1JYLA

Catalytic mechanism of ctp:phosphocholine cytidylyltransferase from streptococcus pneumoniae (licc)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
228
structure length
228
Chain Sequence
IRVKAIILAAGLGTRLRPLTENTPKALVQVNQKPLIEYQIEFLKEKGINDIIIIVGYLKEQFDYLKEKYGVRLVFNDKYADYNNFYSLYLVKEELANSYVIDADNYLFKNMFRNDLTRSTYFSVYREDCTNEWFLVYGDDYKVQDIIVDSKAGRILSGVSFWDAPTAEKIVSFIDKAYVSGEFVDLYWDNMVKDNIKELDVYVEELEGNSIYEIDSVQDYRKLEEILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CTP:phosphocholine Cytidylyltransferase
publication title Structure and mechanism of CTP:phosphocholine cytidylyltransferase (LicC) from Streptococcus pneumoniae.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 68
structure length 228
sequence length 228
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1jylA00
2WGZA 5C4FA 2XMHA 3Q4SA 1JVGA 1GWWA 2CU2A 2I5EA 5C3BA 2JCLA 2O1HA 1H7LA 3CGXA 1VICA 1G8OA 5L6SA 2O1FA 5FU0A 2ZU8A 4JD0A 4CVHA 4KQLA 1JYKA 5CMHA 2VSHA 3OH4A 2OI6A 2D7RA 2FYAA 2VS4A 1LVWA 1ZI3A 2RJ1A 3V0LA 2VD4A 1FXJA 4GBPA 1W55A 4G3SA 1VZTA 4FRHA 2V0IA 4C2SA 5EJ1A 2D0JA 2WE9A 1I52A 1VZXA 2P73A 5CQPA 3EE5A 1PZYB 2E3DA 2X60A 3V0PA 3SXDA 2AECA 1FGGA 4FCUA 1NWGB 2GGQA 3ZGGA 3KIAA 4LW6A 1ZDGA 2D7IA 4HO9A 2Y6PA 3GUEA 1R7XA 3E26A 4NALA 2FFUA 4Y9XA 4Y7FA 3TZTA 5CQMX 4FRQA 1H5SD 2AGDA 1QWJA 5AJOA 2YC3A 2WVKA 3E25A 3HL3A 1H5RB 2PX7A 5CMJA 2YQJA 4B4BA 1O7QA 3CKVA 2GGOA 2AM3A 1FO8A 1FR9A 3RMVA 2RJ4A 1H5TB 2YC5A 3V91A 2OEFA 2YESA 4NAKA 4EEGA 3V8ZA 2JCJA 3U0YA 4M4KA 2Y4KA 1INIA 3PKPA 3POLA 1LL2A 2A8UA 3JUKA 3CKQA 2BO4A 4DECA 5BXCA 1HJLA 4D48A 1GX4A 1W77A 2VSIA 2X5ZA 1VGZA 2YCMA 1H7TA 3D98A 4HO5A 3RMWA 3I0CA 1G9RA 1S4NA 2P6WA 5CQOA 2QH5A 5C1GA 3I0HA 3BCVA 1G3LA 2RJ0A 4BQHA 1H7FA 2RJ7A 5CMIA 2ZU7A 2JCKA 3IOIA 2Y4MA 1H4CA 2V0HA 4B5BA 4ARWA 1ZIZA 4AC3A 4IRQA 4UEGA 5CMGX 1O0RA 4FQWA 4M2BA 4HO8A 5C48A 1GA8A 4EEOA 1QGQA 1XZ6A 1R82A 4Y6NA 4B42A 1FZWA 3SXGA 1MP4A 1H5SB 2FFVA 2AH9A 3OKRA 4Y7GA 4KRVA 1H4DA 5C4CA 4D0ZA 2RITA 4Y63A 5IFYA 4D11C 1ZJ3A 2Y4LA 3OH1A 1WT3A 5FYEA 4ZDQA 3V0OA 2ZU9A 1VH1A 1MP5A 1HM9A 2AM4A 4M28A 4D0TA 2QKXA 1H7HA 4NAIA 4HO3A 2VXLA 4EEMA 4CJ8A 2FYCB 3R3IA 1TW5A 1HM0A 1ZJ0A 1H7QA 5AJPA 2VS5A 1H5RA 1ZJ1A 1R80A 4IRPA 3U2VA 2PGYA 3I0JA 1FG5N 3SXBA 3OH3A 3QVBA 2BO8A 1GWVA 1VM8A 1YP4A 1JV3A 4Y62A 4B3UA 1H5TA 5CMFX 1VGUA 1TZFA 1FXOA 3Q7UA 4Y6UA 2FYBA 4L41C 3CKOA 3U2XA 4FRBA 5IDTA 1FOAA 3DUVA 3F1YA 1OMXA 4FRDA 4FROA 1WT0A 1VGTA 3ST8A 2RIXA 4KNXA 4EEAA 2FYDB 5DDVA 1LZ7A 4KPZA 2V0KA 1G1LA 3O3PA 4B4GA 2WVMA 1HJJA 3I0GA 5FV9A 1IIMA 3OAMA 1LL0A 5C1LA 4HOCA 1WSZA 1ZI4A 2DPWA 4Y64A 2AM5A 1ZCUA 4HO4A 4Y7UA 1ZHJA 4HG6A 2PGVA 5EJZA 1FWYA 1EYRA 5FUHA 3ZF8A 1OMZA 4B2XA 4J18A 3OH2A 3OC9A 5C1HA 1G0RA 1LL3A 1H3MA 4R7PA 4XWIA 1ZI5A 4FRPA 2Y7AA 1R7UA 2Q4JA 1WVCA 4M2AA 5C36A 3FOQA 4MYBA 4FCEA 3U2WA 5C4EA 3I0DA 3U2UA 4ECMA 2A8WA 4K6RA 1FRWA 4KNRA 1G23A 1FR8A 3DJ4A 1LZJA 3OGZA 5CQNX 3ZGFA 1S4PA 1ZJOA 1G97A 3OH0A 2VS3A 1YP3A 4FREA 2APCA 4CJCA 2YQCA 2OEGA 2XWLA 2Z86A 4HO6A 1OQMB 1G95A 2AESA 2RJ6A 2V0JA 1YP2A 4DE7A 2Z87A 2YQSA 1R7YA 3SX3A 1VPAA 2RIYA 5FTSA 3K8DA 4B4MA 3SX8A 4AAWA 4MNDA 3T7OA 1NHEB 1QG8A 1V84A 3F1CA 3NGWA 4G87A 1YROB 5C4DA 2RJ5A 4YS8A 1E5KA 2NXVA 1R7VA 3R2WA 1ON6A 1WT1A 3V0MA 4KC4A 3SXCA 2WAWA 1VZUA 1ZDFA 1INJA 4Y7TA 1MC3A 3BRKX 2X5SA 2VXMA 5C38A 3Q80A 1KWSA 3FWWA 4AYJA 3I0EA 3V0NA 4ASJA 1H7EA 4HCQA 2PA4A 1TVYA 3I0KA 2E8BA 4KC1A 4FRLA 3U2TA 1H5SC 3I0LA 4EE4A 2I7BA 1H4EA 1S4OA 2X65A 2MZBA 1K4VA 4P00A 4ASYA 3CU0A 1G93A 3IOJA 3RSBA 3T7MA 4AYLA 1ON8A 2WVLA 3JTJA 5J49A 5JQQA 4JISA 3D8VA 