2APCA

Crystal structure of n-acetylglucosaminyltransferase i in complex with udp-glcnac phosphonate
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
342
structure length
342
Chain Sequence
AVIPILVIACDRSTVRRCLDKLLHYRPSAELFPIIVSQDCGHEETAQVIASYGSAVTHIRQPDLSNIAVQPDHRKFQGYYKIARHYRWALGQIFHNFNYPAAVVVEDDLEVAPDFFEYFQATYPLLKADPSLWCVSAWNDNGKEQMVDSSKPELLYRTDFFPGLGWLLLAELWAELEPKWPKAFWDDWMRRPEQRKGRACVRPEISRTMTFGRKGVSHGQFFDQHLKFIKLNQQFVPFTQLDLSYLQQEAYDRDFLARVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIVTFLFRGRRVHLAPPQTWDGYDPSWT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminylt
publication title X-ray Crystal Structures of Rabbit N-acetylglucosaminyltransferase I (GnT I) in Complex with Donor Substrate Analogues.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transferase
total genus 113
structure length 342
sequence length 342
ec nomenclature ec 2.4.1.101: Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase.
pdb deposition date 2005-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.180.20 Alpha Beta Roll 2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1 N-Acetylglucosaminyltransferase I, Domain 2 2apcA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2apcA01
2XWLA 4D0ZA 2AH9A 4HO3A 1S4OA 3I0GA 1GWVA 1H5SA 3SXEA 1FR8A 1PZYB 1VH1A 1JYKA 4FRPA 5JQQA 1ZJ0A 5CQOA 3BCVA 1VGZA 3QVBA 4FREA 2AM5A 4FCEA 1ZJ2A 4B3UA 4KRVA 1NF5B 3RMVA 2V0HA 1LVWA 2AESA 2FYBA 3F1CA 3PNNA 1H4CA 4M28A 4CJBA 4KC1A 4HO0A 3I0EA 2Z87A 3F1YA 4B4MA 1EYRA 2VD4A 1GQ9A 4FRMA 3JTJA 1G2VA 1GX4A 1H5SB 1XHBA 4AAWA 1MC3A 5CQLX 4HO8A 3O3PA 2BO6A 3I0LA 1ZCVA 2Z86A 5FTVA 4DDZA 1H7LA 1FGXA 4FRAA 3U0XA 2A8WA 1G3LA 2VS5A 1SS9A 4J18A 2RJ8A 2Y4LA 2MZBA 2YCMA 1JYLA 2JCJA 2XMHA 4MYBA 1H7FA 3POLA 2VSIA 3I0IX 5C38A 3CKJA 3K8DA 3R3IA 1NHEB 1K4VA 3E25A 1TZFA 3D98A 1XZ6A 1ON8A 2VS4A 2O1HA 2DPWA 2RJ5A 1O0RA 2V0JA 4Y64A 5IFYA 1W57A 3DK5A 3SXCA 3OH4A 3JUJA 3I0HA 4C2SA 3FWWA 1FGGA 5C1GA 4ASYA 2E8BA 1FOAA 1O7QA 1ZI1A 2FFVA 3CGXA 3CU0A 1VZUA 3IOHA 3V0MA 2BO7A 5C4CA 2XMEA 3K8EA 4B2XA 5FYEA 3OH3A 4EEOA 1R7VA 1R81A 3I0JA 1TW1A 1R7YA 5C3BA 1ZIZA 4FRQA 1MP3A 2YESA 2QGIA 3CKVA 5EJ1A 4LW3A 4MNDA 3OH0A 4D11C 2V0KA 1H7TA 1G93A 4D0TA 1QG8A 3ZF8A 4JISA 1ON6A 2YC5A 2JCOA 4Y7FA 4G3SA 5C47A 4B5BA 4NALA 3U2TA 4KC2A 1VZTA 2CU2A 3SXDA 3V91A 2FYAA 1LZJA 3T7MA 1H5SD 1H3MA 4GBPA 5C1HA 2OI6A 2AE7A 3OH1A 4B2WA 3JUKA 4ECMA 5FTSA 2ZU7A 2RIXA 5IDSA 4ZDQA 2XWNA 2Q4JA 2D7IA 1IINA 4AYJA 1TVYA 1H7GA 2W0VA 1INIA 1R82A 4G3QA 5HS2A 5C4FA 1ZHJA 1NKHB 1LL3A 2YC3A 3ZLLA 2GGOA 4G87A 1YP3A 2FY7A 5BXCA 4FCUA 4Y63A 2WVMA 4Y62A 2QKXA 3V8YA 1O7OA 4HCQA 3DJ4A 3ZGFA 2AM3A 2I5KA 2OEGA 3GUEA 5AJOA 3I0DA 3DUVA 4EVWA 2WAWA 3V0QA 5C1LA 3ZGGA 1LL0A 2FFUA 1ZDFA 3OGZA 1WT0A 2VSHA 4P00A 1HV9A 1G8OA 5DDVA 1H5TA 1HM9A 2OI5A 4B4GA 3ST8A 1WT2A 3R2WA 5I1FA 2RIZA 4D48A 3N9WA 1H7HA 1YP4A 4R7PA 2X5SA 1MP5A 3TZTA 4FRBA 4L41C 4JD0A 1HM0A 2VXMA 2P6WA 1H7EA 2RJ9A 2GGQA 2PA4A 2Y6PA 3EE5A 1Z90A 1JVDA 1VICA 1WVCA 2RJ0A 3Q80A 2AGDA 2UX8A 4Y7VA 2FYCB 2WVKA 5CMIA 5FU8A 4Y7TA 5C3AA 2QH5A 4FROA 1FXJA 2ZU8A 4HO9A 3U2XA 1GQCA 1PZTA 5CMJA 1V82A 2NXVA 3I0FA 4NAIA 1FO9A 1GX0A 4Y7GA 4EEAA 3D8VA 3V0PA 2I7BA 4ASJA 2XWMA 2X5ZA 1QWJA 4AYLA 3ZLKA 4EE4A 2ZU9A 4KQLA 1VGUA 1VGWA 2ICXA 1OMZA 5C4DA 1VGTA 1LZ7A 1LL2A 2D0JA 2WEEA 2APCA 4P02A 3SX5A 4KC4A 2PGVA 2WE9A 2OEFA 1ZJ1A 1G1LA 4HOCA 1EZIA 1GWWA 2WGZA 3U2WA 2Y4JA 3RMWA 2X60A 4M2AA 2A8UA 1GA8A 3CKNA 4FQWA 2YQJA 5FUHA 1INJA 2PGYA 1LZIA 3IOJA 1E5KA 2Y7AA 3D5NA 2I5EA 5IDTA 2JCLA 3I0KA 2O1GA 4IRPA 4Y7UA 2OI7A 5EJZA 3U0YA 5CMFX 1H7QA 4DECA 4KNRA 4KPZA 1G23A 2VFZA 4CJCA 1H4EA 2V0IA 4ARWA 2RJ4A 2YQCA 4HO6A 5C49A 3V0NA 4UEGA 4E1KA 1TW5A 3HL3A 4EE5A 5CQMX 1O23B 5C48A 4FRLA 4FRDA 4Y9XA 3TQDA 2BO4A 1HJLA 3OH2A 1ZJPA 1IIMA 5CMGX 4B42A 1LZ0A 