5AJO A;  1MP5 A;  2RJ6 A;  5C49 A;  1FG5 N;  4FRP A;  4M4K A;  2Y6P A;  2W0W A;  4CJB A;  3Q7U A;  5D91 A;  1OQM B;  1G1L A;  2RJ0 A;  4HO8 A;  3V8Z A;  2Q4J A;  2XME A;  4FCE A;  1QGQ A;  4ASY A;  5DDV A;  2WVL A;  1FWY A;  2YES A;  3SXC A;  2Z87 A;  4Y9X A;  4NAL A;  1ON8 A;  1HV9 A;  1W55 A;  1IIN A;  1ZI3 A;  2I5K A;  1GQ9 A;  4JIS A;  2Y7A A;  1R7Y A;  3DK5 A;  4HO4 A;  3I0D A;  3SX7 A;  1S4O A;  1ZCV A;  3CKO A;  1SS9 A;  2FYA A;  4CVH A;  1V82 A;  1O0R A;  1WT3 A;  4Y6N A;  1WT2 A;  2JCJ A;  1WT0 A;  4G87 A;  4KQL A;  4AYL A;  2RJ5 A;  1FXJ A;  2WE9 A;  1W57 A;  1R7U A;  3SXB A;  1H5S C;  1JYL A;  1ZI5 A;  5C36 A;  1GQC A;  3RMV A;  4HO9 A;  4EVW A;  3V90 A;  2A8U A;  1ZIZ A;  2X5Z A;  3IOJ A;  1OMZ A;  4K6R A;  2V0J A;  1TW1 A;  1H5T A;  3V0P A;  2ZU9 A;  3SXE A;  1ZJ2 A;  4B3U A;  2CU2 A;  4FIY A;  5C47 A;  1PZY B;  1VH3 A;  5C38 A;  2YCM A;  4CJ8 A;  4P02 A;  4B4B A;  4Y7U A;  2VFZ A;  5J49 A;  2RIZ A;  4D11 C;  5C48 A;  1H5R B;  5C8R A;  3ZLL A;  1R80 A;  2V0K A;  5C4D A;  3Q80 A;  1E5K A;  1TZF A;  1INJ A;  2YC5 A;  1ZHJ A;  3OH3 A;  2FFV A;  4D0Z A;  3SX8 A;  3SX3 A;  4L41 C;  4FRO A;  4KRV A;  1H7G A;  1ZCT A;  2XWM A;  4KC1 A;  3U2T A;  5CQL X;  1TVY A;  4ZDQ A;  1O23 B;  2E3D A;  1ZI4 A;  1Z90 A;  2VS5 A;  2WVM A;  2JCL A;  1G93 A;  2BO8 A;  2ZU7 A;  1VZX A;  4B5B A;  1R82 A;  5L6S A;  3OH0 A;  4Y7V A;  1GX0 A;  1LL3 A;  3GUE A;  4HO5 A;  3JTJ A;  1JVG A;  1G0R A;  3V0M A;  1H4D A;  1H7L A;  1H5S D;  4FIX A;  1VGT A;  4HO3 A;  3N9W A;  1LZI A;  4BMA A;  4MIX A;  2X60 A;  2A8W A;  3CKJ A;  1H7Q A;  4HO6 A;  5C4E A;  3JUK A;  5CMJ A;  3I0K A;  1ZDF A;  2JCK A;  5IFY A;  4G3P A;  5FYE A;  2AH9 A;  1H5T B;  1S4P A;  4CJC A;  2WAW A;  2OEF A;  4Y6U A;  2C0N A;  1YP4 A;  4Q7C A;  3EE5 A;  2VD4 A;  1G95 A;  1YP2 A;  5FTV A;  4JD0 A;  1EZI A;  4Y63 A;  4EE5 A;  2P72 A;  2VSI A;  4FRD A;  1S4N A;  2AES A;  3ST8 A;  3U0X A;  4FRE A;  1H7T A;  1HM0 A;  4KPX A;  3R3I A;  3OGZ A;  1HJL A;  1ZCY A;  2Y4J A;  3D5N A;  1ZJO A;  2AM4 A;  1FOA A;  2V0L A;  3ZF8 A;  4Y7G A;  1R7T A;  4HCQ A;  2PX7 A;  2BO6 A;  3Q4S A;  2VK9 A;  4O6N A;  3I0C A;  2RJ4 A;  4IRP A;  2JCO A;  3V91 A;  3V0N A;  5CQP A;  5DDT A;  2X65 A;  3LW6 A;  2MZB A;  2RJ1 A;  4B4G A;  3V0O A;  3F1Y A;  3NGW A;  3JUJ A;  3U2W A;  5AJP A;  1YRO B;  1VGZ A;  5AJN A;  3PKP A;  1KWS A;  1H7F