1XHBA 1W57A 1LZ0A 2ICXA 3T7NA 5FU8A 3I0IX 3CKNA 3N9WA 2P72A 1NMMB 1VH3A 5L6VA 4D11A 2RJ9A 4EVWA 1ZCVA 1G2VA 3DK5A 2W0WA 2RJ8A 1WT2A 2ICYA 5HS2A 3LW6A 4KXOA 3TQDA 1NKHB 1PZTA 5C49A 1GX0A 1VGWA 4E1KA 3SX5A 2XMEA 5EIYA 4NANA 4FRMA 5C3DA 1V82A 4P02A 3ZLLA 1R81A 1ZCYA 1ZCTA 4HO2A 5DDTA 3SXEA 2OI5A 2XWNA 3SPTA 4Y7VA 2RIZA 2AE7A 1HM8A 3SXAA 3V0QA 1SS9A 4CJBA 2OI7A 2FY7A 5I1FA 1H7GA 1H5SA 2BO6A 3USQA 5C3AA 1FGXA 4EE3A 4G3PA 5IDSA 1GQCA 2V0LA 3USRA 5C8RA 4B2WA 1JVDA 1ZJ2A 4G3QA 1ZJPA 4EE5A 2UX8A 1R7TA 3I0FA 3PNNA 2WEEA 4BMAA 3JUJA 3IOHA 2W0VA 3ZLKA 3U0XA 5FTVA 1O7OA 4DDZA 2Y4JA 1O23B 5C47A 4LW3A 3D5NA 1IINA 2QGIA 2JCOA 1TW1A 4FRAA 1MP3A 2XWMA 3CKJA 5C4BA 1ZI1A 3V90A 2YQHA 4KPXA 1HV9A 1FO9A 1NF5B 1NQIB 1Z90A 3V8YA 1GQ9A 4KC2A 1V83A 1LZIA 1EZIA 4KT7A 1JV1A 5AJNA 1QGSA 3SX7A 3PKQA 5CQLX 1JYLA 2VFZA 2O1GA 4HO0A 2I5KA 3K8EA 2BO7A
chains in the Genus database with same CATH superfamily
2WGZA 5C4FA 2XMHA 3Q4SA 1JVGA 1GWWA 2CU2A 2I5EA 5C3BA 2JCLA 2O1HA 1H7LA 3CGXA 1VICA 1G8OA 5L6SA 2O1FA 5FU0A 2ZU8A 4JD0A 4CVHA 4KQLA 1JYKA 5CMHA 2VSHA 4O6NA 3OH4A 2OI6A 4FIXA 2D7RA 2FYAA 2VS4A 1LVWA 1ZI3A 2RJ1A 3V0LA 2VD4A 1FXJA 4GBPA 1W55A 4G3SA 1VZTA 4FRHA 2V0IA 4C2SA 5EJ1A 2D0JA 2WE9A 1I52A 1VZXA 2P73A 5CQPA 3EE5A 1PZYB 2E3DA 2X60A 3V0PA 3SXDA 2AECA 1FGGA 4FCUA 1NWGB 2GGQA 3ZGGA 3KIAA 4LW6A 1ZDGA 2D7IA 4HO9A 2Y6PA 3GUEA 1R7XA 3E26A 4NALA 2FFUA 4Y9XA 4Y7FA 3TZTA 5CQMX 4FRQA 1H5SD 2AGDA 1QWJA 5AJOA 2YC3A 2WVKA 3E25A 3HL3A 1H5RB 2PX7A 5CMJA 2YQJA 4B4BA 1O7QA 3CKVA 2GGOA 2AM3A 1FO8A 1FR9A 3RMVA 2RJ4A 1H5TB 2YC5A 3V91A 2OEFA 2YESA 4O6MA 4NAKA 4EEGA 3V8ZA 2JCJA 3U0YA 4M4KA 2Y4KA 1INIA 3PKPA 3POLA 1LL2A 2A8UA 3JUKA 3CKQA 2BO4A 4DECA 5BXCA 1HJLA 4D48A 1GX4A 1W77A 2VK9A 2VSIA 2X5ZA 1VGZA 2YCMA 1H7TA 3D98A 4HO5A 3RMWA 3I0CA 1G9RA 1S4NA 2P6WA 5CQOA 2QH5A 5C1GA 3I0HA 3BCVA 1G3LA 2RJ0A 4BQHA 1H7FA 2RJ7A 5CMIA 2ZU7A 2JCKA 3IOIA 2Y4MA 1H4CA 2V0HA 4B5BA 4ARWA 1ZIZA 4AC3A 4IRQA 4UEGA 5CMGX 1O0RA 4FQWA 4M2BA 4HO8A 5C48A 1GA8A 4EEOA 1QGQA 1XZ6A 1R82A 4Y6NA 4B42A 1FZWA 3SXGA 1MP4A 1H5SB 2FFVA 2AH9A 3OKRA 4Y7GA 4KRVA 1H4DA 5C4CA 4D0ZA 2RITA 4Y63A 5IFYA 4D11C 1ZJ3A 2Y4LA 3OH1A 1WT3A 5FYEA 4ZDQA 3V0OA 2ZU9A 1VH1A 1MP5A 1HM9A 2AM4A 4M28A 4D0TA 2QKXA 1H7HA 4NAIA 4HO3A 2VXLA 4EEMA 4CJ8A 2FYCB 3R3IA 1TW5A 1HM0A 1ZJ0A 1H7QA 5AJPA 2VS5A 1H5RA 1ZJ1A 1R80A 4IRPA 3U2VA 2PGYA 3I0JA 1FG5N 3SXBA 3OH3A 3QVBA 4MIXA 2BO8A 1GWVA 1VM8A 1YP4A 1JV3A 4Y62A 4B3UA 1H5TA 5CMFX 1VGUA 1TZFA 1FXOA 3Q7UA 4Y6UA 2FYBA 4L41C 3CKOA 3U2XA 4FRBA 5IDTA 1FOAA 3DUVA 3F1YA 1OMXA 4FRDA 4FROA 1WT0A 1VGTA 3ST8A 2RIXA 4KNXA 4EEAA 2FYDB 5DDVA 1LZ7A 4FIYA 4KPZA 2V0KA 1G1LA 3O3PA 4B4GA 2WVMA 1HJJA 3I0GA 5FV9A 1IIMA 3OAMA 1LL0A 5C1LA 4HOCA 1WSZA 1ZI4A 2DPWA 4Y64A 2AM5A 1ZCUA 4HO4A 4Y7UA 1ZHJA 4HG6A 2PGVA 5EJZA 1FWYA 1EYRA 5FUHA 3ZF8A 1OMZA 4B2XA 4J18A 3OH2A 3OC9A 5C1HA 1G0RA 1LL3A 1H3MA 4R7PA 4XWIA 1ZI5A 4FRPA 2Y7AA 1R7UA 2Q4JA 1WVCA 4M2AA 5C36A 3FOQA 4MYBA 4FCEA 3U2WA 5C4EA 3I0DA 3U2UA 4ECMA 2A8WA 4K6RA 1FRWA 4KNRA 1G23A 1FR8A 3DJ4A 1LZJA 3OGZA 5CQNX 3ZGFA 1S4PA 1ZJOA 1G97A 3OH0A 2VS3A 1YP3A 4FREA 2APCA 4CJCA 2YQCA 2OEGA 2XWLA 2J0BA 2Z86A 4HO6A 1OQMB 1G95A 2AESA 2RJ6A 2V0JA 1YP2A 4DE7A 2Z87A 2YQSA 1R7YA 3SX3A 1VPAA 2RIYA 5FTSA 3K8DA 4B4MA 3SX8A 4AAWA 4MNDA 3T7OA 1NHEB 1QG8A 1V84A 3F1CA 3NGWA 4G87A 1YROB 5C4DA 2RJ5A 4YS8A 1E5KA 2NXVA 1R7VA 3R2WA 1ON6A 1WT1A 3V0MA 4KC4A 4Q7CA 3SXCA 2WAWA 1VZUA 1ZDFA 1INJA 4Y7TA 1MC3A 3BRKX 2X5SA 2VXMA 2C0NA 5C38A 3Q80A 1KWSA 3FWWA 4AYJA 3I0EA 3V0NA 4ASJA 1H7EA 4HCQA 2PA4A 1TVYA 3I0KA 2E8BA 4KC1A 4FRLA 3U2TA 