2RJ7A

B-specific alpha-1,3-galactosyltransferase g176r s235g mutant (aabb) + udpgal + deoxy-acceptor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
293
structure length
292
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycoprotein-fucosylgalactoside alpha-galactosyltransferase
publication title ABO(H) blood group A and B glycosyltransferases recognize substrate via specific conformational changes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 94
structure length 292
sequence length 293
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2007-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2rj7A00
1ZJPA 1V84A 4CVHA 2I5KA 3IOHA 1H5SA 5CMGX 1LL3A 3V8YA 4KXOA 1W57A 2VS3A 2DPWA 3U0YA 1ZJ2A 3I0CA 2YQSA 4UEGA 5AJOA 2VS5A 4B4MA 4FREA 4EEGA 2V0IA 2YQCA 4EEAA 2Y4LA 1WT2A 3E26A 1YROB 2OEGA 2FYDB 3SXCA 5EIYA 1VGTA 5C1GA 3R2WA 5EJZA 5C4FA 4G3QA 1PZTA 4AAWA 4FRPA 3EE5A 2WVKA 2VS4A 1HJLA 2VXMA 4Y7FA 4Y6NA 3IOJA 4M2AA 2RJ5A 1HJJA 1R80A 2BO4A 4HCQA 2A8UA 1TZFA 1XHBA 1VH3A 4E1KA 2YC5A 2O1FA 4D11C 4KC2A 3T7OA 5CMHA 4KC1A 3V91A 5C4CA 4IRPA 1ON6A 4KRVA 1ZI1A 5JQQA 4NAIA 1G23A 1HM9A 2RJ9A 4FCEA 3I0IX 4FRQA 2YQJA 2FY7A 2Y4MA 3QVBA 1G9RA 1R7VA 1FOAA 4ASJA 2D7RA 1GA8A 1G97A 1ZCYA 1FXOA 4P02A 1LZIA 3K8DA 3PKPA 5C48A 3OH0A 1ZCUA 3CKQA 5FU8A 5CQNX 2Z87A 3D5NA 3IOIA 2OI5A 1S4NA 4GBPA 4ZDQA 2D0JA 3R3IA 3V0LA 1G8OA 4LW3A 1HM0A 4LW6A 2Y4KA 3GUEA 2X60A 1OQMB 3USRA 3OGZA 2QH5A 3HL3A 2QGIA 3Q7UA 2VD4A 3U2XA 4AYJA 5DDVA 5CMJA 2O1GA 1IINA 2RIZA 4FROA 4Y7VA 4B42A 1EZIA 1HV9A 2O1HA 1GX4A 4EE3A 1FR9A 1H7TA 1PZYB 3I0GA 2FYAA 2X65A 1E5KA 1TVYA 3V90A 1VGZA 3E25A 4R7PA 3ZLKA 1QGQA 2X5ZA 3RMVA 2UX8A 2RJ6A 4FQWA 4G3SA 1ZCVA 3RMWA 5CQMX 3JUKA 4EVWA 5CQPA 3RSBA 2WVMA 4KQLA 4MNDA 2APCA 2AECA 4FRHA 3T7MA 2W0VA 1FZWA 2E8BA 4HOCA 2AE7A 3T7NA 1WT3A 1JV1A 1ZJ0A 1H5RB 3I0DA 4KPXA 2ICXA 4DE7A 1ZI3A 4AYLA 2GGQA 2AGDA 3U2WA 1WVCA 1H7HA 1GWVA 1R7TA 1VZUA 3DUVA 1ON8A 5C47A 4Y62A 1G1LA 3CKOA 4FRMA 2RJ8A 3V0NA 1JV3A 4B3UA 2WAWA 1G93A 4HO3A 4B4BA 4NAKA 3DK5A 4L41C 5C1LA 1I52A 1FGGA 2P72A 5C36A 4B2XA 4ECMA 4HO4A 5CQOA 4CJBA 4G3PA 4HO5A 1XZ6A 2JCKA 3BRKX 5DDTA 2PGVA 1G0RA 2P73A 4D0TA 1VPAA 1H4DA 3OC9A 1JYLA 1OMZA 1ZI4A 5FTVA 1TW5A 5C4DA 1H5SD 3SPTA 3SXBA 2RJ4A 1NMMB 2PX7A 4BQHA 4Y7UA 1LL2A 1IIMA 5J49A 5C49A 4DECA 1GQCA 2AM3A 1NWGB 3OAMA 4B2WA 1S4OA 5C8RA 3Q80A 1GWWA 2FFUA 2XWLA 2Q4JA 3O3PA 1FO8A 2FYBA 3ZGGA 4M2BA 4EEOA 1FXJA 1V82A 3JTJA 3DJ4A 3D8VA 2ICYA 4JD0A 2RJ0A 4M28A 4KC4A 1TW1A 1NQIB 3V0OA 2JCOA 2Y4JA 1H7QA 5FTSA 4CJ8A 4K6RA 2XWNA 3SXDA 3OH2A 3FOQA 1LVWA 1O7OA 2YESA 1VH1A 1WT0A 4EEMA 3I0LA 2WE9A 4ARWA 3PKQA 4P00A 1ZDGA 3CKVA 2AM4A 2BO8A 4ASYA 5C3BA 1SS9A 2OEFA 4M4KA 1JYKA 2PGYA 1R7UA 1H7LA 2RJ1A 1G3LA 1YP4A 4Y6UA 3OH4A 2OI6A 3BCVA 3OKRA 2E3DA 1VGUA 3CKNA 1FRWA 1EYRA 1VZXA 4B4GA 1OMXA 1FWYA 2A8WA 2VSIA 4FRBA 5IFYA 2I7BA 2GGOA 1O23B 2ZU9A 1H7GA 1ZJ3A 3Q4SA 3SX3A 4KNXA 4NANA 1NHEB 5HS2A 1ZI5A 2YCMA 2V0KA 2W0WA 5BXCA 1K4VA 4C2SA 2YQHA 2RIXA 1FGXA 2PA4A 3POLA 4FRDA 1YP3A 2VXLA 2RJ7A 3I0EA 3I0JA 4FRLA 4XWIA 1HM8A 3ZLLA 3V0PA 5C3AA 1FO9A 2FYCB 3CGXA 1R81A 1R82A 3KIAA 5FUHA 2RITA 2JCLA 2I5EA 1G95A 1MP4A 4Y7TA 3OH1A 1H5SC 3K8EA 3OH3A 1MP5A 4D11A 4HO8A 5C3DA 1O7QA 1YP2A 2Y6PA 2WGZA 5CQLX 1O0RA 1INJA 2BO7A 2FFVA 2VSHA 1MP3A 4KPZA 2QKXA 3SXEA 4KNRA 2AM5A 2D7IA 4YS8A 2Z86A 2JCJA 2CU2A 3V0MA 4HO0A 3I0KA 1Z90A 2WEEA 4HG6A 5AJNA 1FG5N 3NGWA 4FRAA 4Y63A 3U2UA 1H5TB 2AH9A 3U2VA 1LZ0A 3F1YA 1H7FA 1FR8A 2V0LA 1ZJ1A 4Y9XA 1H7EA 1QG8A 1GQ9A 1H5RA 5IDSA 1GX0A 4HO9A 2P6WA 4FCUA 2BO6A 