A;  1FGX A;  3PNN A;  1G97 A;  4KNR A;  1FGG A;  5CMI A;  2AE7 A;  2FFU A;  1ZJP A;  1G9R A;  1H4C A;  4NAK A;  2V0H A;  4KC2 A;  5IDS A;  5BXC A;  3FOQ A;  1V84 A;  2O1H A;  4P00 A;  2AGD A;  1W77 A;  4FRQ A;  4KC4 A;  4LW6 A;  4FRA A;  1LVW A;  3TZT A;  1JVD A;  5EJ1 A;  1LZ7 A;  2QH5 A;  3I0F A;  1QGS A;  5EIY A;  1HJJ A;  1MP4 A;  5I1F A;  5IDT A;  2AM3 A;  2E8B A;  5CMH A;  4DEC A;  4FRH A;  1TW5 A;  1WSZ A;  3OKR A;  1K4V A;  4J18 A;  2YQJ A;  2WEE A;  4NAI A;  3U0Y A;  4EE4 A;  2XWN A;  4B42 A;  1HM8 A;  2FYB A;  4YS8 A;  4DE7 A;  3SX5 A;  2WVK A;  4AC3 A;  3USR A;  1JV3 A;  1V83 A;  4Y62 A;  4EE3 A;  3CGX A;  1GA8 A;  1QG8 A;  5FV9 A;  5C3A A;  1H7E A;  3TQD A;  3U2X A;  5CQO A;  3I0I X;  2I5E A;  3OH4 A;  3CKV A;  4DDZ A;  3O3P A;  3K8D A;  1NWG B;  5C1G A;  1H5S A;  1HM9 A;  2VSH A;  2XMH A;  2ICY A;  1ON6 A;  1EYR A;  2YQS A;  2YQH A;  2VXM A;  2QKX A;  1VIC A;  2Z86 A;  1VGW A;  4FRB A;  1YP3 A;  1ZDG A;  1NKH B;  1ZJ3 A;  3U2U A;  3I0H A;  3OAM A;  1G2V A;  3I0J A;  1I52 A;  3V0Q A;  2PGV A;  4HOC A;  2ICX A;  4M2B A;  1H3M A;  5CQM X;  1G23 A;  2RIX A;  5C1H A;  4FCU A;  2Y4K A;  3FWW A;  4D0T A;  5CQN X;  4D11 A;  5CMF X;  1XHB A;  1WT1 A;  2OI7 A;  5C4C A;  1MP3 A;  1GWV A;  2VS3 A;  1LZJ A;  2D0J A;  4AAW A;  1JV1 A;  2FYD B;  1LL0 A;  1LZ0 A;  1VZU A;  1FR9 A;  3RSB A;  2PGY A;  1XZ6 A;  2WGZ A;  3ZLK A;  4Y7F A;  3KIA A;  4BQH A;  5D92 A;  2VXL A;  3I0G A;  1VPA A;  2AEC A;  1VM8 A;  3BRK X;  2DPW A;  2FYC B;  4B2W A;  3IOH A;  2BO4 A;  4KNX A;  1VH1 A;  5L6V A;  2P6W A;  5C3B A;  1WVC A;  4KPZ A;  3HL3 A;  4FRL A;  2I7B A;  2J0A A;  3T7O A;  2GGQ A;  2GGO A;  1FZW A;  1R7X A;  2RJ7 A;  2W0V A;  4XWI A;  5FTS A;  2O1G A;  4EEA A;  2OI5 A;  1JYK A;  1GX4 A;  1R7V A;  2NXV A;  5HS2 A;  2YQC A;  3PKQ A;  3T7M A;  1VZT A;  2ZU8 A;  4KXO A;  3BCV A;  2PA4 A;  4Y7T A;  1NF5 B;  3POL A;  3R2W A;  1NHE B;  3I0E A;  5EJZ A;  1NQI B;  1H5S B;  3I0L A;  4HG6 A;  4R7P A;  4EEM A;  2VS4 A;  3DJ4 A;  2V0I A;  1FO8 A;  4NAN A;  1FRW A;  5C1L A;  4AYJ A;  1R81 A;  3SXD A;  4B4M A;  5CMG X;  4ECM A;  1GWW A;  3OC9 A;  4GBP A;  3ZGG A;  4KT7 A;  3ZGF A;  4EEG A;  1OMX A;  1FXO A;  2RIT A;  3E25 A;  3V8Y A;  3V0L A;  1PZT A;  1ZCU A;  3QVB A;  1VGU A;  2QGI A;  1LL2 A;  4LW3 A;  5C4F A;  1FO9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...