1H5SC 3I0LA 4EE4A 2I7BA 1H4EA 1S4OA 2X65A 2MZBA 1K4VA 4P00A 4ASYA 3CU0A 1G93A 3IOJA 3RSBA 3T7MA 4AYLA 1ON8A 2WVLA 3JTJA 5J49A 5JQQA 4JISA 3D8VA 1XHBA 1W57A 1LZ0A 2ICXA 3T7NA 5FU8A 5D91A 3I0IX 3CKNA 3N9WA 2P72A 1NMMB 1VH3A 5L6VA 4D11A 2RJ9A 4EVWA 1ZCVA 1G2VA 3DK5A 2W0WA 2RJ8A 1WT2A 2ICYA 5HS2A 3LW6A 4KXOA 3TQDA 1NKHB 1PZTA 5C49A 2J0AA 1GX0A 1VGWA 4E1KA 3SX5A 2XMEA 5EIYA 4NANA 4FRMA 5C3DA 1V82A 4P02A 3ZLLA 1R81A 1ZCYA 1ZCTA 4HO2A 5DDTA 3SXEA 2OI5A 2XWNA 3SPTA 4Y7VA 2RIZA 2AE7A 1HM8A 3SXAA 3V0QA 1SS9A 4CJBA 2OI7A 2FY7A 5I1FA 1H7GA 1H5SA 2BO6A 3USQA 5C3AA 1FGXA 4EE3A 4G3PA 5IDSA 1GQCA 2V0LA 3USRA 5C8RA 4B2WA 1JVDA 1ZJ2A 4G3QA 5D92A 1ZJPA 4EE5A 2UX8A 1R7TA 3I0FA 3PNNA 2WEEA 4BMAA 3JUJA 3IOHA 2W0VA 3ZLKA 3U0XA 5FTVA 1O7OA 4DDZA 2Y4JA 1O23B 5C47A 4LW3A 3D5NA 1IINA 2QGIA 2JCOA 1TW1A 4FRAA 1MP3A 2XWMA 3CKJA 5C4BA 1ZI1A 3V90A 2YQHA 4KPXA 1HV9A 1FO9A 1NF5B 1NQIB 1Z90A 3V8YA 1GQ9A 4KC2A 1V83A 1LZIA 1EZIA 4KT7A 1JV1A 5AJNA 1QGSA 3SX7A 3PKQA 5CQLX 1JYLA 2VFZA 2O1GA 4HO0A 2I5KA 3K8EA 2BO7A
chains in the Genus database with same CATH topology
2WGZA 5C4FA 2XMHA 3Q4SA 1JVGA 1GWWA 2CU2A 2I5EA 5C3BA 2JCLA 2O1HA 1H7LA 3CGXA 1VICA 1G8OA 5L6SA 2O1FA 5FU0A 2ZU8A 4JD0A 4CVHA 4KQLA 1JYKA 5CMHA 2VSHA 4O6NA 3OH4A 2OI6A 4FIXA 2D7RA 2FYAA 2VS4A 1LVWA 1ZI3A 2RJ1A 3V0LA 2VD4A 1FXJA 4GBPA 1W55A 4G3SA 1VZTA 4FRHA 2V0IA 4C2SA 5EJ1A 2D0JA 2WE9A 1I52A 1VZXA 2P73A 5CQPA 3EE5A 1PZYB 2E3DA 2X60A 3V0PA 3SXDA 2AECA 1FGGA 4FCUA 1NWGB 2GGQA 3ZGGA 3KIAA 4LW6A 1ZDGA 2D7IA 4HO9A 2Y6PA 3GUEA 1R7XA 3E26A 4NALA 2FFUA 4Y9XA 4Y7FA 3TZTA 5CQMX 4FRQA 1H5SD 2AGDA 1QWJA 5AJOA 2YC3A 2WVKA 3E25A 3HL3A 1H5RB 2PX7A 5CMJA 2YQJA 4B4BA 1O7QA 3CKVA 2GGOA 2AM3A 1FO8A 1FR9A 3RMVA 2RJ4A 1H5TB 2YC5A 3V91A 2OEFA 2YESA 4O6MA 4NAKA 4EEGA 3V8ZA 2JCJA 3U0YA 4M4KA 2Y4KA 1INIA 3PKPA 3POLA 1LL2A 2A8UA 3JUKA 3CKQA 2BO4A 4DECA 5BXCA 1HJLA 4D48A 1GX4A 1W77A 2VK9A 2VSIA 2X5ZA 1VGZA 2YCMA 1H7TA 3D98A 4HO5A 3RMWA 3I0CA 1G9RA 1S4NA 2P6WA 5CQOA 2QH5A 5C1GA 3I0HA 3BCVA 1G3LA 2RJ0A 4BQHA 1H7FA 2RJ7A 5CMIA 2ZU7A 2JCKA 3IOIA 2Y4MA 1H4CA 2V0HA 4B5BA 4ARWA 1ZIZA 4AC3A 4IRQA 4UEGA 5CMGX 1O0RA 4FQWA 4M2BA 4HO8A 5C48A 1GA8A 4EEOA 1QGQA 1XZ6A 1R82A 4Y6NA 4B42A 1FZWA 3SXGA 1MP4A 1H5SB 2FFVA 2AH9A 3OKRA 4Y7GA 4KRVA 1H4DA 5C4CA 4D0ZA 2RITA 4Y63A 5IFYA 4D11C 1ZJ3A 2Y4LA 3OH1A 1WT3A 5FYEA 4ZDQA 3V0OA 2ZU9A 1VH1A 1MP5A 1HM9A 2AM4A 4M28A 4D0TA 2QKXA 1H7HA 4NAIA 4HO3A 2VXLA 4EEMA 4CJ8A 2FYCB 3R3IA 1TW5A 1HM0A 1ZJ0A 1H7QA 5AJPA 2VS5A 1H5RA 1ZJ1A 1R80A 4IRPA 3U2VA 2PGYA 3I0JA 1FG5N 3SXBA 3OH3A 3QVBA 4MIXA 2BO8A 1GWVA 1VM8A 1YP4A 1JV3A 4Y62A 4B3UA 1H5TA 5CMFX 1VGUA 1TZFA 1FXOA 3Q7UA 4Y6UA 2FYBA 4L41C 3CKOA 3U2XA 4FRBA 5IDTA 1FOAA 3DUVA 3F1YA 1OMXA 4FRDA 4FROA 1WT0A 1VGTA 3ST8A 2RIXA 4KNXA 4EEAA 2FYDB 5DDVA 1LZ7A 4FIYA 4KPZA 2V0KA 1G1LA 3O3PA 4B4GA 2WVMA 1HJJA 3I0GA 5FV9A 1IIMA 3OAMA 1LL0A 5C1LA 4HOCA 1WSZA 1ZI4A 2DPWA 4Y64A 2AM5A 1ZCUA 4HO4A 4Y7UA 1ZHJA 4HG6A 2PGVA 5EJZA 1FWYA 1EYRA 5FUHA 3ZF8A 1OMZA 4B2XA 4J18A 3OH2A 3OC9A 5C1HA 1G0RA 1LL3A 1H3MA 4R7PA 4XWIA 1ZI5A 4FRPA 2Y7AA 1R7UA 2Q4JA 1WVCA 4M2AA 5C36A 3FOQA 4MYBA 4FCEA 3U2WA 5C4EA 3I0DA 3U2UA 4ECMA 2A8WA 4K6RA 1FRWA 4KNRA 1G23A 1FR8A 3DJ4A 1LZJA 3OGZA 5CQNX 3ZGFA 1S4PA 1ZJOA 1G97A 3OH0A 2VS3A 1YP3A 4FREA 2APCA 4CJCA 2YQCA 2OEGA 2XWLA 2J0BA 2Z86A 4HO6A 1OQMB 1G95A 2AESA 2RJ6A 2V0JA 1YP2A 4DE7A 2Z87A 2YQSA 1R7YA 3SX3A 1VPAA 2RIYA 5FTSA 3K8DA 4B4MA 3SX8A 4AAWA 4MNDA 3T7OA 1NHEB 1QG8A 1V84A 3F1CA 3NGWA 4G87A 1YROB 5C4DA 2RJ5A 4YS8A 1E5KA 2NXVA 1R7VA 3R2WA 1ON6A 1WT1A 3V0MA 4KC4A 4Q7CA 3SXCA 2WAWA 