3BRKX 4EEMA 3SX3A 2YQHA 2P72A 1FR9A 1VM8A 1H5SC 1H4DA 1S4PA 3KIAA 2P73A 3SX8A 3Q4SA 1OMXA 2RIYA 1WSZA 4KXOA 1FRWA 5C4EA 1ZCUA 4KPXA 2Y4KA 1G0RA 1JVGA 1V84A 4EE3A 3PKPA 1ZDGA 2PX7A 3OKRA 1S4NA 4NANA 1H5RA 2V0LA 4BMAA 1VPAA 3U2VA 4YS8A 4LW6A 1YROB 1HJJA 2W0WA 4B4BA 2BO8A 2X65A 4M4KA 1W77A 4HO2A 5FV9A 3PKQA 2AM4A 1VZXA 4M2BA 3I0CA 5J49A 1R7TA 1OQMB 1ZI4A 1ZCTA 4Y6NA 4G3PA 2RJ6A 1H5TB 2E3DA 3NGWA 5C4BA 3CKOA 3V90A 5C8RA 3U2UA 1NWGB 1ZJ3A 1H5RB 4K6RA 3FOQA 5CQPA 4AC3A 3SXBA 1ZJOA 3Q7UA 5L6VA 4Y6UA 1JV3A 1R80A 3OAMA 2O1FA 3SXGA 4D11A 2YQSA 4BQHA 4HO4A 3OC9A 4XWIA 3T7OA 3CKQA 4KNXA 1YP2A 1ZCYA 3E26A 1QGSA 3IOIA 1KWSA 1QGQA 2FYDB 1V83A 2JCKA 1FO8A 1FZWA 1VH3A 2WVLA 4HG6A 1JV1A 3LW6A 4NAKA 2RITA 5FU0A 1R7XA 1WT1A 4HO5A 2VXLA 1WT3A 1FG5N 5EIYA 1G97A 5CQNX 3V8ZA 1FXOA 1I52A 1G95A 4FRHA 5L6SA 4KT7A 1HM8A 4CJ8A 5C3DA 3T7NA 5C36A 1R7UA 1G9RA 1MP4A 1W55A 5CMHA 4EEGA 2RJ7A 2AECA 3V0LA 5DDTA 4CVHA 3SPTA 1ZI3A 3V0OA 2VS3A 3SX7A 3RSBA 1NQIB 2RJ1A 1ZI5A 2D7RA 4IRQA 5AJPA 5AJNA 1NMMB 2ICYA 3USRA 3USQA 2Y4MA 1FWYA 3SXAA 4DE7A
chains in the Genus database with same CATH superfamily
2XWLA 4D0ZA 2AH9A 4MTTA 4HO3A 1S4OA 3RRIA 3I0GA 1GWVA 4HUZA 1H5SA 3SXEA 1FR8A 4RT5A 1PZYB 1KWCB 1VH1A 1JYKA 4FRPA 1EILA 5JQQA 1ZJ0A 5CQOA 1XRKA 4KYKA 1LQOA 1VGZA 3BCVA 3QVBA 4FREA 5D92A 2AM5A 4FCEA 1ZJ2A 4B3UA 4KRVA 1NF5B 3RMVA 2V0HA 4Z6VA 4OPNA 1LVWA 2AESA 2FYBA 3F1CA 3PNNA 1H4CA 4M28A 1SQIA 2ZA0A 5BWGA 1LKDA 4CJBA 1SP8A 1EIQA 4KC1A 4HO0A 3I0EA 4PV5A 2Z87A 3F1YA 1KMYA 4B4MA 1EYRA 2VD4A 3E5DA 1GQ9A 4FRMA 1NKIA 3OJTA 3JTJA 1G2VA 1GX4A 1H5SB 1XHBA 4AAWA 1U6LA 3L7TA 1MC3A 5CQLX 4HO8A 3HPYA 4FIXA 3O3PA 2BO6A 3I0LA 1ZCVA 2Z86A 5FTVA 4DDZA 1H7LA 1FGXA 4FRAA 3U0XA 2A8WA 1G3LA 2VS5A 4QB5A 1SS9A 3W0UA 2RJ8A 4J18A 2Y4LA 5BWHA 2MZBA 2YCMA 2EI1A 1SQDA 2EHZA 2IG9A 2QH0A 1JYLA 2JCJA 4JD1A 4JH6A 1XQAA 2XMHA 4MYBA 1H7FA 3POLA 5EC3A 2VSIA 3I0IX 5C38A 3CKJA 3K8DA 3R3IA 1NHEB 2ZYQA 1K4VA 3E25A 2P25A 1TZFA 1KNFA 3D98A 1XZ6A 1ON8A 2VS4A 4Z6ZA 2O1HA 2DPWA 2RJ5A 4Z6TA 1O0RA 1FA8A 2V0JA 2P7MA 4Y64A 3OULA 5IFYA 1W57A 3DK5A 3SXCA 2EI0A 3OH4A 3JUJA 3I0HA 4C2SA 2P7LA 3FWWA 1FGGA 1JC5A 5C1GA 4ASYA 2E8BA 1FOAA 1O7QA 1ZI1A 1Q0CA 2FFVA 3CGXA 5D91A 1TG5A 3OJKA 3CU0A 3HQ0A 4R7PA 1VZUA 3IOHA 3V0MA 2BO7A 1BH5A 4IAGA 5C4CA 2XMEA 3K8EA 4B2XA 4G6XA 5FYEA 1NPBA 3OH3A 4EEOA 1R7VA 4MTQA 1R81A 3I0JA 1KW9B 1R7YA 1TW1A 5C3BA 3OAJA 4PAVA 1ZIZA 4FRQA 5DHWA 1MP3A 2YESA 2QGIA 3CKVA 5EJ1A 4Z6UA 4LW3A 4MNDA 3OH0A 4D11C 2V0KA 1H7TA 4MTRA 1G93A 4D0TA 1QG8A 3ZF8A 4JISA 1ON6A 2YC5A 2JCOA 4Y7FA 4G3SA 4HC5A 5C47A 4B5BA 4NALA 3U2TA 4KC2A 2P7PA 1VZTA 2CU2A 3SXDA 3V91A 2I7RA 2FYAA 1LZJA 4JH8A 3T7MA 1H5SD 1H3MA 4GBPA 2A4XA 4JH3A 5C1HA 2OI6A 2AE7A 5F6QA 3OH1A 4Z6RA 4Z6WA 4B2WA 2ZW7A 3JUKA 4X2AA 4ECMA 5FTSA 2ZU7A 2RIXA 5IDSA 4JH5A 2WL3A 4ZDQA 4Z04A 2Q4JA 2ZW6A 4JH4A 2XWNA 2C0NA 2D7IA 4JH1A 1IINA 4AYJA 1F1UA 1TVYA 1H7GA 2W0VA 1INIA 1R82A 4G3QA 5HS2A 5C4FA 1ZHJA 1NKHB 1LL3A 2YC3A 3ZLLA 2GGOA 1EIRA 4G87A 1MPYA 1YP3A 2FY7A 5BXCA 1Q0OA 4FCUA 4Y63A 2WVMA 4Y62A 2QKXA 1LQPA 4Z6QA 3V8YA 1O7OA 4HCQA 3DJ4A 3ZGFA 2AM3A 1EWJA 2I5KA 3OPYA 1CJXA 2OEGA 3GUEA 5AJOA 3R4QA 3DUVA 3I0DA 2WAWA 4EVWA 3V0QA 5C1LA 3ZGGA 1LL0A 2FFUA 4IR0A 3BZAA 1ZDFA 3OGZA 2PJSA 1WT0A 2VSHA 2J0BA 4FIYA 4P00A 1HV9A 4GHGA 1G8OA 2R5VA 4GHHA 5DDVA 1H5TA 1HM9A 2OI5A 4B4GA 3ST8A 1WT2A 3OUMA 3R2WA 5I1FA 2RIZA 2J0AA 4D48A 3KOLA 1BYLA 1H7HA 1YP4A 3N9WA 2X5SA 1MP5A 3GHJA 3W0TA 1ZSWA 4NAYA 4Q7CA 3TZTA 4FRBA 4L41C 1R9CA 5C6XA 1SS4A 4JD0A 3HPVA 1FA6A 3PKVA 4Z6SA 1HM0A 2VXMA 2WL9A 1U69A 2P6WA 3OPYB 1H7EA 2RJ9A 3G12A 2GGQA 2PA4A 2Y6PA 3EE5A 2ZW4A 1Z90A 4NB1A 1JVDA 1VICA 2QNTA 4Z6NA 1WVCA 2RJ0A 3Q80A 2AGDA 2UX8A 4Y7VA 5HCWA 2FYCB 2WVKA 5CMIA 5FU8A 3ZI1A 4Y7TA 5C3AA 3VB0A 2RK0A 2QH5A 4FROA 1FXJA 2ZU8A 1DHYA 4HO9A 3U2XA 5D7ZA 1GQCA 