3F1CA 1LL0A 1JVGA 1W55A 1NKHB 2AESA 3PNNA 1WT1A 1INIA 4EE4A 5C4EA 4MYBA 1ZDFA 1R7YA 4J18A 5L6VA 5FV9A 1H3MA 3D98A 4Y7GA 5C4BA 3CKJA 3I0HA 4DDZA 2ZU7A 5FYEA 5C38A 3V0QA 1VM8A 4D0ZA 1H4CA 1S4PA 1VICA 5AJPA 2Y7AA 3SXAA 2MZBA 2ZU8A 3JUJA 1LZ7A 4CJCA 1JVDA 1LZJA 3SXGA 1MC3A 1H5SB 1VGWA 2XMHA 3USQA 4EE5A 4Y64A 4AC3A 4NALA 1KWSA 3ZF8A 3TZTA 1G2VA 2VFZA 1R7XA 4HO6A 1H5TA 3FWWA 3V8ZA 3SX8A 2YC3A 4G87A 3LW6A 5L6SA 3SX5A 4BMAA 1ZCTA 5I1FA 1H4EA 1V83A 2XWMA 1W77A 3U2TA 4HO2A 2WVLA 1ZJOA 5IDTA 4B5BA 3I0FA 1WSZA 2X5SA 1VZTA 5C1HA 2V0JA 3U0XA 2NXVA 2V0HA 3N9WA 2RIYA 5CMFX 3ZGFA 3ST8A 1ZHJA 1NF5B 1QGSA 5CMIA 3SX7A 4IRQA 2XMEA 1ZIZA 4D48A 3TQDA 2OI7A 1QWJA 4JISA 3CU0A 5EJ1A 5FU0A 4KT7A
chains in the Genus database with same CATH superfamily
1ZJPA 1V84A 4CVHA 2I5KA 3IOHA 1H5SA 5CMGX 1LL3A 3V8YA 4KXOA 1W57A 2VS3A 2DPWA 3U0YA 1ZJ2A 3I0CA 2YQSA 4UEGA 5AJOA 2VS5A 4B4MA 4FREA 4EEGA 2V0IA 2YQCA 4EEAA 2Y4LA 1WT2A 3E26A 1YROB 2OEGA 2FYDB 3SXCA 5EIYA 1VGTA 5C1GA 3R2WA 5EJZA 5C4FA 4G3QA 1PZTA 4AAWA 4FRPA 3EE5A 2WVKA 2VS4A 1HJLA 2VXMA 4Y7FA 4Y6NA 2J0BA 3IOJA 4M2AA 2RJ5A 1HJJA 1R80A 2BO4A 4HCQA 2A8UA 1TZFA 1XHBA 1VH3A 4E1KA 2YC5A 2O1FA 4D11C 4KC2A 3T7OA 5CMHA 4KC1A 3V91A 5C4CA 4IRPA 1ON6A 4KRVA 1ZI1A 5JQQA 4NAIA 1G23A 1HM9A 2RJ9A 4FCEA 3I0IX 4FRQA 2YQJA 2FY7A 2Y4MA 3QVBA 1G9RA 1R7VA 1FOAA 4ASJA 2D7RA 1GA8A 1G97A 1ZCYA 1FXOA 4P02A 1LZIA 3K8DA 3PKPA 5C48A 3OH0A 1ZCUA 3CKQA 4O6MA 5FU8A 5CQNX 2Z87A 3D5NA 3IOIA 2OI5A 1S4NA 4GBPA 4ZDQA 2D0JA 3R3IA 3V0LA 1G8OA 4LW3A 1HM0A 4LW6A 2Y4KA 3GUEA 2X60A 1OQMB 3USRA 3OGZA 2QH5A 3HL3A 2QGIA 3Q7UA 2VD4A 3U2XA 4AYJA 5DDVA 5CMJA 2O1GA 1IINA 2RIZA 4FROA 4Y7VA 4B42A 1EZIA 1HV9A 2O1HA 1GX4A 4EE3A 1FR9A 1H7TA 1PZYB 3I0GA 2FYAA 2X65A 1E5KA 1TVYA 3V90A 1VGZA 3E25A 4R7PA 3ZLKA 1QGQA 2X5ZA 3RMVA 2UX8A 2RJ6A 4FQWA 4G3SA 1ZCVA 3RMWA 5CQMX 3JUKA 4EVWA 5CQPA 3RSBA 2WVMA 4KQLA 4MNDA 2APCA 2AECA 4FRHA 3T7MA 2W0VA 1FZWA 2E8BA 4HOCA 2AE7A 3T7NA 1WT3A 1JV1A 1ZJ0A 1H5RB 3I0DA 4KPXA 2ICXA 4DE7A 1ZI3A 4AYLA 2GGQA 2AGDA 3U2WA 1WVCA 1H7HA 1GWVA 1R7TA 1VZUA 3DUVA 4O6NA 1ON8A 5C47A 4Y62A 1G1LA 3CKOA 4FRMA 2RJ8A 3V0NA 1JV3A 4B3UA 2WAWA 1G93A 4HO3A 4B4BA 4NAKA 3DK5A 4L41C 5C1LA 1I52A 1FGGA 2P72A 5C36A 4B2XA 5D92A 4HO4A 5CQOA 4ECMA 4CJBA 4G3PA 4HO5A 1XZ6A 2JCKA 3BRKX 5DDTA 2PGVA 1G0RA 2P73A 4D0TA 1VPAA 1H4DA 3OC9A 1JYLA 1OMZA 1ZI4A 5FTVA 1TW5A 5C4DA 1H5SD 3SPTA 3SXBA 2RJ4A 1NMMB 2PX7A 4BQHA 4Y7UA 1LL2A 1IIMA 5J49A 5C49A 4DECA 1GQCA 2AM3A 1NWGB 3OAMA 4B2WA 1S4OA 5C8RA 3Q80A 1GWWA 2FFUA 2XWLA 2Q4JA 3O3PA 1FO8A 2FYBA 3ZGGA 4M2BA 4EEOA 1FXJA 1V82A 4MIXA 3JTJA 3DJ4A 3D8VA 2ICYA 4JD0A 2RJ0A 4M28A 4KC4A 1TW1A 1NQIB 3V0OA 2JCOA 2Y4JA 1H7QA 5FTSA 4CJ8A 4K6RA 2XWNA 3SXDA 3OH2A 3FOQA 1LVWA 2VK9A 1O7OA 2YESA 1VH1A 1WT0A 4EEMA 3I0LA 2WE9A 4ARWA 3PKQA 4P00A 1ZDGA 3CKVA 2AM4A 2BO8A 4ASYA 5C3BA 1SS9A 2OEFA 4M4KA 1JYKA 2PGYA 1R7UA 1H7LA 2RJ1A 1G3LA 4FIYA 1YP4A 4Y6UA 3OH4A 2OI6A 3BCVA 3OKRA 2E3DA 1VGUA 3CKNA 1FRWA 1EYRA 1VZXA 4B4GA 1OMXA 1FWYA 2A8WA 2VSIA 4FRBA 5IFYA 2I7BA 2GGOA 2C0NA 1O23B 2ZU9A 4FIXA 1H7GA 1ZJ3A 3Q4SA 3SX3A 4KNXA 4NANA 1NHEB 5HS2A 1ZI5A 2YCMA 2V0KA 2W0WA 5BXCA 1K4VA 4C2SA 2YQHA 2RIXA 1FGXA 2PA4A 3POLA 4FRDA 1YP3A 2VXLA 2RJ7A 3I0EA 3I0JA 4FRLA 4XWIA 1HM8A 3ZLLA 3V0PA 5C3AA 1FO9A 2FYCB 3CGXA 1R81A 1R82A 3KIAA 5FUHA 2RITA 2JCLA 2I5EA 1G95A 1MP4A 4Y7TA 3OH1A 1H5SC 3K8EA 3OH3A 1MP5A 4D11A 4HO8A 5C3DA 1O7QA 1YP2A 2Y6PA 2WGZA 5CQLX 1O0RA 1INJA 2BO7A 2FFVA 2VSHA 1MP3A 4KPZA 2QKXA 3SXEA 4KNRA 2AM5A 2D7IA 4YS8A 2Z86A 2JCJA 2CU2A 3V0MA 4Q7CA 4HO0A 3I0KA 1Z90A 