1VZUA 1ZDFA 1INJA 4Y7TA 1MC3A 3BRKX 2X5SA 2VXMA 2C0NA 5C38A 3Q80A 1KWSA 3FWWA 4AYJA 3I0EA 3V0NA 4ASJA 1H7EA 4HCQA 2PA4A 1TVYA 3I0KA 2E8BA 4KC1A 4FRLA 3U2TA 1H5SC 3I0LA 4EE4A 2I7BA 1H4EA 1S4OA 2X65A 2MZBA 1K4VA 4P00A 4ASYA 3CU0A 1G93A 3IOJA 3RSBA 3T7MA 4AYLA 1ON8A 2WVLA 3JTJA 5J49A 5JQQA 4JISA 3D8VA 1XHBA 1W57A 1LZ0A 2ICXA 3T7NA 5FU8A 5D91A 3I0IX 3CKNA 3N9WA 2P72A 1NMMB 1VH3A 5L6VA 4D11A 2RJ9A 4EVWA 1ZCVA 1G2VA 3DK5A 2W0WA 2RJ8A 1WT2A 2ICYA 5HS2A 3LW6A 4KXOA 3TQDA 1NKHB 1PZTA 5C49A 2J0AA 1GX0A 1VGWA 4E1KA 3SX5A 2XMEA 5EIYA 4NANA 4FRMA 5C3DA 1V82A 4P02A 3ZLLA 1R81A 1ZCYA 1ZCTA 4HO2A 5DDTA 3SXEA 2OI5A 2XWNA 3SPTA 4Y7VA 2RIZA 2AE7A 1HM8A 3SXAA 3V0QA 1SS9A 4CJBA 2OI7A 2FY7A 5I1FA 1H7GA 1H5SA 2BO6A 3USQA 5C3AA 1FGXA 4EE3A 4G3PA 5IDSA 1GQCA 2V0LA 3USRA 5C8RA 4B2WA 1JVDA 1ZJ2A 4G3QA 5D92A 1ZJPA 4EE5A 2UX8A 1R7TA 3I0FA 3PNNA 2WEEA 4BMAA 3JUJA 3IOHA 2W0VA 3ZLKA 3U0XA 5FTVA 1O7OA 4DDZA 2Y4JA 1O23B 5C47A 4LW3A 3D5NA 1IINA 2QGIA 2JCOA 1TW1A 4FRAA 1MP3A 2XWMA 3CKJA 5C4BA 1ZI1A 3V90A 2YQHA 4KPXA 1HV9A 1FO9A 1NF5B 1NQIB 1Z90A 3V8YA 1GQ9A 4KC2A 1V83A 1LZIA 1EZIA 4KT7A 1JV1A 5AJNA 1QGSA 3SX7A 3PKQA 5CQLX 1JYLA 2VFZA 2O1GA 4HO0A 2I5KA 3K8EA 2BO7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WGZ A;  5C4F A;  2XMH A;  3Q4S A;  1JVG A;  1GWW A;  2CU2 A;  2I5E A;  5C3B A;  2JCL A;  2O1H A;  1H7L A;  3CGX A;  1VIC A;  1G8O A;  5L6S A;  2O1F A;  5FU0 A;  2ZU8 A;  4JD0 A;  4CVH A;  4KQL A;  1JYK A;  5CMH A;  2VSH A;  3OH4 A;  2OI6 A;  2D7R A;  2FYA A;  2VS4 A;  1LVW A;  1ZI3 A;  2RJ1 A;  3V0L A;  2VD4 A;  1FXJ A;  4GBP A;  1W55 A;  4G3S A;  1VZT A;  4FRH A;  2V0I A;  4C2S A;  5EJ1 A;  2D0J A;  2WE9 A;  1I52 A;  1VZX A;  2P73 A;  5CQP A;  3EE5 A;  1PZY B;  2E3D A;  2X60 A;  3V0P A;  3SXD A;  2AEC A;  1FGG A;  4FCU A;  1NWG B;  2GGQ A;  3ZGG A;  3KIA A;  4LW6 A;  1ZDG A;  2D7I A;  4HO9 A;  2Y6P A;  3GUE A;  1R7X A;  3E26 A;  4NAL A;  2FFU A;  4Y9X A;  4Y7F A;  3TZT A;  5CQM X;  4FRQ A;  1H5S D;  2AGD A;  1QWJ A;  5AJO A;  2YC3 A;  2WVK A;  3E25 A;  3HL3 A;  1H5R B;  2PX7 A;  5CMJ A;  2YQJ A;  4B4B A;  1O7Q A;  3CKV A;  2GGO A;  2AM3 A;  1FO8 A;  1FR9 A;  3RMV A;  2RJ4 A;  1H5T B;  2YC5 A;  3V91 A;  2OEF A;  2YES A;  4NAK A;  4EEG A;  3V8Z A;  2JCJ A;  3U0Y A;  4M4K A;  2Y4K A;  1INI A;  3PKP A;  3POL A;  1LL2 A;  2A8U A;  3JUK A;  3CKQ A;  2BO4 A;  4DEC A;  5BXC A;  1HJL A;  4D48 A;  1GX4 A;  1W77 A;  2VSI A;  2X5Z A;  1VGZ A;  2YCM A;  1H7T A;  3D98 A;  4HO5 A;  3RMW A;  3I0C A;  1G9R A;  1S4N A;  2P6W A;  5CQO A;  2QH5 A;  5C1G A;  3I0H A;  3BCV A;  1G3L A;  2RJ0 A;  4BQH A;  1H7F A;  2RJ7 A;  5CMI A;  2ZU7 A;  2JCK A;  3IOI A;  2Y4M A;  1H4C A;  2V0H A;  4B5B A;  4ARW A;  1ZIZ A;  4AC3 A;  4IRQ A;  4UEG A;  5CMG X;  1O0R A;  4FQW A;  4M2B A;  4HO8 A;  5C48 A;  1GA8 A;  4EEO A;  1QGQ A;  1XZ6 A;  1R82 A;  4Y6N A;  4B42 A;  1FZW A;  3SXG A;  1MP4 A;  1H5S B;  2FFV A;  2AH9 A;  3OKR A;  4Y7G A;  4KRV A;  1H4D A;  5C4C A;  4D0Z A;  2RIT A;  4Y63 A;  5IFY A;  4D11 C;  1ZJ3 A;  2Y4L A;  3OH1 A;  1WT3 A;  5FYE A;  4ZDQ A;  3V0O A;  2ZU9 A;  1VH1 A;  1MP5 A;  1HM9 A;  2AM4 A;  4M28 A;  4D0T A;  2QKX A;  1H7H A;  4NAI A;  4HO3 A;  2VXL A;  4EEM A;  4CJ8 A;  2FYC B;  3R3I A;  1TW5 A;  1HM0 A;  1ZJ0 A;  1H7Q A;  5AJP A;  2VS5 A;  1H5R A;  1ZJ1 A;  1R80 A;  4IRP A;  3U2V A;  2PGY A;  3I0J A;  1FG5 N;  3SXB A;  3OH3 A;  3QVB A;  2BO8 A;  1GWV A;  1VM8 A;  1YP4 A;  1JV3 A;  4Y62 A;  4B3U A;  1H5T A;  5CMF X;  1VGU A;  1TZF A;  1FXO A;  3Q7U A;  4Y6U A;  2FYB A;  4L41 C;  3CKO A;  