1PZTA 3GM5A 4NVSA 5CMJA 1V82A 1SP9A 2NXVA 3I0FA 1NNRA 4NAIA 1FO9A 1GX0A 3EY7A 4Y7GA 4EEAA 3D8VA 3V0PA 2I7BA 2Q48A 2ZW5A 3OXHA 3OA4A 4ASJA 2XWMA 3RHEA 2X5ZA 1QWJA 3PKXA 4AYLA 3ZLKA 4EE4A 1JC4A 1KW6B 3CT8A 4GHFA 2ZU9A 4KQLA 1VGUA 4NB2A 1VGWA 2ICXA 1OMZA 1KW3B 5C4DA 1VGTA 1QINA 2EI2A 1LZ7A 1LL2A 2D0JA 2WEEA 2APCA 4P02A 1HANA 4KC4A 3SX5A 2PGVA 2WE9A 2OEFA 4GHEA 1ZJ1A 1G1LA 5CJ3A 4HOCA 4MIXA 1EZIA 1GWWA 2WGZA 3U2WA 2Y4JA 1TWUA 3HNQA 3RMWA 3RMUA 2X60A 1KNDA 4M2AA 2QQZA 4GHDA 2A8UA 1GA8A 3CKNA 4FQWA 4LQBA 2YQJA 3HDPA 4JH7A 5FUHA 1INJA 2VK9A 5CTOA 3FCDA 1LZIA 2PGYA 3IOJA 1E5KA 2Y7AA 3D5NA 2P7QA 4Z6OA 2I5EA 1NIQB 5IDTA 2JCLA 4Z6PA 3I0KA 2O1GA 4IRPA 4Y7UA 2OI7A 5EJZA 3U0YA 5CMFX 1H7QA 2A4WA 4DECA 4KNRA 4KPZA 1G23A 1FA7A 1KW8B 2VFZA 4CJCA 5D4FA 1H4EA 2V0IA 4ARWA 2RJ4A 2YQCA 4HO6A 5C49A 3V0NA 4UEGA 4E1KA 3HUHA 1TW5A 3HL3A 4EE5A 3VW9A 1F1VA 5CQMX 2C21A 3E0RA 1O23B 5C48A 4KYHA 4FRLA 4FRDA 4Y9XA 3TQDA 2BO4A 1HJLA 1T47A 3OH2A 2P7OA 3LHOA 1ZJPA 1IIMA 5CMGX 4B42A 1LZ0A 3BRKX 4O6NA 4EEMA 3SX3A 2YQHA 2P72A 1FR9A 4JH9A 1VM8A 1H5SC 1H4DA 1S4PA 3KIAA 2P73A 3SX8A 1TFZA 3Q4SA 1OMXA 2RIYA 1WSZA 3IUZA 4KXOA 1FRWA 5DRHA 5C4EA 2IGAA 1ZCUA 4KPXA 3ECJA 2Y4KA 1G0RA 1JVGA 4NB0A 4N04A 1V84A 4EE3A 3PKPA 1ZDGA 2PX7A 3OKRA 1ECSA 1S4NA 4NANA 1H5RA 2RJBA 2V0LA 4BMAA 1VPAA 3U2VA 4YS8A 4LW6A 1K4NA 1YROB 1HJJA 2W0WA 4B4BA 2BO8A 2X65A 5C4PA 4M4KA 1W77A 4HO2A 4O6MA 3OJNA 5FV9A 3PKWA 3PKQA 2AM4A 1VZXA 3BQXA 4M2BA 3I0CA 5J49A 1R7TA 1OQMB 1ZI4A 1F1RA 1ZCTA 1MH6A 4Y6NA 4G3PA 2RJ6A 1H5TB 2R6UA 2E3DA 1FA5A 3NGWA 1QTOA 3SK2A 5C4BA 1TSJA 3R6AA 3CKOA 3V90A 5C8RA 4NAZA 3U2UA 1NWGB 4MTSA 1ZJ3A 4Z6LA 4GHCA 1H5RB 1JIFA 3FOQA 4K6RA 5CQPA 3SXBA 1ZJOA 3Q7UA 4AC3A 2ZI8A 5L6VA 4Y6UA 1JV3A 2EI3A 5C68A 3P8AA 3B59A 1R80A 3OAMA 2O1FA 3SXGA 4D11A 2YQSA 4BQHA 4HO4A 3OC9A 4XWIA 1QIPA 3T7OA 3EY8A 3CKQA 4KNXA 1KWBB 1YP2A 5CB9A 1ZCYA 3E26A 1QGSA 4Z6MA 3IOIA 1KWSA 1QGQA 2FYDB 1V83A 2JCKA 1FO8A 1FZWA 1VH3A 2WVLA 4HG6A 3L20A 1JV1A 3LW6A 4NAKA 2RK9A 1XY7A 2RITA 5FU0A 1R7XA 1WT1A 4HO5A 2VXLA 2ZHPA 1JIEA 5KEFA 1FG5N 1WT3A 5EIYA 1G97A 5CQNX 3ECKA 3V8ZA 1KLLA 1FXOA 1I52A 1G95A 4FRHA 5L6SA 2RBBA 4KT7A 1HM8A 4CJ8A 5C3DA 3T7NA 5C36A 4GYMA 1G9RA 1R7UA 1MP4A 1F1XA 1W55A 5CMHA 5DFGA 4EEGA 2RJ7A 2AECA 3V0LA 1LGTA 5DDTA 4CVHA 3ZGJA 3ZW5A 3SPTA 1ZI3A 3V0OA 2VS3A 3SX7A 1KMZA 3RSBA 1NQIB 2RJ1A 4MYMA 1ZI5A 2D7RA 4IRQA 5AJPA 5AJNA 1LQKA 3LM4A 1NMMB 3ISQA 2ICYA 3USRA 1FROA 3USQA 2Y4MA 1FWYA 3SXAA 1F9ZA 4JH2A 3OJJA 4DE7A 2P7KA
chains in the Genus database with same CATH topology
2XWLA 4D0ZA 2AH9A 4HO3A 1S4OA 3I0GA 1GWVA 1H5SA 3SXEA 1FR8A 1PZYB 1VH1A 1JYKA 4FRPA 5JQQA 1ZJ0A 5CQOA 3BCVA 1VGZA 3QVBA 4FREA 5D92A 2AM5A 4FCEA 1ZJ2A 4B3UA 4KRVA 1NF5B 3RMVA 2V0HA 1LVWA 2AESA 2FYBA 3F1CA 3PNNA 1H4CA 4M28A 4CJBA 4KC1A 4HO0A 3I0EA 2Z87A 3F1YA 4B4MA 1EYRA 2VD4A 1GQ9A 4FRMA 3JTJA 1G2VA 1GX4A 1H5SB 1XHBA 4AAWA 1MC3A 5CQLX 4HO8A 4FIXA 3O3PA 2BO6A 3I0LA 1ZCVA 2Z86A 5FTVA 4DDZA 1H7LA 1FGXA 4FRAA 3U0XA 2A8WA 1G3LA 2VS5A 1SS9A 4J18A 2RJ8A 2Y4LA 2MZBA 2YCMA 1JYLA 2JCJA 2XMHA 4MYBA 1H7FA 3POLA 2VSIA 3I0IX 5C38A 3CKJA 3K8DA 3R3IA 1NHEB 1K4VA 3E25A 1TZFA 3D98A 1XZ6A 1ON8A 2VS4A 2O1HA 2DPWA 2RJ5A 1O0RA 2V0JA 4Y64A 5IFYA 1W57A 3DK5A 3SXCA 3OH4A 3JUJA 3I0HA 4C2SA 3FWWA 1FGGA 5C1GA 4ASYA 2E8BA 1FOAA 1O7QA 1ZI1A 2FFVA 5D91A 3CGXA 3CU0A 1VZUA 3IOHA 3V0MA 2BO7A 5C4CA 2XMEA 3K8EA 4B2XA 5FYEA 3OH3A 4EEOA 1R7VA 1R81A 3I0JA 1TW1A 1R7YA 5C3BA 1ZIZA 4FRQA 1MP3A 2YESA 2QGIA 3CKVA 5EJ1A 4LW3A 4MNDA 3OH0A 4D11C 2V0KA 1H7TA 1G93A 4D0TA 1QG8A 3ZF8A 4JISA 1ON6A 2YC5A 2JCOA 4Y7FA 4G3SA 5C47A 4B5BA 4NALA 3U2TA 4KC2A 1VZTA 2CU2A 3SXDA 3V91A 2FYAA 1LZJA 3T7MA 1H5SD 1H3MA 4GBPA 5C1HA 2OI6A 2AE7A 3OH1A 4B2WA 3JUKA 4ECMA 5FTSA 2ZU7A 2RIXA 5IDSA 4ZDQA 2XWNA 2Q4JA 2C0NA 2D7IA 1IINA 4AYJA 1TVYA 1H7GA 