2WEEA 4HG6A 5AJNA 1FG5N 3NGWA 4FRAA 4Y63A 3U2UA 1H5TB 2AH9A 3U2VA 1LZ0A 3F1YA 1H7FA 5D91A 1FR8A 2V0LA 1ZJ1A 4Y9XA 1H7EA 1QG8A 1GQ9A 1H5RA 5IDSA 1GX0A 4HO9A 2P6WA 4FCUA 2BO6A 3F1CA 1LL0A 1JVGA 1W55A 1NKHB 2AESA 3PNNA 1WT1A 1INIA 4EE4A 5C4EA 4MYBA 1ZDFA 1R7YA 4J18A 5L6VA 5FV9A 1H3MA 3D98A 4Y7GA 5C4BA 3CKJA 3I0HA 4DDZA 2ZU7A 5FYEA 5C38A 3V0QA 1VM8A 4D0ZA 1H4CA 1S4PA 1VICA 5AJPA 2Y7AA 3SXAA 2MZBA 2ZU8A 3JUJA 1LZ7A 4CJCA 1JVDA 1LZJA 3SXGA 1MC3A 1H5SB 1VGWA 2XMHA 3USQA 4EE5A 4Y64A 4AC3A 4NALA 1KWSA 3ZF8A 3TZTA 1G2VA 2VFZA 1R7XA 4HO6A 1H5TA 2J0AA 3FWWA 3V8ZA 3SX8A 2YC3A 4G87A 3LW6A 5L6SA 3SX5A 4BMAA 1ZCTA 5I1FA 1H4EA 1V83A 2XWMA 1W77A 3U2TA 4HO2A 2WVLA 1ZJOA 5IDTA 4B5BA 3I0FA 1WSZA 2X5SA 1VZTA 5C1HA 2V0JA 3U0XA 2NXVA 2V0HA 3N9WA 2RIYA 5CMFX 3ZGFA 3ST8A 1ZHJA 1NF5B 1QGSA 5CMIA 3SX7A 4IRQA 2XMEA 1ZIZA 4D48A 3TQDA 2OI7A 1QWJA 4JISA 3CU0A 5EJ1A 5FU0A 4KT7A
chains in the Genus database with same CATH topology
1ZJPA 1V84A 4CVHA 2I5KA 3IOHA 1H5SA 5CMGX 1LL3A 3V8YA 4KXOA 1W57A 2VS3A 2DPWA 3U0YA 1ZJ2A 3I0CA 2YQSA 4UEGA 5AJOA 2VS5A 4B4MA 4FREA 4EEGA 2V0IA 2YQCA 4EEAA 2Y4LA 1WT2A 3E26A 1YROB 2OEGA 2FYDB 3SXCA 5EIYA 1VGTA 5C1GA 3R2WA 5EJZA 5C4FA 4G3QA 1PZTA 4AAWA 4FRPA 3EE5A 2WVKA 2VS4A 1HJLA 2VXMA 4Y7FA 4Y6NA 2J0BA 3IOJA 4M2AA 2RJ5A 1HJJA 1R80A 2BO4A 4HCQA 2A8UA 1TZFA 1XHBA 1VH3A 4E1KA 2YC5A 2O1FA 4D11C 4KC2A 3T7OA 5CMHA 4KC1A 3V91A 5C4CA 4IRPA 1ON6A 4KRVA 1ZI1A 5JQQA 4NAIA 1G23A 1HM9A 2RJ9A 4FCEA 3I0IX 4FRQA 2YQJA 2FY7A 2Y4MA 3QVBA 1G9RA 1R7VA 1FOAA 4ASJA 2D7RA 1GA8A 1G97A 1ZCYA 1FXOA 4P02A 1LZIA 3K8DA 3PKPA 5C48A 3OH0A 1ZCUA 3CKQA 4O6MA 5FU8A 5CQNX 2Z87A 3D5NA 3IOIA 2OI5A 1S4NA 4GBPA 4ZDQA 2D0JA 3R3IA 3V0LA 1G8OA 4LW3A 1HM0A 4LW6A 2Y4KA 3GUEA 2X60A 1OQMB 3USRA 3OGZA 2QH5A 3HL3A 2QGIA 3Q7UA 2VD4A 3U2XA 4AYJA 5DDVA 5CMJA 2O1GA 1IINA 2RIZA 4FROA 4Y7VA 4B42A 1EZIA 1HV9A 2O1HA 1GX4A 4EE3A 1FR9A 1H7TA 1PZYB 3I0GA 2FYAA 2X65A 1E5KA 1TVYA 3V90A 1VGZA 3E25A 4R7PA 3ZLKA 1QGQA 2X5ZA 3RMVA 2UX8A 2RJ6A 4FQWA 4G3SA 1ZCVA 3RMWA 5CQMX 3JUKA 4EVWA 5CQPA 3RSBA 2WVMA 4KQLA 4MNDA 2APCA 2AECA 4FRHA 3T7MA 2W0VA 1FZWA 2E8BA 4HOCA 2AE7A 3T7NA 1WT3A 1JV1A 1ZJ0A 1H5RB 3I0DA 4KPXA 2ICXA 4DE7A 1ZI3A 4AYLA 2GGQA 2AGDA 3U2WA 1WVCA 1H7HA 1GWVA 1R7TA 1VZUA 3DUVA 4O6NA 1ON8A 5C47A 4Y62A 1G1LA 3CKOA 4FRMA 2RJ8A 3V0NA 1JV3A 4B3UA 2WAWA 1G93A 4HO3A 4B4BA 4NAKA 3DK5A 4L41C 5C1LA 1I52A 1FGGA 2P72A 5C36A 4B2XA 5D92A 4HO4A 5CQOA 4ECMA 4CJBA 4G3PA 4HO5A 1XZ6A 2JCKA 3BRKX 5DDTA 2PGVA 1G0RA 2P73A 4D0TA 1VPAA 1H4DA 3OC9A 1JYLA 1OMZA 1ZI4A 5FTVA 1TW5A 5C4DA 1H5SD 3SPTA 3SXBA 2RJ4A 1NMMB 2PX7A 4BQHA 4Y7UA 1LL2A 1IIMA 5J49A 5C49A 4DECA 1GQCA 2AM3A 1NWGB 3OAMA 4B2WA 1S4OA 5C8RA 3Q80A 1GWWA 2FFUA 2XWLA 2Q4JA 3O3PA 1FO8A 2FYBA 3ZGGA 4M2BA 4EEOA 1FXJA 1V82A 4MIXA 3JTJA 3DJ4A 3D8VA 2ICYA 4JD0A 2RJ0A 4M28A 4KC4A 1TW1A 1NQIB 3V0OA 2JCOA 2Y4JA 1H7QA 5FTSA 4CJ8A 4K6RA 2XWNA 3SXDA 3OH2A 3FOQA 1LVWA 2VK9A 1O7OA 2YESA 1VH1A 1WT0A 4EEMA 3I0LA 2WE9A 4ARWA 3PKQA 4P00A 1ZDGA 3CKVA 2AM4A 2BO8A 4ASYA 5C3BA 1SS9A 2OEFA 4M4KA 1JYKA 2PGYA 1R7UA 1H7LA 2RJ1A 1G3LA 4FIYA 1YP4A 4Y6UA 3OH4A 2OI6A 3BCVA 3OKRA 2E3DA 1VGUA 3CKNA 1FRWA 1EYRA 1VZXA 4B4GA 1OMXA 1FWYA 2A8WA 2VSIA 4FRBA 5IFYA 2I7BA 2GGOA 2C0NA 1O23B 2ZU9A 4FIXA 1H7GA 1ZJ3A 3Q4SA 3SX3A 4KNXA 4NANA 1NHEB 5HS2A 1ZI5A 2YCMA 2V0KA 2W0WA 5BXCA 1K4VA 4C2SA 2YQHA 2RIXA 1FGXA 2PA4A 3POLA 4FRDA 1YP3A 2VXLA 2RJ7A 3I0EA 3I0JA 4FRLA 4XWIA 1HM8A 3ZLLA 3V0PA 5C3AA 1FO9A 2FYCB 3CGXA 1R81A 1R82A 3KIAA 5FUHA 2RITA 2JCLA 2I5EA 1G95A 1MP4A 4Y7TA 3OH1A 1H5SC 3K8EA 3OH3A 