3U2X A;  4FRB A;  5IDT A;  1FOA A;  3DUV A;  3F1Y A;  1OMX A;  4FRD A;  4FRO A;  1WT0 A;  1VGT A;  3ST8 A;  2RIX A;  4KNX A;  4EEA A;  2FYD B;  5DDV A;  1LZ7 A;  4KPZ A;  2V0K A;  1G1L A;  3O3P A;  4B4G A;  2WVM A;  1HJJ A;  3I0G A;  5FV9 A;  1IIM A;  3OAM A;  1LL0 A;  5C1L A;  4HOC A;  1WSZ A;  1ZI4 A;  2DPW A;  4Y64 A;  2AM5 A;  1ZCU A;  4HO4 A;  4Y7U A;  1ZHJ A;  4HG6 A;  2PGV A;  5EJZ A;  1FWY A;  1EYR A;  5FUH A;  3ZF8 A;  1OMZ A;  4B2X A;  4J18 A;  3OH2 A;  3OC9 A;  5C1H A;  1G0R A;  1LL3 A;  1H3M A;  4R7P A;  4XWI A;  1ZI5 A;  4FRP A;  2Y7A A;  1R7U A;  2Q4J A;  1WVC A;  4M2A A;  5C36 A;  3FOQ A;  4MYB A;  4FCE A;  3U2W A;  5C4E A;  3I0D A;  3U2U A;  4ECM A;  2A8W A;  4K6R A;  1FRW A;  4KNR A;  1G23 A;  1FR8 A;  3DJ4 A;  1LZJ A;  3OGZ A;  5CQN X;  3ZGF A;  1S4P A;  1ZJO A;  1G97 A;  3OH0 A;  2VS3 A;  1YP3 A;  4FRE A;  2APC A;  4CJC A;  2YQC A;  2OEG A;  2XWL A;  2Z86 A;  4HO6 A;  1OQM B;  1G95 A;  2AES A;  2RJ6 A;  2V0J A;  1YP2 A;  4DE7 A;  2Z87 A;  2YQS A;  1R7Y A;  3SX3 A;  1VPA A;  2RIY A;  5FTS A;  3K8D A;  4B4M A;  3SX8 A;  4AAW A;  4MND A;  3T7O A;  1NHE B;  1QG8 A;  1V84 A;  3F1C A;  3NGW A;  4G87 A;  1YRO B;  5C4D A;  2RJ5 A;  4YS8 A;  1E5K A;  2NXV A;  1R7V A;  3R2W A;  1ON6 A;  1WT1 A;  3V0M A;  4KC4 A;  3SXC A;  2WAW A;  1VZU A;  1ZDF A;  1INJ A;  4Y7T A;  1MC3 A;  3BRK X;  2X5S A;  2VXM A;  5C38 A;  3Q80 A;  1KWS A;  3FWW A;  4AYJ A;  3I0E A;  3V0N A;  4ASJ A;  1H7E A;  4HCQ A;  2PA4 A;  1TVY A;  3I0K A;  2E8B A;  4KC1 A;  4FRL A;  3U2T A;  1H5S C;  3I0L A;  4EE4 A;  2I7B A;  1H4E A;  1S4O A;  2X65 A;  2MZB A;  1K4V A;  4P00 A;  4ASY A;  3CU0 A;  1G93 A;  3IOJ A;  3RSB A;  3T7M A;  4AYL A;  1ON8 A;  2WVL A;  3JTJ A;  5J49 A;  5JQQ A;  4JIS A;  3D8V A;  1XHB A;  1W57 A;  1LZ0 A;  2ICX A;  3T7N A;  5FU8 A;  3I0I X;  3CKN A;  3N9W A;  2P72 A;  1NMM B;  1VH3 A;  5L6V A;  4D11 A;  2RJ9 A;  4EVW A;  1ZCV A;  1G2V A;  3DK5 A;  2W0W A;  2RJ8 A;  1WT2 A;  2ICY A;  5HS2 A;  3LW6 A;  4KXO A;  3TQD A;  1NKH B;  1PZT A;  5C49 A;  1GX0 A;  1VGW A;  4E1K A;  3SX5 A;  2XME A;  5EIY A;  4NAN A;  4FRM A;  5C3D A;  1V82 A;  4P02 A;  3ZLL A;  1R81 A;  1ZCY A;  1ZCT A;  4HO2 A;  5DDT A;  3SXE A;  2OI5 A;  2XWN A;  3SPT A;  4Y7V A;  2RIZ A;  2AE7 A;  1HM8 A;  3SXA A;  3V0Q A;  1SS9 A;  4CJB A;  2OI7 A;  2FY7 A;  5I1F A;  1H7G A;  1H5S A;  2BO6 A;  3USQ A;  5C3A A;  1FGX A;  4EE3 A;  4G3P A;  5IDS A;  1GQC A;  2V0L A;  3USR A;  5C8R A;  4B2W A;  1JVD A;  1ZJ2 A;  4G3Q A;  1ZJP A;  4EE5 A;  2UX8 A;  1R7T A;  3I0F A;  3PNN A;  2WEE A;  4BMA A;  3JUJ A;  3IOH A;  2W0V A;  3ZLK A;  3U0X A;  5FTV A;  1O7O A;  4DDZ A;  2Y4J A;  1O23 B;  5C47 A;  4LW3 A;  3D5N A;  1IIN A;  2QGI A;  2JCO A;  1TW1 A;  4FRA A;  1MP3 A;  2XWM A;  3CKJ A;  5C4B A;  1ZI1 A;  3V90 A;  2YQH A;  4KPX A;  1HV9 A;  1FO9 A;  1NF5 B;  1NQI B;  1Z90 A;  3V8Y A;  1GQ9 A;  4KC2 A;  1V83 A;  1LZI A;  1EZI A;  4KT7 A;  1JV1 A;  5AJN A;  1QGS A;  3SX7 A;  3PKQ A;  5CQL X;  1JYL A;  2VFZ A;  2O1G A;  4HO0 A;  2I5K A;  3K8E A;  2BO7 A; 
#chains in the Genus database with same CATH topology