2W0VA 1INIA 1R82A 4G3QA 5HS2A 5C4FA 1ZHJA 1NKHB 1LL3A 2YC3A 3ZLLA 2GGOA 4G87A 1YP3A 2FY7A 5BXCA 4FCUA 4Y63A 2WVMA 4Y62A 2QKXA 3V8YA 1O7OA 4HCQA 3DJ4A 3ZGFA 2AM3A 2I5KA 2OEGA 3GUEA 5AJOA 3I0DA 3DUVA 4EVWA 2WAWA 3V0QA 5C1LA 3ZGGA 1LL0A 2FFUA 1ZDFA 3OGZA 1WT0A 2VSHA 4FIYA 2J0BA 4P00A 1HV9A 1G8OA 5DDVA 1H5TA 1HM9A 2OI5A 4B4GA 3ST8A 1WT2A 3R2WA 5I1FA 2RIZA 2J0AA 4D48A 3N9WA 1H7HA 1YP4A 4R7PA 2X5SA 1MP5A 4Q7CA 3TZTA 4FRBA 4L41C 4JD0A 1HM0A 2VXMA 2P6WA 1H7EA 2RJ9A 2GGQA 2PA4A 2Y6PA 3EE5A 1Z90A 1JVDA 1VICA 1WVCA 2RJ0A 3Q80A 2AGDA 2UX8A 4Y7VA 2FYCB 2WVKA 5CMIA 5FU8A 4Y7TA 5C3AA 2QH5A 4FROA 1FXJA 2ZU8A 4HO9A 3U2XA 1GQCA 1PZTA 5CMJA 1V82A 2NXVA 3I0FA 4NAIA 1FO9A 1GX0A 4Y7GA 4EEAA 3D8VA 3V0PA 2I7BA 4ASJA 2XWMA 2X5ZA 1QWJA 4AYLA 3ZLKA 4EE4A 2ZU9A 4KQLA 1VGUA 1VGWA 2ICXA 1OMZA 5C4DA 1VGTA 1LZ7A 1LL2A 2D0JA 2WEEA 2APCA 4P02A 3SX5A 4KC4A 2PGVA 2WE9A 2OEFA 1ZJ1A 1G1LA 4HOCA 4MIXA 1EZIA 1GWWA 2WGZA 3U2WA 2Y4JA 3RMWA 2X60A 4M2AA 2A8UA 1GA8A 3CKNA 4FQWA 2YQJA 5FUHA 1INJA 2VK9A 2PGYA 1LZIA 3IOJA 1E5KA 2Y7AA 3D5NA 2I5EA 5IDTA 2JCLA 3I0KA 2O1GA 4IRPA 4Y7UA 2OI7A 5EJZA 3U0YA 5CMFX 1H7QA 4DECA 4KNRA 4KPZA 1G23A 2VFZA 4CJCA 1H4EA 2V0IA 4ARWA 2RJ4A 2YQCA 4HO6A 5C49A 3V0NA 4UEGA 4E1KA 1TW5A 3HL3A 4EE5A 5CQMX 1O23B 5C48A 4FRLA 4FRDA 4Y9XA 3TQDA 2BO4A 1HJLA 3OH2A 1ZJPA 1IIMA 5CMGX 4B42A 1LZ0A 3BRKX 4O6NA 4EEMA 3SX3A 2YQHA 2P72A 1FR9A 1VM8A 1H5SC 1H4DA 1S4PA 3KIAA 2P73A 3SX8A 3Q4SA 1OMXA 2RIYA 1WSZA 4KXOA 1FRWA 5C4EA 1ZCUA 4KPXA 2Y4KA 1G0RA 1JVGA 1V84A 4EE3A 3PKPA 1ZDGA 2PX7A 3OKRA 1S4NA 4NANA 1H5RA 2V0LA 4BMAA 1VPAA 3U2VA 4YS8A 4LW6A 1YROB 1HJJA 2W0WA 4B4BA 2BO8A 2X65A 4M4KA 1W77A 4HO2A 4O6MA 5FV9A 3PKQA 2AM4A 1VZXA 4M2BA 3I0CA 5J49A 1R7TA 1OQMB 1ZI4A 1ZCTA 4Y6NA 4G3PA 2RJ6A 1H5TB 2E3DA 3NGWA 5C4BA 3CKOA 3V90A 5C8RA 3U2UA 1NWGB 1ZJ3A 1H5RB 4K6RA 3FOQA 5CQPA 4AC3A 3SXBA 1ZJOA 3Q7UA 5L6VA 4Y6UA 1JV3A 1R80A 3OAMA 2O1FA 3SXGA 4D11A 2YQSA 4BQHA 4HO4A 3OC9A 4XWIA 3T7OA 3CKQA 4KNXA 1YP2A 1ZCYA 3E26A 1QGSA 3IOIA 1KWSA 1QGQA 2FYDB 1V83A 2JCKA 1FO8A 1FZWA 1VH3A 2WVLA 4HG6A 1JV1A 3LW6A 4NAKA 2RITA 5FU0A 1R7XA 1WT1A 4HO5A 2VXLA 1WT3A 1FG5N 5EIYA 1G97A 5CQNX 3V8ZA 1FXOA 1I52A 1G95A 4FRHA 5L6SA 4KT7A 1HM8A 4CJ8A 5C3DA 3T7NA 5C36A 1R7UA 1G9RA 1MP4A 1W55A 5CMHA 4EEGA 2RJ7A 2AECA 3V0LA 5DDTA 4CVHA 3SPTA 1ZI3A 3V0OA 2VS3A 3SX7A 3RSBA 1NQIB 2RJ1A 1ZI5A 2D7RA 4IRQA 5AJPA 5AJNA 1NMMB 2ICYA 3USRA 3USQA 2Y4MA 1FWYA 3SXAA 4DE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XWL A;  4D0Z A;  2AH9 A;  4HO3 A;  1S4O A;  3I0G A;  1GWV A;  1H5S A;  3SXE A;  1FR8 A;  1PZY B;  1VH1 A;  1JYK A;  4FRP A;  5JQQ A;  1ZJ0 A;  5CQO A;  3BCV A;  1VGZ A;  3QVB A;  4FRE A;  2AM5 A;  4FCE A;  1ZJ2 A;  4B3U A;  4KRV A;  1NF5 B;  3RMV A;  2V0H A;  1LVW A;  2AES A;  2FYB A;  3F1C A;  3PNN A;  1H4C A;  4M28 A;  4CJB A;  4KC1 A;  4HO0 A;  3I0E A;  2Z87 A;  3F1Y A;  4B4M A;  1EYR A;  2VD4 A;  1GQ9 A;  4FRM A;  3JTJ A;  1G2V A;  1GX4 A;  1H5S B;  1XHB A;  4AAW A;  1MC3 A;  5CQL X;  4HO8 A;  3O3P A;  2BO6 A;  3I0L A;  1ZCV A;  2Z86 A;  5FTV A;  4DDZ A;  1H7L A;  1FGX A;  4FRA A;  3U0X A;  2A8W A;  1G3L A;  2VS5 A;  1SS9 A;  4J18 A;  2RJ8 A;  2Y4L A;  2MZB A;  2YCM A;  1JYL A;  2JCJ A;  2XMH A;  4MYB A;  1H7F A;  3POL A;  2VSI A;  3I0I X;  5C38 A;  3CKJ A;  3K8D A;  3R3I A;  1NHE B;  1K4V A;  3E25 A;  1TZF A;  3D98 A;  1XZ6 A;  1ON8 A;  2VS4 A;  2O1H A;  2DPW A;  2RJ5 A;  1O0R A;  2V0J A;  4Y64 A;  5IFY A;  1W57 A;  3DK5 A;  3SXC A;  3OH4 A;  3JUJ A;  3I0H A;  4C2S A;  3FWW A;  1FGG A;  5C1G A;  4ASY A;  2E8B A;  1FOA A;  1O7Q A;  1ZI1 A;  2FFV A;  3CGX A;  3CU0 A;  1VZU A;  3IOH A;  3V0M A;  2BO7 A;  5C4C A;  2XME A;  3K8E A;  4B2X A;  5FYE A;  3OH3 A;  4EEO A;  1R7V A;  1R81 A;  3I0J A;  1TW1 A;  1R7Y A;  5C3B A;  1ZIZ A;  4FRQ A;  1MP3 