1MP5A 4D11A 4HO8A 5C3DA 1O7QA 1YP2A 2Y6PA 2WGZA 5CQLX 1O0RA 1INJA 2BO7A 2FFVA 2VSHA 1MP3A 4KPZA 2QKXA 3SXEA 4KNRA 2AM5A 2D7IA 4YS8A 2Z86A 2JCJA 2CU2A 3V0MA 4Q7CA 4HO0A 3I0KA 1Z90A 2WEEA 4HG6A 5AJNA 1FG5N 3NGWA 4FRAA 4Y63A 3U2UA 1H5TB 2AH9A 3U2VA 1LZ0A 3F1YA 1H7FA 5D91A 1FR8A 2V0LA 1ZJ1A 4Y9XA 1H7EA 1QG8A 1GQ9A 1H5RA 5IDSA 1GX0A 4HO9A 2P6WA 4FCUA 2BO6A 3F1CA 1LL0A 1JVGA 1W55A 1NKHB 2AESA 3PNNA 1WT1A 1INIA 4EE4A 5C4EA 4MYBA 1ZDFA 1R7YA 4J18A 5L6VA 5FV9A 1H3MA 3D98A 4Y7GA 5C4BA 3CKJA 3I0HA 4DDZA 2ZU7A 5FYEA 5C38A 3V0QA 1VM8A 4D0ZA 1H4CA 1S4PA 1VICA 5AJPA 2Y7AA 3SXAA 2MZBA 2ZU8A 3JUJA 1LZ7A 4CJCA 1JVDA 1LZJA 3SXGA 1MC3A 1H5SB 1VGWA 2XMHA 3USQA 4EE5A 4Y64A 4AC3A 4NALA 1KWSA 3ZF8A 3TZTA 1G2VA 2VFZA 1R7XA 4HO6A 1H5TA 2J0AA 3FWWA 3V8ZA 3SX8A 2YC3A 4G87A 3LW6A 5L6SA 3SX5A 4BMAA 1ZCTA 5I1FA 1H4EA 1V83A 2XWMA 1W77A 3U2TA 4HO2A 2WVLA 1ZJOA 5IDTA 4B5BA 3I0FA 1WSZA 2X5SA 1VZTA 5C1HA 2V0JA 3U0XA 2NXVA 2V0HA 3N9WA 2RIYA 5CMFX 3ZGFA 3ST8A 1ZHJA 1NF5B 1QGSA 5CMIA 3SX7A 4IRQA 2XMEA 1ZIZA 4D48A 3TQDA 2OI7A 1QWJA 4JISA 3CU0A 5EJ1A 5FU0A 4KT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZJP A;  1V84 A;  4CVH A;  2I5K A;  3IOH A;  1H5S A;  5CMG X;  1LL3 A;  3V8Y A;  4KXO A;  1W57 A;  2VS3 A;  2DPW A;  3U0Y A;  1ZJ2 A;  3I0C A;  2YQS A;  4UEG A;  5AJO A;  2VS5 A;  4B4M A;  4FRE A;  4EEG A;  2V0I A;  2YQC A;  4EEA A;  2Y4L A;  1WT2 A;  3E26 A;  1YRO B;  2OEG A;  2FYD B;  3SXC A;  5EIY A;  1VGT A;  5C1G A;  3R2W A;  5EJZ A;  5C4F A;  4G3Q A;  1PZT A;  4AAW A;  4FRP A;  3EE5 A;  2WVK A;  2VS4 A;  1HJL A;  2VXM A;  4Y7F A;  4Y6N A;  3IOJ A;  4M2A A;  2RJ5 A;  1HJJ A;  1R80 A;  2BO4 A;  4HCQ A;  2A8U A;  1TZF A;  1XHB A;  1VH3 A;  4E1K A;  2YC5 A;  2O1F A;  4D11 C;  4KC2 A;  3T7O A;  5CMH A;  4KC1 A;  3V91 A;  5C4C A;  4IRP A;  1ON6 A;  4KRV A;  1ZI1 A;  5JQQ A;  4NAI A;  1G23 A;  1HM9 A;  2RJ9 A;  4FCE A;  3I0I X;  4FRQ A;  2YQJ A;  2FY7 A;  2Y4M A;  3QVB A;  1G9R A;  1R7V A;  1FOA A;  4ASJ A;  2D7R A;  1GA8 A;  1G97 A;  1ZCY A;  1FXO A;  4P02 A;  1LZI A;  3K8D A;  3PKP A;  5C48 A;  3OH0 A;  1ZCU A;  3CKQ A;  5FU8 A;  5CQN X;  2Z87 A;  3D5N A;  3IOI A;  2OI5 A;  1S4N A;  4GBP A;  4ZDQ A;  2D0J A;  3R3I A;  3V0L A;  1G8O A;  4LW3 A;  1HM0 A;  4LW6 A;  2Y4K A;  3GUE A;  2X60 A;  1OQM B;  3USR A;  3OGZ A;  2QH5 A;  3HL3 A;  2QGI A;  3Q7U A;  2VD4 A;  3U2X A;  4AYJ A;  5DDV A;  5CMJ A;  2O1G A;  1IIN A;  2RIZ A;  4FRO A;  4Y7V A;  4B42 A;  1EZI A;  1HV9 A;  2O1H A;  1GX4 A;  4EE3 A;  1FR9 A;  1H7T A;  1PZY B;  3I0G A;  2FYA A;  2X65 A;  1E5K A;  1TVY A;  3V90 A;  1VGZ A;  3E25 A;  4R7P A;  3ZLK A;  1QGQ A;  2X5Z A;  3RMV A;  2UX8 A;  2RJ6 A;  4FQW A;  4G3S A;  1ZCV A;  3RMW A;  5CQM X;  3JUK A;  4EVW A;  5CQP A;  3RSB A;  2WVM A;  4KQL A;  4MND A;  2APC A;  2AEC A;  4FRH A;  3T7M A;  2W0V A;  1FZW A;  2E8B A;  4HOC A;  2AE7 A;  3T7N A;  1WT3 A;  1JV1 A;  1ZJ0 A;  1H5R B;  3I0D A;  4KPX A;  2ICX A;  4DE7 A;  1ZI3 A;  4AYL A;  2GGQ A;  2AGD A;  3U2W A;  1WVC A;  1H7H A;  1GWV A;  1R7T A;  1VZU A;  3DUV A;  1ON8 A;  5C47 A;  4Y62 A;  1G1L A;  3CKO A;  4FRM A;  2RJ8 A;  3V0N A;  1JV3 A;  4B3U A;  2WAW A;  1G93 A;  4HO3 A;  4B4B A;  4NAK A;  3DK5 A;  4L41 C;  5C1L A;  1I52 A;  1FGG A;  2P72 A;  5C36 A;  4B2X A;  4ECM A;  4HO4 A;  5CQO A;  4CJB A;  4G3P A;  4HO5 A;  1XZ6 A;  2JCK A;  3BRK X;  5DDT A;  2PGV A;  1G0R A;  2P73 A;  4D0T A;  1VPA A;  1H4D A;  3OC9 A;  1JYL A;  1OMZ A;  1ZI4 A;  5FTV A;  1TW5 A;  5C4D A;  1H5S D;  3SPT A;  3SXB A;  2RJ4 A;  1NMM