 2WGZ A;  5C4F A;  2XMH A;  3Q4S A;  1JVG A;  1GWW A;  2CU2 A;  2I5E A;  5C3B A;  2JCL A;  2O1H A;  1H7L A;  3CGX A;  1VIC A;  1G8O A;  5L6S A;  2O1F A;  5FU0 A;  2ZU8 A;  4JD0 A;  4CVH A;  4KQL A;  1JYK A;  5CMH A;  2VSH A;  4O6N A;  3OH4 A;  2OI6 A;  4FIX A;  2D7R A;  2FYA A;  2VS4 A;  1LVW A;  1ZI3 A;  2RJ1 A;  3V0L A;  2VD4 A;  1FXJ A;  4GBP A;  1W55 A;  4G3S A;  1VZT A;  4FRH A;  2V0I A;  4C2S A;  5EJ1 A;  2D0J A;  2WE9 A;  1I52 A;  1VZX A;  2P73 A;  5CQP A;  3EE5 A;  1PZY B;  2E3D A;  2X60 A;  3V0P A;  3SXD A;  2AEC A;  1FGG A;  4FCU A;  1NWG B;  2GGQ A;  3ZGG A;  3KIA A;  4LW6 A;  1ZDG A;  2D7I A;  4HO9 A;  2Y6P A;  3GUE A;  1R7X A;  3E26 A;  4NAL A;  2FFU A;  4Y9X A;  4Y7F A;  3TZT A;  5CQM X;  4FRQ A;  1H5S D;  2AGD A;  1QWJ A;  5AJO A;  2YC3 A;  2WVK A;  3E25 A;  3HL3 A;  1H5R B;  2PX7 A;  5CMJ A;  2YQJ A;  4B4B A;  1O7Q A;  3CKV A;  2GGO A;  2AM3 A;  1FO8 A;  1FR9 A;  3RMV A;  2RJ4 A;  1H5T B;  2YC5 A;  3V91 A;  2OEF A;  2YES A;  4O6M A;  4NAK A;  4EEG A;  3V8Z A;  2JCJ A;  3U0Y A;  4M4K A;  2Y4K A;  1INI A;  3PKP A;  3POL A;  1LL2 A;  2A8U A;  3JUK A;  3CKQ A;  2BO4 A;  4DEC A;  5BXC A;  1HJL A;  4D48 A;  1GX4 A;  1W77 A;  2VK9 A;  2VSI A;  2X5Z A;  1VGZ A;  2YCM A;  1H7T A;  3D98 A;  4HO5 A;  3RMW A;  3I0C A;  1G9R A;  1S4N A;  2P6W A;  5CQO A;  2QH5 A;  5C1G A;  3I0H A;  3BCV A;  1G3L A;  2RJ0 A;  4BQH A;  1H7F A;  2RJ7 A;  5CMI A;  2ZU7 A;  2JCK A;  3IOI A;  2Y4M A;  1H4C A;  2V0H A;  4B5B A;  4ARW A;  1ZIZ A;  4AC3 A;  4IRQ A;  4UEG A;  5CMG X;  1O0R A;  4FQW A;  4M2B A;  4HO8 A;  5C48 A;  1GA8 A;  4EEO A;  1QGQ A;  1XZ6 A;  1R82 A;  4Y6N A;  4B42 A;  1FZW A;  3SXG A;  1MP4 A;  1H5S B;  2FFV A;  2AH9 A;  3OKR A;  4Y7G A;  4KRV A;  1H4D A;  5C4C A;  4D0Z A;  2RIT A;  4Y63 A;  5IFY A;  4D11 C;  1ZJ3 A;  2Y4L A;  3OH1 A;  1WT3 A;  5FYE A;  4ZDQ A;  3V0O A;  2ZU9 A;  1VH1 A;  1MP5 A;  1HM9 A;  2AM4 A;  4M28 A;  4D0T A;  2QKX A;  1H7H A;  4NAI A;  4HO3 A;  2VXL A;  4EEM A;  4CJ8 A;  2FYC B;  3R3I A;  1TW5 A;  1HM0 A;  1ZJ0 A;  1H7Q A;  5AJP A;  2VS5 A;  1H5R A;  1ZJ1 A;  1R80 A;  4IRP A;  3U2V A;  2PGY A;  3I0J A;  1FG5 N;  3SXB A;  3OH3 A;  3QVB A;  4MIX A;  2BO8 A;  1GWV A;  1VM8 A;  1YP4 A;  1JV3 A;  4Y62 A;  4B3U A;  1H5T A;  5CMF X;  1VGU A;  1TZF A;  1FXO A;  3Q7U A;  4Y6U A;  2FYB A;  4L41 C;  3CKO A;  3U2X A;  4FRB A;  5IDT A;  1FOA A;  3DUV A;  3F1Y A;  1OMX A;  4FRD A;  4FRO A;  1WT0 A;  1VGT A;  3ST8 A;  2RIX A;  4KNX A;  4EEA A;  2FYD B;  5DDV A;  1LZ7 A;  4FIY A;  4KPZ A;  2V0K A;  1G1L A;  3O3P A;  4B4G A;  2WVM A;  1HJJ A;  3I0G A;  5FV9 A;  1IIM A;  3OAM A;  1LL0 A;  5C1L A;  4HOC A;  1WSZ A;  1ZI4 A;  2DPW A;  4Y64 A;  2AM5 A;  1ZCU A;  4HO4 A;  4Y7U A;  1ZHJ A;  4HG6 A;  2PGV A;  5EJZ A;  1FWY A;  1EYR A;  5FUH A;  3ZF8 A;  1OMZ A;  4B2X A;  4J18 A;  3OH2 A;  3OC9 A;  5C1H A;  1G0R A;  1LL3 A;  1H3M A;  4R7P A;  4XWI A;  1ZI5 A;  4FRP A;  2Y7A A;  1R7U A;  2Q4J A;  1WVC A;  4M2A A;  5C36 A;  3FOQ A;  4MYB A;  4FCE A;  3U2W A;  5C4E A;  3I0D A;  3U2U A;  4ECM A;  2A8W A;  4K6R A;  1FRW A;  4KNR A;  1G23 A;  1FR8 A;  3DJ4 A;  1LZJ A;  3OGZ A;  5CQN X;  3ZGF A;  1S4P A;  1ZJO A;  1G97 A;  3OH0 A;  2VS3 A;  1YP3 A;  4FRE A;  2APC A;  4CJC A;  2YQC A;  2OEG A;  2XWL A;  2J0B A;  2Z86 A;  4HO6 A;  1OQM B;  1G95 A;  2AES A;  2RJ6 A;  2V0J A;  1YP2 A;  4DE7 A;  2Z87 A;  2YQS A;  1R7Y A;  3SX3 A;  1VPA A;  2RIY A;  5FTS A;  3K8D A;  4B4M A;  3SX8 A;  4AAW A;  4MND A;  3T7O A;  1NHE B;  1QG8 A;  1V84 A;  3F1C A;  3NGW A;  4G87 A;  1YRO B;  5C4D A;  2RJ5 A;  4YS8 A;  1E5K A;  2NXV A;  1R7V A;  3R2W A;  1ON6 A;  1WT1 A;  3V0M A;  4KC4 A;  4Q7C A;  3SXC A;  2WAW A;  1VZU A;  1ZDF A;  1INJ A;  4Y7T A;  1MC3 A;  3BRK X;  2X5S A;  2VXM A;  2C0N A;  5C38 A;  3Q80 A;  1KWS A;  3FWW A;  4AYJ A;  3I0E A;  3V0N A;  4ASJ A;  1H7E A;  4HCQ A;  2PA4 A;  1TVY A;  3I0K A;  2E8B A;  4KC1 A;  4FRL A;  3U2T A;  1H5S C;  3I0L A;  4EE4 A;  2I7B A;  1H4E