A;  2YES A;  2QGI A;  3CKV A;  5EJ1 A;  4LW3 A;  4MND A;  3OH0 A;  4D11 C;  2V0K A;  1H7T A;  1G93 A;  4D0T A;  1QG8 A;  3ZF8 A;  4JIS A;  1ON6 A;  2YC5 A;  2JCO A;  4Y7F A;  4G3S A;  5C47 A;  4B5B A;  4NAL A;  3U2T A;  4KC2 A;  1VZT A;  2CU2 A;  3SXD A;  3V91 A;  2FYA A;  1LZJ A;  3T7M A;  1H5S D;  1H3M A;  4GBP A;  5C1H A;  2OI6 A;  2AE7 A;  3OH1 A;  4B2W A;  3JUK A;  4ECM A;  5FTS A;  2ZU7 A;  2RIX A;  5IDS A;  4ZDQ A;  2XWN A;  2Q4J A;  2D7I A;  1IIN A;  4AYJ A;  1TVY A;  1H7G A;  2W0V A;  1INI A;  1R82 A;  4G3Q A;  5HS2 A;  5C4F A;  1ZHJ A;  1NKH B;  1LL3 A;  2YC3 A;  3ZLL A;  2GGO A;  4G87 A;  1YP3 A;  2FY7 A;  5BXC A;  4FCU A;  4Y63 A;  2WVM A;  4Y62 A;  2QKX A;  3V8Y A;  1O7O A;  4HCQ A;  3DJ4 A;  3ZGF A;  2AM3 A;  2I5K A;  2OEG A;  3GUE A;  5AJO A;  3I0D A;  3DUV A;  4EVW A;  2WAW A;  3V0Q A;  5C1L A;  3ZGG A;  1LL0 A;  2FFU A;  1ZDF A;  3OGZ A;  1WT0 A;  2VSH A;  4P00 A;  1HV9 A;  1G8O A;  5DDV A;  1H5T A;  1HM9 A;  2OI5 A;  4B4G A;  3ST8 A;  1WT2 A;  3R2W A;  5I1F A;  2RIZ A;  4D48 A;  3N9W A;  1H7H A;  1YP4 A;  4R7P A;  2X5S A;  1MP5 A;  3TZT A;  4FRB A;  4L41 C;  4JD0 A;  1HM0 A;  2VXM A;  2P6W A;  1H7E A;  2RJ9 A;  2GGQ A;  2PA4 A;  2Y6P A;  3EE5 A;  1Z90 A;  1JVD A;  1VIC A;  1WVC A;  2RJ0 A;  3Q80 A;  2AGD A;  2UX8 A;  4Y7V A;  2FYC B;  2WVK A;  5CMI A;  5FU8 A;  4Y7T A;  5C3A A;  2QH5 A;  4FRO A;  1FXJ A;  2ZU8 A;  4HO9 A;  3U2X A;  1GQC A;  1PZT A;  5CMJ A;  1V82 A;  2NXV A;  3I0F A;  4NAI A;  1FO9 A;  1GX0 A;  4Y7G A;  4EEA A;  3D8V A;  3V0P A;  2I7B A;  4ASJ A;  2XWM A;  2X5Z A;  1QWJ A;  4AYL A;  3ZLK A;  4EE4 A;  2ZU9 A;  4KQL A;  1VGU A;  1VGW A;  2ICX A;  1OMZ A;  5C4D A;  1VGT A;  1LZ7 A;  1LL2 A;  2D0J A;  2WEE A;  2APC A;  4P02 A;  3SX5 A;  4KC4 A;  2PGV A;  2WE9 A;  2OEF A;  1ZJ1 A;  1G1L A;  4HOC A;  1EZI A;  1GWW A;  2WGZ A;  3U2W A;  2Y4J A;  3RMW A;  2X60 A;  4M2A A;  2A8U A;  1GA8 A;  3CKN A;  4FQW A;  2YQJ A;  5FUH A;  1INJ A;  2PGY A;  1LZI A;  3IOJ A;  1E5K A;  2Y7A A;  3D5N A;  2I5E A;  5IDT A;  2JCL A;  3I0K A;  2O1G A;  4IRP A;  4Y7U A;  2OI7 A;  5EJZ A;  3U0Y A;  5CMF X;  1H7Q A;  4DEC A;  4KNR A;  4KPZ A;  1G23 A;  2VFZ A;  4CJC A;  1H4E A;  2V0I A;  4ARW A;  2RJ4 A;  2YQC A;  4HO6 A;  5C49 A;  3V0N A;  4UEG A;  4E1K A;  1TW5 A;  3HL3 A;  4EE5 A;  5CQM X;  1O23 B;  5C48 A;  4FRL A;  4FRD A;  4Y9X A;  3TQD A;  2BO4 A;  1HJL A;  3OH2 A;  1ZJP A;  1IIM A;  5CMG X;  4B42 A;  1LZ0 A;  3BRK X;  4EEM A;  3SX3 A;  2YQH A;  2P72 A;  1FR9 A;  1VM8 A;  1H5S C;  1H4D A;  1S4P A;  3KIA A;  2P73 A;  3SX8 A;  3Q4S A;  1OMX A;  2RIY A;  1WSZ A;  4KXO A;  1FRW A;  5C4E A;  1ZCU A;  4KPX A;  2Y4K A;  1G0R A;  1JVG A;  1V84 A;  4EE3 A;  3PKP A;  1ZDG A;  2PX7 A;  3OKR A;  1S4N A;  4NAN A;  1H5R A;  2V0L A;  4BMA A;  1VPA A;  3U2V A;  4YS8 A;  4LW6 A;  1YRO B;  1HJJ A;  2W0W A;  4B4B A;  2BO8 A;  2X65 A;  4M4K A;  1W77 A;  4HO2 A;  5FV9 A;  3PKQ A;  2AM4 A;  1VZX A;  4M2B A;  3I0C A;  5J49 A;  1R7T A;  1OQM B;  1ZI4 A;  1ZCT A;  4Y6N A;  4G3P A;  2RJ6 A;  1H5T B;  2E3D A;  3NGW A;  5C4B A;  3CKO A;  3V90 A;  5C8R A;  3U2U A;  1NWG B;  1ZJ3 A;  1H5R B;  4K6R A;  3FOQ A;  5CQP A;  4AC3 A;  3SXB A;  1ZJO A;  3Q7U A;  5L6V A;  4Y6U A;  1JV3 A;  1R80 A;  3OAM A;  2O1F A;  3SXG A;  4D11 A;  2YQS A;  4BQH A;  4HO4 A;  3OC9 A;  4XWI A;  3T7O A;  3CKQ A;  4KNX A;  1YP2 A;  1ZCY A;  3E26 A;  1QGS A;  3IOI A;  1KWS A;  1QGQ A;  2FYD B;  1V83 A;  2JCK A;  1FO8 A;  1FZW A;  1VH3 A;  2WVL A;  4HG6 A;  1JV1 A;  3LW6 A;  4NAK A;  2RIT A;  5FU0 A;  1R7X A;  1WT1 A;  4HO5 A;  2VXL A;  1WT3 A;  1FG5 N;  5EIY A;  1G97 A;  5CQN X;  3V8Z A;  1FXO A;  1I52 A;  1G95 A;  4FRH A;  5L6S A;  4KT7 A;  1HM8 A;  4CJ8 A;  5C3D A;  3T7N A;  5C36 A;  1R7U A;  1G9R A;  1MP4 A;  1W55 A;  5CMH A;  4EEG A;  2RJ7 A;  2AEC A;  3V0L A;  5DDT A;  4CVH A;  3SPT A;  1ZI3 A;  3V0O A;  2VS3 A;  3SX7 A;  3RSB A;  1NQI B;  2RJ1 A;  1ZI5 A;  2D7R A;  4IRQ A;  5AJP A;  5AJN A;  1NMM B;  2ICY A;  3USR A;  3USQ A;  2Y4M A;  1FWY A;  3SXA A;  4DE7 A; 