B;  2PX7 A;  4BQH A;  4Y7U A;  1LL2 A;  1IIM A;  5J49 A;  5C49 A;  4DEC A;  1GQC A;  2AM3 A;  1NWG B;  3OAM A;  4B2W A;  1S4O A;  5C8R A;  3Q80 A;  1GWW A;  2FFU A;  2XWL A;  2Q4J A;  3O3P A;  1FO8 A;  2FYB A;  3ZGG A;  4M2B A;  4EEO A;  1FXJ A;  1V82 A;  3JTJ A;  3DJ4 A;  3D8V A;  2ICY A;  4JD0 A;  2RJ0 A;  4M28 A;  4KC4 A;  1TW1 A;  1NQI B;  3V0O A;  2JCO A;  2Y4J A;  1H7Q A;  5FTS A;  4CJ8 A;  4K6R A;  2XWN A;  3SXD A;  3OH2 A;  3FOQ A;  1LVW A;  1O7O A;  2YES A;  1VH1 A;  1WT0 A;  4EEM A;  3I0L A;  2WE9 A;  4ARW A;  3PKQ A;  4P00 A;  1ZDG A;  3CKV A;  2AM4 A;  2BO8 A;  4ASY A;  5C3B A;  1SS9 A;  2OEF A;  4M4K A;  1JYK A;  2PGY A;  1R7U A;  1H7L A;  2RJ1 A;  1G3L A;  1YP4 A;  4Y6U A;  3OH4 A;  2OI6 A;  3BCV A;  3OKR A;  2E3D A;  1VGU A;  3CKN A;  1FRW A;  1EYR A;  1VZX A;  4B4G A;  1OMX A;  1FWY A;  2A8W A;  2VSI A;  4FRB A;  5IFY A;  2I7B A;  2GGO A;  1O23 B;  2ZU9 A;  1H7G A;  1ZJ3 A;  3Q4S A;  3SX3 A;  4KNX A;  4NAN A;  1NHE B;  5HS2 A;  1ZI5 A;  2YCM A;  2V0K A;  2W0W A;  5BXC A;  1K4V A;  4C2S A;  2YQH A;  2RIX A;  1FGX A;  2PA4 A;  3POL A;  4FRD A;  1YP3 A;  2VXL A;  2RJ7 A;  3I0E A;  3I0J A;  4FRL A;  4XWI A;  1HM8 A;  3ZLL A;  3V0P A;  5C3A A;  1FO9 A;  2FYC B;  3CGX A;  1R81 A;  1R82 A;  3KIA A;  5FUH A;  2RIT A;  2JCL A;  2I5E A;  1G95 A;  1MP4 A;  4Y7T A;  3OH1 A;  1H5S C;  3K8E A;  3OH3 A;  1MP5 A;  4D11 A;  4HO8 A;  5C3D A;  1O7Q A;  1YP2 A;  2Y6P A;  2WGZ A;  5CQL X;  1O0R A;  1INJ A;  2BO7 A;  2FFV A;  2VSH A;  1MP3 A;  4KPZ A;  2QKX A;  3SXE A;  4KNR A;  2AM5 A;  2D7I A;  4YS8 A;  2Z86 A;  2JCJ A;  2CU2 A;  3V0M A;  4HO0 A;  3I0K A;  1Z90 A;  2WEE A;  4HG6 A;  5AJN A;  1FG5 N;  3NGW A;  4FRA A;  4Y63 A;  3U2U A;  1H5T B;  2AH9 A;  3U2V A;  1LZ0 A;  3F1Y A;  1H7F A;  1FR8 A;  2V0L A;  1ZJ1 A;  4Y9X A;  1H7E A;  1QG8 A;  1GQ9 A;  1H5R A;  5IDS A;  1GX0 A;  4HO9 A;  2P6W A;  4FCU A;  2BO6 A;  3F1C A;  1LL0 A;  1JVG A;  1W55 A;  1NKH B;  2AES A;  3PNN A;  1WT1 A;  1INI A;  4EE4 A;  5C4E A;  4MYB A;  1ZDF A;  1R7Y A;  4J18 A;  5L6V A;  5FV9 A;  1H3M A;  3D98 A;  4Y7G A;  5C4B A;  3CKJ A;  3I0H A;  4DDZ A;  2ZU7 A;  5FYE A;  5C38 A;  3V0Q A;  1VM8 A;  4D0Z A;  1H4C A;  1S4P A;  1VIC A;  5AJP A;  2Y7A A;  3SXA A;  2MZB A;  2ZU8 A;  3JUJ A;  1LZ7 A;  4CJC A;  1JVD A;  1LZJ A;  3SXG A;  1MC3 A;  1H5S B;  1VGW A;  2XMH A;  3USQ A;  4EE5 A;  4Y64 A;  4AC3 A;  4NAL A;  1KWS A;  3ZF8 A;  3TZT A;  1G2V A;  2VFZ A;  1R7X A;  4HO6 A;  1H5T A;  3FWW A;  3V8Z A;  3SX8 A;  2YC3 A;  4G87 A;  3LW6 A;  5L6S A;  3SX5 A;  4BMA A;  1ZCT A;  5I1F A;  1H4E A;  1V83 A;  2XWM A;  1W77 A;  3U2T A;  4HO2 A;  2WVL A;  1ZJO A;  5IDT A;  4B5B A;  3I0F A;  1WSZ A;  2X5S A;  1VZT A;  5C1H A;  2V0J A;  3U0X A;  2NXV A;  2V0H A;  3N9W A;  2RIY A;  5CMF X;  3ZGF A;  3ST8 A;  1ZHJ A;  1NF5 B;  1QGS A;  5CMI A;  3SX7 A;  4IRQ A;  2XME A;  1ZIZ A;  4D48 A;  3TQD A;  2OI7 A;  1QWJ A;  4JIS A;  3CU0 A;  5EJ1 A;  5FU0 A;  4KT7 A; 
#chains in the Genus database with same CATH topology