A;  1S4O A;  2X65 A;  2MZB A;  1K4V A;  4P00 A;  4ASY A;  3CU0 A;  1G93 A;  3IOJ A;  3RSB A;  3T7M A;  4AYL A;  1ON8 A;  2WVL A;  3JTJ A;  5J49 A;  5JQQ A;  4JIS A;  3D8V A;  1XHB A;  1W57 A;  1LZ0 A;  2ICX A;  3T7N A;  5FU8 A;  5D91 A;  3I0I X;  3CKN A;  3N9W A;  2P72 A;  1NMM B;  1VH3 A;  5L6V A;  4D11 A;  2RJ9 A;  4EVW A;  1ZCV A;  1G2V A;  3DK5 A;  2W0W A;  2RJ8 A;  1WT2 A;  2ICY A;  5HS2 A;  3LW6 A;  4KXO A;  3TQD A;  1NKH B;  1PZT A;  5C49 A;  2J0A A;  1GX0 A;  1VGW A;  4E1K A;  3SX5 A;  2XME A;  5EIY A;  4NAN A;  4FRM A;  5C3D A;  1V82 A;  4P02 A;  3ZLL A;  1R81 A;  1ZCY A;  1ZCT A;  4HO2 A;  5DDT A;  3SXE A;  2OI5 A;  2XWN A;  3SPT A;  4Y7V A;  2RIZ A;  2AE7 A;  1HM8 A;  3SXA A;  3V0Q A;  1SS9 A;  4CJB A;  2OI7 A;  2FY7 A;  5I1F A;  1H7G A;  1H5S A;  2BO6 A;  3USQ A;  5C3A A;  1FGX A;  4EE3 A;  4G3P A;  5IDS A;  1GQC A;  2V0L A;  3USR A;  5C8R A;  4B2W A;  1JVD A;  1ZJ2 A;  4G3Q A;  5D92 A;  1ZJP A;  4EE5 A;  2UX8 A;  1R7T A;  3I0F A;  3PNN A;  2WEE A;  4BMA A;  3JUJ A;  3IOH A;  2W0V A;  3ZLK A;  3U0X A;  5FTV A;  1O7O A;  4DDZ A;  2Y4J A;  1O23 B;  5C47 A;  4LW3 A;  3D5N A;  1IIN A;  2QGI A;  2JCO A;  1TW1 A;  4FRA A;  1MP3 A;  2XWM A;  3CKJ A;  5C4B A;  1ZI1 A;  3V90 A;  2YQH A;  4KPX A;  1HV9 A;  1FO9 A;  1NF5 B;  1NQI B;  1Z90 A;  3V8Y A;  1GQ9 A;  4KC2 A;  1V83 A;  1LZI A;  1EZI A;  4KT7 A;  1JV1 A;  5AJN A;  1QGS A;  3SX7 A;  3PKQ A;  5CQL X;  1JYL A;  2VFZ A;  2O1G A;  4HO0 A;  2I5K A;  3K8E A;  2BO7 A; 
#chains in the Genus database with same CATH homology
 2WGZ A;  5C4F A;  2XMH A;  3Q4S A;  1JVG A;  1GWW A;  2CU2 A;  2I5E A;  5C3B A;  2JCL A;  2O1H A;  1H7L A;  3CGX A;  1VIC A;  1G8O A;  5L6S A;  2O1F A;  5FU0 A;  2ZU8 A;  4JD0 A;  4CVH A;  4KQL A;  1JYK A;  5CMH A;  2VSH A;  4O6N A;  3OH4 A;  2OI6 A;  4FIX A;  2D7R A;  2FYA A;  2VS4 A;  1LVW A;  1ZI3 A;  2RJ1 A;  3V0L A;  2VD4 A;  1FXJ A;  4GBP A;  1W55 A;  4G3S A;  1VZT A;  4FRH A;  2V0I A;  4C2S A;  5EJ1 A;  2D0J A;  2WE9 A;  1I52 A;  1VZX A;  2P73 A;  5CQP A;  3EE5 A;  1PZY B;  2E3D A;  2X60 A;  3V0P A;  3SXD A;  2AEC A;  1FGG A;  4FCU A;  1NWG B;  2GGQ A;  3ZGG A;  3KIA A;  4LW6 A;  1ZDG A;  2D7I A;  4HO9 A;  2Y6P A;  3GUE A;  1R7X A;  3E26 A;  4NAL A;  2FFU A;  4Y9X A;  4Y7F A;  3TZT A;  5CQM X;  4FRQ A;  1H5S D;  2AGD A;  1QWJ A;  5AJO A;  2YC3 A;  2WVK A;  3E25 A;  3HL3 A;  1H5R B;  2PX7 A;  5CMJ A;  2YQJ A;  4B4B A;  1O7Q A;  3CKV A;  2GGO A;  2AM3 A;  1FO8 A;  1FR9 A;  3RMV A;  2RJ4 A;  1H5T B;  2YC5 A;  3V91 A;  2OEF A;  2YES A;  4O6M A;  4NAK A;  4EEG A;  3V8Z A;  2JCJ A;  3U0Y A;  4M4K A;  2Y4K A;  1INI A;  3PKP A;  3POL A;  1LL2 A;  2A8U A;  3JUK A;  3CKQ A;  2BO4 A;  4DEC A;  5BXC A;  1HJL A;  4D48 A;  1GX4 A;  1W77 A;  2VK9 A;  2VSI A;  2X5Z A;  1VGZ A;  2YCM A;  1H7T A;  3D98 A;  4HO5 A;  3RMW A;  3I0C A;  1G9R A;  1S4N A;  2P6W A;  5CQO A;  2QH5 A;  5C1G A;  3I0H A;  3BCV A;  1G3L A;  2RJ0 A;  4BQH A;  1H7F A;  2RJ7 A;  5CMI A;  2ZU7 A;  2JCK A;  3IOI A;  2Y4M A;  1H4C A;  2V0H A;  4B5B A;  4ARW A;  1ZIZ A;  4AC3 A;  4IRQ A;  4UEG A;  5CMG X;  1O0R A;  4FQW A;  4M2B A;  4HO8 A;  5C48 A;  1GA8 A;  4EEO A;  1QGQ A;  1XZ6 A;  1R82 A;  4Y6N A;  4B42 A;  1FZW A;  3SXG A;  1MP4 A;  1H5S B;  2FFV A;  2AH9 A;  3OKR A;  4Y7G A;  4KRV A;  1H4D A;  5C4C A;  4D0Z A;  2RIT A;  4Y63 A;  5IFY A;  4D11 C;  1ZJ3 A;  2Y4L A;  3OH1 A;  1WT3 A;  5FYE A;  4ZDQ A;  3V0O A;  2ZU9 A;  1VH1 A;  1MP5 A;  1HM9 A;  2AM4 A;  4M28 A;  4D0T A;  2QKX A;  1H7H A;  4NAI A;  4HO3 A;  2VXL A;  