#chains in the Genus database with same CATH topology
 2XWL A;  4D0Z A;  2AH9 A;  4MTT A;  4HO3 A;  1S4O A;  3RRI A;  3I0G A;  1GWV A;  4HUZ A;  1H5S A;  3SXE A;  1FR8 A;  4RT5 A;  1PZY B;  1KWC B;  1VH1 A;  1JYK A;  4FRP A;  1EIL A;  5JQQ A;  1ZJ0 A;  5CQO A;  1XRK A;  4KYK A;  1LQO A;  1VGZ A;  3BCV A;  3QVB A;  4FRE A;  5D92 A;  2AM5 A;  4FCE A;  1ZJ2 A;  4B3U A;  4KRV A;  1NF5 B;  3RMV A;  2V0H A;  4Z6V A;  4OPN A;  1LVW A;  2AES A;  2FYB A;  3F1C A;  3PNN A;  1H4C A;  4M28 A;  1SQI A;  2ZA0 A;  5BWG A;  1LKD A;  4CJB A;  1SP8 A;  1EIQ A;  4KC1 A;  4HO0 A;  3I0E A;  4PV5 A;  2Z87 A;  3F1Y A;  1KMY A;  4B4M A;  1EYR A;  2VD4 A;  3E5D A;  1GQ9 A;  4FRM A;  1NKI A;  3OJT A;  3JTJ A;  1G2V A;  1GX4 A;  1H5S B;  1XHB A;  4AAW A;  1U6L A;  3L7T A;  1MC3 A;  5CQL X;  4HO8 A;  3HPY A;  4FIX A;  3O3P A;  2BO6 A;  3I0L A;  1ZCV A;  2Z86 A;  5FTV A;  4DDZ A;  1H7L A;  1FGX A;  4FRA A;  3U0X A;  2A8W A;  1G3L A;  2VS5 A;  4QB5 A;  1SS9 A;  3W0U A;  2RJ8 A;  4J18 A;  2Y4L A;  5BWH A;  2MZB A;  2YCM A;  2EI1 A;  1SQD A;  2EHZ A;  2IG9 A;  2QH0 A;  1JYL A;  2JCJ A;  4JD1 A;  4JH6 A;  1XQA A;  2XMH A;  4MYB A;  1H7F A;  3POL A;  5EC3 A;  2VSI A;  3I0I X;  5C38 A;  3CKJ A;  3K8D A;  3R3I A;  1NHE B;  2ZYQ A;  1K4V A;  3E25 A;  2P25 A;  1TZF A;  1KNF A;  3D98 A;  1XZ6 A;  1ON8 A;  2VS4 A;  4Z6Z A;  2O1H A;  2DPW A;  2RJ5 A;  4Z6T A;  1O0R A;  1FA8 A;  2V0J A;  2P7M A;  4Y64 A;  3OUL A;  5IFY A;  1W57 A;  3DK5 A;  3SXC A;  2EI0 A;  3OH4 A;  3JUJ A;  3I0H A;  4C2S A;  2P7L A;  3FWW A;  1FGG A;  1JC5 A;  5C1G A;  4ASY A;  2E8B A;  1FOA A;  1O7Q A;  1ZI1 A;  1Q0C A;  2FFV A;  3CGX A;  5D91 A;  1TG5 A;  3OJK A;  3CU0 A;  3HQ0 A;  4R7P A;  1VZU A;  3IOH A;  3V0M A;  2BO7 A;  1BH5 A;  4IAG A;  5C4C A;  2XME A;  3K8E A;  4B2X A;  4G6X A;  5FYE A;  1NPB A;  3OH3 A;  4EEO A;  1R7V A;  4MTQ A;  1R81 A;  3I0J A;  1KW9 B;  1R7Y A;  1TW1 A;  5C3B A;  3OAJ A;  4PAV A;  1ZIZ A;  4FRQ A;  5DHW A;  1MP3 A;  2YES A;  2QGI A;  3CKV A;  5EJ1 A;  4Z6U A;  4LW3 A;  4MND A;  3OH0 A;  4D11 C;  2V0K A;  1H7T A;  4MTR A;  1G93 A;  4D0T A;  1QG8 A;  3ZF8 A;  4JIS A;  1ON6 A;  2YC5 A;  2JCO A;  4Y7F A;  4G3S A;  4HC5 A;  5C47 A;  4B5B A;  4NAL A;  3U2T A;  4KC2 A;  2P7P A;  1VZT A;  2CU2 A;  3SXD A;  3V91 A;  2I7R A;  2FYA A;  1LZJ A;  4JH8 A;  3T7M A;  1H5S D;  1H3M A;  4GBP A;  2A4X A;  4JH3 A;  5C1H A;  2OI6 A;  2AE7 A;  5F6Q A;  3OH1 A;  4Z6R A;  4Z6W A;  4B2W A;  2ZW7 A;  3JUK A;  4X2A A;  4ECM A;  5FTS A;  2ZU7 A;  2RIX A;  5IDS A;  4JH5 A;  2WL3 A;  4ZDQ A;  4Z04 A;  2Q4J A;  2ZW6 A;  4JH4 A;  2XWN A;  2C0N A;  2D7I A;  4JH1 A;  1IIN A;  4AYJ A;  1F1U A;  1TVY A;  1H7G A;  2W0V A;  1INI A;  1R82 A;  4G3Q A;  5HS2 A;  5C4F A;  1ZHJ A;  1NKH B;  1LL3 A;  2YC3 A;  3ZLL A;  2GGO A;  1EIR A;  4G87 A;  1MPY A;  1YP3 A;  2FY7 A;  5BXC A;  1Q0O A;  4FCU A;  4Y63 A;  2WVM A;  4Y62 A;  2QKX A;  1LQP A;  4Z6Q A;  3V8Y A;  1O7O A;  4HCQ A;  3DJ4 A;  3ZGF A;  2AM3 A;  1EWJ A;  2I5K A;  3OPY A;  1CJX A;  2OEG A;  3GUE A;  5AJO A;  3R4Q A;  3DUV A;  3I0D A;  2WAW A;  4EVW A;  3V0Q A;  5C1L A;  3ZGG A;  1LL0 A;  2FFU A;  4IR0 A;  3BZA A;  1ZDF A;  3OGZ A;  2PJS A;  1WT0 A;  2VSH A;  2J0B A;  4FIY A;  4P00 A;  1HV9 A;  4GHG A;  1G8O A;  2R5V A;  4GHH A;  5DDV A;  1H5T A;  1HM9 A;  2OI5 A;  4B4G A;  3ST8 A;  1WT2 A;  3OUM A;  3R2W A;  5I1F A;  2RIZ A;  2J0A A;  4D48 A;  3KOL A;  1BYL A;  1H7H A;  1YP4 A;  3N9W A;  2X5S A;  1MP5 A;  3GHJ A;  3W0T A;  1ZSW