 1ZJP A;  1V84 A;  4CVH A;  2I5K A;  3IOH A;  1H5S A;  5CMG X;  1LL3 A;  3V8Y A;  4KXO A;  1W57 A;  2VS3 A;  2DPW A;  3U0Y A;  1ZJ2 A;  3I0C A;  2YQS A;  4UEG A;  5AJO A;  2VS5 A;  4B4M A;  4FRE A;  4EEG A;  2V0I A;  2YQC A;  4EEA A;  2Y4L A;  1WT2 A;  3E26 A;  1YRO B;  2OEG A;  2FYD B;  3SXC A;  5EIY A;  1VGT A;  5C1G A;  3R2W A;  5EJZ A;  5C4F A;  4G3Q A;  1PZT A;  4AAW A;  4FRP A;  3EE5 A;  2WVK A;  2VS4 A;  1HJL A;  2VXM A;  4Y7F A;  4Y6N A;  2J0B A;  3IOJ A;  4M2A A;  2RJ5 A;  1HJJ A;  1R80 A;  2BO4 A;  4HCQ A;  2A8U A;  1TZF A;  1XHB A;  1VH3 A;  4E1K A;  2YC5 A;  2O1F A;  4D11 C;  4KC2 A;  3T7O A;  5CMH A;  4KC1 A;  3V91 A;  5C4C A;  4IRP A;  1ON6 A;  4KRV A;  1ZI1 A;  5JQQ A;  4NAI A;  1G23 A;  1HM9 A;  2RJ9 A;  4FCE A;  3I0I X;  4FRQ A;  2YQJ A;  2FY7 A;  2Y4M A;  3QVB A;  1G9R A;  1R7V A;  1FOA A;  4ASJ A;  2D7R A;  1GA8 A;  1G97 A;  1ZCY A;  1FXO A;  4P02 A;  1LZI A;  3K8D A;  3PKP A;  5C48 A;  3OH0 A;  1ZCU A;  3CKQ A;  4O6M A;  5FU8 A;  5CQN X;  2Z87 A;  3D5N A;  3IOI A;  2OI5 A;  1S4N A;  4GBP A;  4ZDQ A;  2D0J A;  3R3I A;  3V0L A;  1G8O A;  4LW3 A;  1HM0 A;  4LW6 A;  2Y4K A;  3GUE A;  2X60 A;  1OQM B;  3USR A;  3OGZ A;  2QH5 A;  3HL3 A;  2QGI A;  3Q7U A;  2VD4 A;  3U2X A;  4AYJ A;  5DDV A;  5CMJ A;  2O1G A;  1IIN A;  2RIZ A;  4FRO A;  4Y7V A;  4B42 A;  1EZI A;  1HV9 A;  2O1H A;  1GX4 A;  4EE3 A;  1FR9 A;  1H7T A;  1PZY B;  3I0G A;  2FYA A;  2X65 A;  1E5K A;  1TVY A;  3V90 A;  1VGZ A;  3E25 A;  4R7P A;  3ZLK A;  1QGQ A;  2X5Z A;  3RMV A;  2UX8 A;  2RJ6 A;  4FQW A;  4G3S A;  1ZCV A;  3RMW A;  5CQM X;  3JUK A;  4EVW A;  5CQP A;  3RSB A;  2WVM A;  4KQL A;  4MND A;  2APC A;  2AEC A;  4FRH A;  3T7M A;  2W0V A;  1FZW A;  2E8B A;  4HOC A;  2AE7 A;  3T7N A;  1WT3 A;  1JV1 A;  1ZJ0 A;  1H5R B;  3I0D A;  4KPX A;  2ICX A;  4DE7 A;  1ZI3 A;  4AYL A;  2GGQ A;  2AGD A;  3U2W A;  1WVC A;  1H7H A;  1GWV A;  1R7T A;  1VZU A;  3DUV A;  4O6N A;  1ON8 A;  5C47 A;  4Y62 A;  1G1L A;  3CKO A;  4FRM A;  2RJ8 A;  3V0N A;  1JV3 A;  4B3U A;  2WAW A;  1G93 A;  4HO3 A;  4B4B A;  4NAK A;  3DK5 A;  4L41 C;  5C1L A;  1I52 A;  1FGG A;  2P72 A;  5C36 A;  4B2X A;  5D92 A;  4HO4 A;  5CQO A;  4ECM A;  4CJB A;  4G3P A;  4HO5 A;  1XZ6 A;  2JCK A;  3BRK X;  5DDT A;  2PGV A;  1G0R A;  2P73 A;  4D0T A;  1VPA A;  1H4D A;  3OC9 A;  1JYL A;  1OMZ A;  1ZI4 A;  5FTV A;  1TW5 A;  5C4D A;  1H5S D;  3SPT A;  3SXB A;  2RJ4 A;  1NMM B;  2PX7 A;  4BQH A;  4Y7U A;  1LL2 A;  1IIM A;  5J49 A;  5C49 A;  4DEC A;  1GQC A;  2AM3 A;  1NWG B;  3OAM A;  4B2W A;  1S4O A;  5C8R A;  3Q80 A;  1GWW A;  2FFU A;  2XWL A;  2Q4J A;  3O3P A;  1FO8 A;  2FYB A;  3ZGG A;  4M2B A;  4EEO A;  1FXJ A;  1V82 A;  4MIX A;  3JTJ A;  3DJ4 A;  3D8V A;  2ICY A;  4JD0 A;  2RJ0 A;  4M28 A;  4KC4 A;  1TW1 A;  1NQI B;  3V0O A;  2JCO A;  2Y4J A;  1H7Q A;  5FTS A;  4CJ8 A;  4K6R A;  2XWN A;  3SXD A;  3OH2 A;  3FOQ A;  1LVW A;  2VK9 A;  1O7O A;  2YES A;  1VH1 A;  1WT0 A;  4EEM A;  3I0L A;  2WE9 A;  4ARW A;  3PKQ A;  4P00 A;  1ZDG A;  3CKV A;  2AM4 A;  2BO8 A;  4ASY A;  5C3B A;  1SS9 A;  2OEF A;  4M4K A;  1JYK A;  2PGY A;  1R7U A;  1H7L A;  2RJ1 A;  1G3L A;  4FIY A;  1YP4 A;  4Y6U A;  3OH4 A;  2OI6 A;  3BCV A;  3OKR A;  2E3D A;  1VGU A;  3CKN A;  1FRW A;  1EYR A;  1VZX A;  4B4G A;  1OMX A;  1FWY A;  2A8W A;  2VSI A;  4FRB A;  5IFY A;  2I7B A;  2GGO A;  2C0N A;  1O23 B;  2ZU9 A;  4FIX A;  1H7G A;  1ZJ3 A;  3Q4S A;  3SX3 A;  4KNX A;  4NAN A;  1NHE B;  5HS2 A;  1ZI5 A;  2YCM A;  2V0K A;  2W0W A;  5BXC A;  1K4V A;  4C2S A;  2YQH A;  2RIX A;  1FGX A;  2PA4 A;  3POL A;  4FRD A;  1YP3 A;  2VXL A;  2RJ7 A;  3I0E A;  3I0J A;  4FRL A;  4XWI A;  1HM8 A;  3ZLL A;  3V0P A;  5C3A A;  1FO9 A;  2FYC B;  3CGX A;  1R81 A;  1R82 A;  3KIA A;  5FUH A;  2RIT A;  2JCL A;  2I5E A;  1G95 A;  1MP4 A;  4Y7T A;  3OH1 A;  1H5S C;  3K8E A;  3OH3 A;  1MP5 A;  4D11 A;  4HO8 A;  5C3D A;  1O7Q A;  1YP2 A;  2Y6P A;  2WGZ A;  5CQL X;  1O0R A;  1INJ A;  2BO7 A;  2FFV A;  2VSH A;  1MP3 A;  4KPZ A;  2QKX A;  