4EEM A;  4CJ8 A;  2FYC B;  3R3I A;  1TW5 A;  1HM0 A;  1ZJ0 A;  1H7Q A;  5AJP A;  2VS5 A;  1H5R A;  1ZJ1 A;  1R80 A;  4IRP A;  3U2V A;  2PGY A;  3I0J A;  1FG5 N;  3SXB A;  3OH3 A;  3QVB A;  4MIX A;  2BO8 A;  1GWV A;  1VM8 A;  1YP4 A;  1JV3 A;  4Y62 A;  4B3U A;  1H5T A;  5CMF X;  1VGU A;  1TZF A;  1FXO A;  3Q7U A;  4Y6U A;  2FYB A;  4L41 C;  3CKO A;  3U2X A;  4FRB A;  5IDT A;  1FOA A;  3DUV A;  3F1Y A;  1OMX A;  4FRD A;  4FRO A;  1WT0 A;  1VGT A;  3ST8 A;  2RIX A;  4KNX A;  4EEA A;  2FYD B;  5DDV A;  1LZ7 A;  4FIY A;  4KPZ A;  2V0K A;  1G1L A;  3O3P A;  4B4G A;  2WVM A;  1HJJ A;  3I0G A;  5FV9 A;  1IIM A;  3OAM A;  1LL0 A;  5C1L A;  4HOC A;  1WSZ A;  1ZI4 A;  2DPW A;  4Y64 A;  2AM5 A;  1ZCU A;  4HO4 A;  4Y7U A;  1ZHJ A;  4HG6 A;  2PGV A;  5EJZ A;  1FWY A;  1EYR A;  5FUH A;  3ZF8 A;  1OMZ A;  4B2X A;  4J18 A;  3OH2 A;  3OC9 A;  5C1H A;  1G0R A;  1LL3 A;  1H3M A;  4R7P A;  4XWI A;  1ZI5 A;  4FRP A;  2Y7A A;  1R7U A;  2Q4J A;  1WVC A;  4M2A A;  5C36 A;  3FOQ A;  4MYB A;  4FCE A;  3U2W A;  5C4E A;  3I0D A;  3U2U A;  4ECM A;  2A8W A;  4K6R A;  1FRW A;  4KNR A;  1G23 A;  1FR8 A;  3DJ4 A;  1LZJ A;  3OGZ A;  5CQN X;  3ZGF A;  1S4P A;  1ZJO A;  1G97 A;  3OH0 A;  2VS3 A;  1YP3 A;  4FRE A;  2APC A;  4CJC A;  2YQC A;  2OEG A;  2XWL A;  2J0B A;  2Z86 A;  4HO6 A;  1OQM B;  1G95 A;  2AES A;  2RJ6 A;  2V0J A;  1YP2 A;  4DE7 A;  2Z87 A;  2YQS A;  1R7Y A;  3SX3 A;  1VPA A;  2RIY A;  5FTS A;  3K8D A;  4B4M A;  3SX8 A;  4AAW A;  4MND A;  3T7O A;  1NHE B;  1QG8 A;  1V84 A;  3F1C A;  3NGW A;  4G87 A;  1YRO B;  5C4D A;  2RJ5 A;  4YS8 A;  1E5K A;  2NXV A;  1R7V A;  3R2W A;  1ON6 A;  1WT1 A;  3V0M A;  4KC4 A;  4Q7C A;  3SXC A;  2WAW A;  1VZU A;  1ZDF A;  1INJ A;  4Y7T A;  1MC3 A;  3BRK X;  2X5S A;  2VXM A;  2C0N A;  5C38 A;  3Q80 A;  1KWS A;  3FWW A;  4AYJ A;  3I0E A;  3V0N A;  4ASJ A;  1H7E A;  4HCQ A;  2PA4 A;  1TVY A;  3I0K A;  2E8B A;  4KC1 A;  4FRL A;  3U2T A;  1H5S C;  3I0L A;  4EE4 A;  2I7B A;  1H4E A;  1S4O A;  2X65 A;  2MZB A;  1K4V A;  4P00 A;  4ASY A;  3CU0 A;  1G93 A;  3IOJ A;  3RSB A;  3T7M A;  4AYL A;  1ON8 A;  2WVL A;  3JTJ A;  5J49 A;  5JQQ A;  4JIS A;  3D8V A;  1XHB A;  1W57 A;  1LZ0 A;  2ICX A;  3T7N A;  5FU8 A;  5D91 A;  3I0I X;  3CKN A;  3N9W A;  2P72 A;  1NMM B;  1VH3 A;  5L6V A;  4D11 A;  2RJ9 A;  4EVW A;  1ZCV A;  1G2V A;  3DK5 A;  2W0W A;  2RJ8 A;  1WT2 A;  2ICY A;  5HS2 A;  3LW6 A;  4KXO A;  3TQD A;  1NKH B;  1PZT A;  5C49 A;  2J0A A;  1GX0 A;  1VGW A;  4E1K A;  3SX5 A;  2XME A;  5EIY A;  4NAN A;  4FRM A;  5C3D A;  1V82 A;  4P02 A;  3ZLL A;  1R81 A;  1ZCY A;  1ZCT A;  4HO2 A;  5DDT A;  3SXE A;  2OI5 A;  2XWN A;  3SPT A;  4Y7V A;  2RIZ A;  2AE7 A;  1HM8 A;  3SXA A;  3V0Q A;  1SS9 A;  4CJB A;  2OI7 A;  2FY7 A;  5I1F A;  1H7G A;  1H5S A;  2BO6 A;  3USQ A;  5C3A A;  1FGX A;  4EE3 A;  4G3P A;  5IDS A;  1GQC A;  2V0L A;  3USR A;  5C8R A;  4B2W A;  1JVD A;  1ZJ2 A;  4G3Q A;  5D92 A;  1ZJP A;  4EE5 A;  2UX8 A;  1R7T A;  3I0F A;  3PNN A;  2WEE A;  4BMA A;  3JUJ A;  3IOH A;  2W0V A;  3ZLK A;  3U0X A;  5FTV A;  1O7O A;  4DDZ A;  2Y4J A;  1O23 B;  5C47 A;  4LW3 A;  3D5N A;  1IIN A;  2QGI A;  2JCO A;  1TW1 A;  4FRA A;  1MP3 A;  2XWM A;  3CKJ A;  5C4B A;  1ZI1 A;  3V90 A;  2YQH A;  4KPX A;  1HV9 A;  1FO9 A;  1NF5 B;  1NQI B;  1Z90 A;  3V8Y A;  1GQ9 A;  4KC2 A;  1V83 A;  1LZI A;  1EZI A;  4KT7 A;  1JV1 A;  5AJN A;  1QGS A;  3SX7 A;  3PKQ A;  5CQL X;  1JYL A;  2VFZ A;  2O1G A;  4HO0 A;  2I5K A;  3K8E A;  2BO7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...