A;  4NAY A;  4Q7C A;  3TZT A;  4FRB A;  4L41 C;  1R9C A;  5C6X A;  1SS4 A;  4JD0 A;  3HPV A;  1FA6 A;  3PKV A;  4Z6S A;  1HM0 A;  2VXM A;  2WL9 A;  1U69 A;  2P6W A;  3OPY B;  1H7E A;  2RJ9 A;  3G12 A;  2GGQ A;  2PA4 A;  2Y6P A;  3EE5 A;  2ZW4 A;  1Z90 A;  4NB1 A;  1JVD A;  1VIC A;  2QNT A;  4Z6N A;  1WVC A;  2RJ0 A;  3Q80 A;  2AGD A;  2UX8 A;  4Y7V A;  5HCW A;  2FYC B;  2WVK A;  5CMI A;  5FU8 A;  3ZI1 A;  4Y7T A;  5C3A A;  3VB0 A;  2RK0 A;  2QH5 A;  4FRO A;  1FXJ A;  2ZU8 A;  1DHY A;  4HO9 A;  3U2X A;  5D7Z A;  1GQC A;  1PZT A;  3GM5 A;  4NVS A;  5CMJ A;  1V82 A;  1SP9 A;  2NXV A;  3I0F A;  1NNR A;  4NAI A;  1FO9 A;  1GX0 A;  3EY7 A;  4Y7G A;  4EEA A;  3D8V A;  3V0P A;  2I7B A;  2Q48 A;  2ZW5 A;  3OXH A;  3OA4 A;  4ASJ A;  2XWM A;  3RHE A;  2X5Z A;  1QWJ A;  3PKX A;  4AYL A;  3ZLK A;  4EE4 A;  1JC4 A;  1KW6 B;  3CT8 A;  4GHF A;  2ZU9 A;  4KQL A;  1VGU A;  4NB2 A;  1VGW A;  2ICX A;  1OMZ A;  1KW3 B;  5C4D A;  1VGT A;  1QIN A;  2EI2 A;  1LZ7 A;  1LL2 A;  2D0J A;  2WEE A;  2APC A;  4P02 A;  1HAN A;  4KC4 A;  3SX5 A;  2PGV A;  2WE9 A;  2OEF A;  4GHE A;  1ZJ1 A;  1G1L A;  5CJ3 A;  4HOC A;  4MIX A;  1EZI A;  1GWW A;  2WGZ A;  3U2W A;  2Y4J A;  1TWU A;  3HNQ A;  3RMW A;  3RMU A;  2X60 A;  1KND A;  4M2A A;  2QQZ A;  4GHD A;  2A8U A;  1GA8 A;  3CKN A;  4FQW A;  4LQB A;  2YQJ A;  3HDP A;  4JH7 A;  5FUH A;  1INJ A;  2VK9 A;  5CTO A;  3FCD A;  1LZI A;  2PGY A;  3IOJ A;  1E5K A;  2Y7A A;  3D5N A;  2P7Q A;  4Z6O A;  2I5E A;  1NIQ B;  5IDT A;  2JCL A;  4Z6P A;  3I0K A;  2O1G A;  4IRP A;  4Y7U A;  2OI7 A;  5EJZ A;  3U0Y A;  5CMF X;  1H7Q A;  2A4W A;  4DEC A;  4KNR A;  4KPZ A;  1G23 A;  1FA7 A;  1KW8 B;  2VFZ A;  4CJC A;  5D4F A;  1H4E A;  2V0I A;  4ARW A;  2RJ4 A;  2YQC A;  4HO6 A;  5C49 A;  3V0N A;  4UEG A;  4E1K A;  3HUH A;  1TW5 A;  3HL3 A;  4EE5 A;  3VW9 A;  1F1V A;  5CQM X;  2C21 A;  3E0R A;  1O23 B;  5C48 A;  4KYH A;  4FRL A;  4FRD A;  4Y9X A;  3TQD A;  2BO4 A;  1HJL A;  1T47 A;  3OH2 A;  2P7O A;  3LHO A;  1ZJP A;  1IIM A;  5CMG X;  4B42 A;  1LZ0 A;  3BRK X;  4O6N A;  4EEM A;  3SX3 A;  2YQH A;  2P72 A;  1FR9 A;  4JH9 A;  1VM8 A;  1H5S C;  1H4D A;  1S4P A;  3KIA A;  2P73 A;  3SX8 A;  1TFZ A;  3Q4S A;  1OMX A;  2RIY A;  1WSZ A;  3IUZ A;  4KXO A;  1FRW A;  5DRH A;  5C4E A;  2IGA A;  1ZCU A;  4KPX A;  3ECJ A;  2Y4K A;  1G0R A;  1JVG A;  4NB0 A;  4N04 A;  1V84 A;  4EE3 A;  3PKP A;  1ZDG A;  2PX7 A;  3OKR A;  1ECS A;  1S4N A;  4NAN A;  1H5R A;  2RJB A;  2V0L A;  4BMA A;  1VPA A;  3U2V A;  4YS8 A;  4LW6 A;  1K4N A;  1YRO B;  1HJJ A;  2W0W A;  4B4B A;  2BO8 A;  2X65 A;  5C4P A;  4M4K A;  1W77 A;  4HO2 A;  4O6M A;  3OJN A;  5FV9 A;  3PKW A;  3PKQ A;  2AM4 A;  1VZX A;  3BQX A;  4M2B A;  3I0C A;  5J49 A;  1R7T A;  1OQM B;  1ZI4 A;  1F1R A;  1ZCT A;  1MH6 A;  4Y6N A;  4G3P A;  2RJ6 A;  1H5T B;  2R6U A;  2E3D A;  1FA5 A;  3NGW A;  1QTO A;  3SK2 A;  5C4B A;  1TSJ A;  3R6A A;  3CKO A;  3V90 A;  5C8R A;  4NAZ A;  3U2U A;  1NWG B;  4MTS A;  1ZJ3 A;  4Z6L A;  4GHC A;  1H5R B;  1JIF A;  3FOQ A;  4K6R A;  5CQP A;  3SXB A;  1ZJO A;  3Q7U A;  4AC3 A;  2ZI8 A;  5L6V A;  4Y6U A;  1JV3 A;  2EI3 A;  5C68 A;  3P8A A;  3B59 A;  1R80 A;  3OAM A;  2O1F A;  3SXG A;  4D11 A;  2YQS A;  4BQH A;  4HO4 A;  3OC9 A;  4XWI A;  1QIP A;  3T7O A;  3EY8 A;  3CKQ A;  4KNX A;  1KWB B;  1YP2 A;  5CB9 A;  1ZCY A;  3E26 A;  1QGS A;  4Z6M A;  3IOI A;  1KWS A;  1QGQ A;  2FYD B;  1V83 A;  2JCK A;  1FO8 A;  1FZW A;  1VH3 A;  2WVL A;  4HG6 A;  3L20 A;  1JV1 A;  3LW6 A;  4NAK A;  2RK9 A;  1XY7 A;  2RIT A;  5FU0 A;  1R7X A;  1WT1 A;  4HO5 A;  2VXL A;  2ZHP A;  1JIE A;  5KEF A;  1FG5 N;  1WT3 A;  5EIY A;  1G97 A;  5CQN X;  3ECK A;  3V8Z A;  1KLL A;  1FXO A;  1I52 A;  1G95 A;  4FRH A;  5L6S A;  2RBB A;  4KT7 A;  1HM8 A;  4CJ8 A;  5C3D A;  3T7N A;  5C36 A;  4GYM A;  1G9R A;  1R7U A;  1MP4 A;  1F1X A;  1W55 A;  5CMH A;  5DFG A;  4EEG A;  2RJ7 A;  2AEC A;  3V0L A;  1LGT A;  5DDT A;  4CVH A;  3ZGJ A;  3ZW5 A;  3SPT A;  1ZI3 A;  3V0O A;  2VS3 A;  3SX7 A;  1KMZ A;  3RSB A;  1NQI B;  2RJ1 A;  4MYM A;  1ZI5 A;  2D7R A;  4IRQ A;  5AJP A;  5AJN A;  1LQK A;  3LM4 A;  1NMM B;  3ISQ A;  2ICY A;  3USR A;  1FRO A;  3USQ A;  2Y4M A;  1FWY A;  3SXA A;  1F9Z A;  4JH2 A;  3OJJ A;  4DE7 A;  2P7K A; 