3SXE A;  4KNR A;  2AM5 A;  2D7I A;  4YS8 A;  2Z86 A;  2JCJ A;  2CU2 A;  3V0M A;  4Q7C A;  4HO0 A;  3I0K A;  1Z90 A;  2WEE A;  4HG6 A;  5AJN A;  1FG5 N;  3NGW A;  4FRA A;  4Y63 A;  3U2U A;  1H5T B;  2AH9 A;  3U2V A;  1LZ0 A;  3F1Y A;  1H7F A;  5D91 A;  1FR8 A;  2V0L A;  1ZJ1 A;  4Y9X A;  1H7E A;  1QG8 A;  1GQ9 A;  1H5R A;  5IDS A;  1GX0 A;  4HO9 A;  2P6W A;  4FCU A;  2BO6 A;  3F1C A;  1LL0 A;  1JVG A;  1W55 A;  1NKH B;  2AES A;  3PNN A;  1WT1 A;  1INI A;  4EE4 A;  5C4E A;  4MYB A;  1ZDF A;  1R7Y A;  4J18 A;  5L6V A;  5FV9 A;  1H3M A;  3D98 A;  4Y7G A;  5C4B A;  3CKJ A;  3I0H A;  4DDZ A;  2ZU7 A;  5FYE A;  5C38 A;  3V0Q A;  1VM8 A;  4D0Z A;  1H4C A;  1S4P A;  1VIC A;  5AJP A;  2Y7A A;  3SXA A;  2MZB A;  2ZU8 A;  3JUJ A;  1LZ7 A;  4CJC A;  1JVD A;  1LZJ A;  3SXG A;  1MC3 A;  1H5S B;  1VGW A;  2XMH A;  3USQ A;  4EE5 A;  4Y64 A;  4AC3 A;  4NAL A;  1KWS A;  3ZF8 A;  3TZT A;  1G2V A;  2VFZ A;  1R7X A;  4HO6 A;  1H5T A;  2J0A A;  3FWW A;  3V8Z A;  3SX8 A;  2YC3 A;  4G87 A;  3LW6 A;  5L6S A;  3SX5 A;  4BMA A;  1ZCT A;  5I1F A;  1H4E A;  1V83 A;  2XWM A;  1W77 A;  3U2T A;  4HO2 A;  2WVL A;  1ZJO A;  5IDT A;  4B5B A;  3I0F A;  1WSZ A;  2X5S A;  1VZT A;  5C1H A;  2V0J A;  3U0X A;  2NXV A;  2V0H A;  3N9W A;  2RIY A;  5CMF X;  3ZGF A;  3ST8 A;  1ZHJ A;  1NF5 B;  1QGS A;  5CMI A;  3SX7 A;  4IRQ A;  2XME A;  1ZIZ A;  4D48 A;  3TQD A;  2OI7 A;  1QWJ A;  4JIS A;  3CU0 A;  5EJ1 A;  5FU0 A;  4KT7 A; 
#chains in the Genus database with same CATH homology
 1ZJP A;  1V84 A;  4CVH A;  2I5K A;  3IOH A;  1H5S A;  5CMG X;  1LL3 A;  3V8Y A;  4KXO A;  1W57 A;  2VS3 A;  2DPW A;  3U0Y A;  1ZJ2 A;  3I0C A;  2YQS A;  4UEG A;  5AJO A;  2VS5 A;  4B4M A;  4FRE A;  4EEG A;  2V0I A;  2YQC A;  4EEA A;  2Y4L A;  1WT2 A;  3E26 A;  1YRO B;  2OEG A;  2FYD B;  3SXC A;  5EIY A;  1VGT A;  5C1G A;  3R2W A;  5EJZ A;  5C4F A;  4G3Q A;  1PZT A;  4AAW A;  4FRP A;  3EE5 A;  2WVK A;  2VS4 A;  1HJL A;  2VXM A;  4Y7F A;  4Y6N A;  2J0B A;  3IOJ A;  4M2A A;  2RJ5 A;  1HJJ A;  1R80 A;  2BO4 A;  4HCQ A;  2A8U A;  1TZF A;  1XHB A;  1VH3 A;  4E1K A;  2YC5 A;  2O1F A;  4D11 C;  4KC2 A;  3T7O A;  5CMH A;  4KC1 A;  3V91 A;  5C4C A;  4IRP A;  1ON6 A;  4KRV A;  1ZI1 A;  5JQQ A;  4NAI A;  1G23 A;  1HM9 A;  2RJ9 A;  4FCE A;  3I0I X;  4FRQ A;  2YQJ A;  2FY7 A;  2Y4M A;  3QVB A;  1G9R A;  1R7V A;  1FOA A;  4ASJ A;  2D7R A;  1GA8 A;  1G97 A;  1ZCY A;  1FXO A;  4P02 A;  1LZI A;  3K8D A;  3PKP A;  5C48 A;  3OH0 A;  1ZCU A;  3CKQ A;  4O6M A;  5FU8 A;  5CQN X;  2Z87 A;  3D5N A;  3IOI A;  2OI5 A;  1S4N A;  4GBP A;  4ZDQ A;  2D0J A;  3R3I A;  3V0L A;  1G8O A;  4LW3 A;  1HM0 A;  4LW6 A;  2Y4K A;  3GUE A;  2X60 A;  1OQM B;  3USR A;  3OGZ A;  2QH5 A;  3HL3 A;  2QGI A;  3Q7U A;  2VD4 A;  3U2X A;  4AYJ A;  5DDV A;  5CMJ A;  2O1G A;  1IIN A;  2RIZ A;  4FRO A;  4Y7V A;  4B42 A;  1EZI A;  1HV9 A;  2O1H A;  1GX4 A;  4EE3 A;  1FR9 A;  1H7T A;  1PZY B;  3I0G A;  2FYA A;  2X65 A;  1E5K A;  1TVY A;  3V90 A;  1VGZ A;  3E25 A;  4R7P A;  3ZLK A;  1QGQ A;  2X5Z A;  3RMV A;  2UX8 A;  2RJ6 A;  4FQW A;  4G3S A;  1ZCV A;  3RMW A;  5CQM X;  3JUK A;  4EVW A;  5CQP A;  3RSB A;  2WVM A;  4KQL A;  4MND A;  2APC A;  2AEC A;  4FRH A;  3T7M A;  2W0V A;  1FZW A;  2E8B A;  4HOC A;  2AE7 A;  3T7N A;  1WT3 A;  1JV1 A;  1ZJ0 A;  1H5R B;  3I0D A;  4KPX A;  2ICX A;  4DE7 A;  1ZI3 A;  4AYL A;  2GGQ A;  2AGD A;  3U2W A;  1WVC A;  1H7H A;  1GWV A;  1R7T A;  1VZU A;  3DUV A;  4O6N A;  1ON8 A;  5C47 A;  4Y62 A;  1G1L A;  3CKO A;  4FRM A;  2RJ8 A;  3V0N A;  1JV3 A;  4B3U A;  2WAW A;  1G93 A;  4HO3 A;  4B4B A;  4NAK A;  3DK5 A;  4L41 C;  5C1L A;  1I52 A;  1FGG A;  2P72 A;  5C36 A;  4B2X A;  5D92 A;  4HO4 A;  5CQO A;  4ECM A;  4CJB A;  4G3P A;  4HO5 A;  1XZ6 A;  2JCK A;  3BRK X;  5DDT A;  2PGV A;  1G0R A;  2P73 A;  4D0T A;  1VPA A;  1H4D A;  3OC9 A;  1JYL A;  1OMZ A;  1ZI4 A;  5FTV A;  1TW5 A;  5C4D A;  1H5S D;  3SPT A;  3SXB A;  2RJ4 A;  1NMM B;  2PX7 A;  4BQH A;  4Y7U A;  1LL2 A;  1IIM A;  5J49 A;  5C49 A;  4DEC A;  1GQC A;  2AM3 A;  1NWG B;  3OAM A;  4B2W A;  1S4O A;  5C8R A;  3Q80 A;  1GWW A;  2FFU A;  2XWL A;  2Q4J A;  3O3P A;  1FO8 A;  2FYB A;  3ZGG A;  4M2B A;  4EEO A;  1FXJ A;  1V82 A;  4MIX A;  3JTJ A;  3DJ4 A;  3D8V A;  2ICY A;  4JD0 A;  2RJ0 A;  4M28 A;  4KC4 A;  1TW1 A;  1NQI B;  3V0O A;  2JCO A;  2Y4J A;  1H7Q A;  5FTS A;  4CJ8 A;  4K6R A;  2XWN A;  3SXD A;  3OH2 A;  3FOQ A;  1LVW A;  2VK9 A;  1O7O A;  2YES A;  1VH1 A;  1WT0 A;  4EEM A;  3I0L A;  2WE9 A;  4ARW A;  3PKQ A;  4P00 A;  1ZDG A;  3CKV A;  2AM4 A;  2BO8 A;  4ASY A;  5C3B A;  1SS9 A;  2OEF A;  4M4K A;  1JYK A;  2PGY A;  1R7U A;  1H7L A;  2RJ1 A;  1G3L A;  4FIY A;  1YP4 A;  4Y6U A;  3OH4 A;  2OI6 A;  3BCV A;  3OKR A;  2E3D A;  1VGU A;  3CKN A;  1FRW A;  1EYR A;  1VZX A;  4B4G A;  1OMX A;  1FWY A;  2A8W A;  2VSI A;  4FRB A;  5IFY A;  2I7B A;  2GGO A;  2C0N A;  1O23 B;  2ZU9 A;  4FIX A;  1H7G A;  1ZJ3 A;  3Q4S A;  3SX3 A;  4KNX A;  4NAN A;  1NHE B;  5HS2 A;  1ZI5 A;  2YCM A;  2V0K A;  2W0W A;  5BXC A;  1K4V A;  4C2S A;  2YQH A;  2RIX A;  1FGX A;  2PA4 A;  3POL A;  4FRD A;  1YP3 A;  2VXL A;  2RJ7 A;  3I0E A;  3I0J A;  4FRL A;  4XWI A;  1HM8 A;  3ZLL A;  3V0P A;  5C3A A;  1FO9 A;  2FYC B;  3CGX A;  1R81 A;  1R82 A;  3KIA A;  5FUH A;  2RIT A;  2JCL A;  2I5E A;  1G95 A;  1MP4 A;  4Y7T A;  3OH1 A;  1H5S C;  3K8E A;  3OH3 A;  1MP5 A;  4D11 A;  4HO8 A;  5C3D A;  1O7Q A;  1YP2 A;  2Y6P A;  2WGZ A;  5CQL X;  1O0R A;  1INJ A;  2BO7 A;  2FFV A;  2VSH A;  1MP3 A;  4KPZ A;  2QKX A;  3SXE A;  4KNR A;  2AM5 A;  2D7I A;  4YS8 A;  2Z86 A;  2JCJ A;  2CU2 A;  3V0M A;  4Q7C A;  4HO0 A;  3I0K A;  1Z90 A;  2WEE A;  4HG6 A;  5AJN A;  1FG5 N;  3NGW A;  4FRA A;  4Y63 A;  3U2U A;  1H5T B;  2AH9 A;  3U2V A;  1LZ0 A;  3F1Y A;  1H7F A;  5D91 A;  1FR8 A;  2V0L A;  1ZJ1 A;  4Y9X A;  1H7E A;  1QG8 A;  1GQ9 A;  1H5R A;  5IDS A;  1GX0 A;  4HO9 A;  2P6W A;  4FCU A;  2BO6 A;  3F1C A;  1LL0 A;  1JVG A;  1W55 A;  1NKH B;  2AES A;  3PNN A;  1WT1 A;  1INI A;  4EE4 A;  5C4E A;  4MYB A;  1ZDF A;  1R7Y A;  4J18 A;  5L6V A;  5FV9 A;  1H3M A;  3D98 A;  4Y7G A;  5C4B A;  3CKJ A;  3I0H A;  4DDZ A;  2ZU7 A;  5FYE A;  5C38 A;  3V0Q A;  1VM8 A;  4D0Z A;  1H4C A;  1S4P A;  1VIC A;  5AJP A;  2Y7A A;  3SXA A;  2MZB A;  2ZU8 A;  3JUJ A;  1LZ7 A;  4CJC A;  1JVD A;  1LZJ A;  3SXG A;  1MC3 A;  1H5S B;  1VGW A;  2XMH A;  3USQ A;  4EE5 A;  4Y64 A;  4AC3 A;  4NAL A;  1KWS A;  3ZF8 A;  3TZT A;  1G2V A;  2VFZ A;  1R7X A;  4HO6 A;  1H5T A;  2J0A A;  3FWW A;  3V8Z A;  3SX8 A;  2YC3 A;  4G87 A;  3LW6 A;  5L6S A;  3SX5 A;  4BMA A;  1ZCT A;  5I1F A;  1H4E A;  1V83 A;  2XWM A;  1W77 A;  3U2T A;  4HO2 A;  2WVL A;  1ZJO A;  5IDT A;  4B5B A;  3I0F A;  1WSZ A;  2X5S A;  1VZT A;  5C1H A;  2V0J A;  3U0X A;  2NXV A;  2V0H A;  3N9W A;  2RIY A;  5CMF X;  3ZGF A;  3ST8 A;  1ZHJ A;  1NF5 B;  1QGS A;  5CMI A;  3SX7 A;  4IRQ A;  2XME A;  1ZIZ A;  4D48 A;  3TQD A;  2OI7 A;  1QWJ A;  4JIS A;  3CU0 A;  5EJ1 A;  5FU0 A;  4KT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...