#chains in the Genus database with same CATH homology
 2XWL A;  4D0Z A;  2AH9 A;  4HO3 A;  1S4O A;  3I0G A;  1GWV A;  1H5S A;  3SXE A;  1FR8 A;  1PZY B;  1VH1 A;  1JYK A;  4FRP A;  5JQQ A;  1ZJ0 A;  5CQO A;  3BCV A;  1VGZ A;  3QVB A;  4FRE A;  5D92 A;  2AM5 A;  4FCE A;  1ZJ2 A;  4B3U A;  4KRV A;  1NF5 B;  3RMV A;  2V0H A;  1LVW A;  2AES A;  2FYB A;  3F1C A;  3PNN A;  1H4C A;  4M28 A;  4CJB A;  4KC1 A;  4HO0 A;  3I0E A;  2Z87 A;  3F1Y A;  4B4M A;  1EYR A;  2VD4 A;  1GQ9 A;  4FRM A;  3JTJ A;  1G2V A;  1GX4 A;  1H5S B;  1XHB A;  4AAW A;  1MC3 A;  5CQL X;  4HO8 A;  4FIX A;  3O3P A;  2BO6 A;  3I0L A;  1ZCV A;  2Z86 A;  5FTV A;  4DDZ A;  1H7L A;  1FGX A;  4FRA A;  3U0X A;  2A8W A;  1G3L A;  2VS5 A;  1SS9 A;  4J18 A;  2RJ8 A;  2Y4L A;  2MZB A;  2YCM A;  1JYL A;  2JCJ A;  2XMH A;  4MYB A;  1H7F A;  3POL A;  2VSI A;  3I0I X;  5C38 A;  3CKJ A;  3K8D A;  3R3I A;  1NHE B;  1K4V A;  3E25 A;  1TZF A;  3D98 A;  1XZ6 A;  1ON8 A;  2VS4 A;  2O1H A;  2DPW A;  2RJ5 A;  1O0R A;  2V0J A;  4Y64 A;  5IFY A;  1W57 A;  3DK5 A;  3SXC A;  3OH4 A;  3JUJ A;  3I0H A;  4C2S A;  3FWW A;  1FGG A;  5C1G A;  4ASY A;  2E8B A;  1FOA A;  1O7Q A;  1ZI1 A;  2FFV A;  5D91 A;  3CGX A;  3CU0 A;  1VZU A;  3IOH A;  3V0M A;  2BO7 A;  5C4C A;  2XME A;  3K8E A;  4B2X A;  5FYE A;  3OH3 A;  4EEO A;  1R7V A;  1R81 A;  3I0J A;  1TW1 A;  1R7Y A;  5C3B A;  1ZIZ A;  4FRQ A;  1MP3 A;  2YES A;  2QGI A;  3CKV A;  5EJ1 A;  4LW3 A;  4MND A;  3OH0 A;  4D11 C;  2V0K A;  1H7T A;  1G93 A;  4D0T A;  1QG8 A;  3ZF8 A;  4JIS A;  1ON6 A;  2YC5 A;  2JCO A;  4Y7F A;  4G3S A;  5C47 A;  4B5B A;  4NAL A;  3U2T A;  4KC2 A;  1VZT A;  2CU2 A;  3SXD A;  3V91 A;  2FYA A;  1LZJ A;  3T7M A;  1H5S D;  1H3M A;  4GBP A;  5C1H A;  2OI6 A;  2AE7 A;  3OH1 A;  4B2W A;  3JUK A;  4ECM A;  5FTS A;  2ZU7 A;  2RIX A;  5IDS A;  4ZDQ A;  2XWN A;  2Q4J A;  2C0N A;  2D7I A;  1IIN A;  4AYJ A;  1TVY A;  1H7G A;  2W0V A;  1INI A;  1R82 A;  4G3Q A;  5HS2 A;  5C4F A;  1ZHJ A;  1NKH B;  1LL3 A;  2YC3 A;  3ZLL A;  2GGO A;  4G87 A;  1YP3 A;  2FY7 A;  5BXC A;  4FCU A;  4Y63 A;  2WVM A;  4Y62 A;  2QKX A;  3V8Y A;  1O7O A;  4HCQ A;  3DJ4 A;  3ZGF A;  2AM3 A;  2I5K A;  2OEG A;  3GUE A;  5AJO A;  3I0D A;  3DUV A;  4EVW A;  2WAW A;  3V0Q A;  5C1L A;  3ZGG A;  1LL0 A;  2FFU A;  1ZDF A;  3OGZ A;  1WT0 A;  2VSH A;  4FIY A;  2J0B A;  4P00 A;  1HV9 A;  1G8O A;  5DDV A;  1H5T A;  1HM9 A;  2OI5 A;  4B4G A;  3ST8 A;  1WT2 A;  3R2W A;  5I1F A;  2RIZ A;  2J0A A;  4D48 A;  3N9W A;  1H7H A;  1YP4 A;  4R7P A;  2X5S A;  1MP5 A;  4Q7C A;  3TZT A;  4FRB A;  4L41 C;  4JD0 A;  1HM0 A;  2VXM A;  2P6W A;  1H7E A;  2RJ9 A;  2GGQ A;  2PA4 A;  2Y6P A;  3EE5 A;  1Z90 A;  1JVD A;  1VIC A;  1WVC A;  2RJ0 A;  3Q80 A;  2AGD A;  2UX8 A;  4Y7V A;  2FYC B;  2WVK A;  5CMI A;  5FU8 A;  4Y7T A;  5C3A A;  2QH5 A;  4FRO A;  1FXJ A;  2ZU8 A;  4HO9 A;  3U2X A;  1GQC A;  1PZT A;  5CMJ A;  1V82 A;  2NXV A;  3I0F A;  4NAI A;  1FO9 A;  1GX0 A;  4Y7G A;  4EEA A;  3D8V A;  3V0P A;  2I7B A;  4ASJ A;  2XWM A;  2X5Z A;  1QWJ A;  4AYL A;  3ZLK A;  4EE4 A;  2ZU9 A;  4KQL A;  1VGU A;  1VGW A;  2ICX A;  1OMZ A;  5C4D A;  1VGT A;  1LZ7 A;  1LL2 A;  2D0J A;  2WEE A;  2APC A;  4P02 A;  3SX5 A;  4KC4 A;  2PGV A;  2WE9 A;  2OEF A;  1ZJ1 A;  1G1L A;  4HOC A;  4MIX A;  1EZI A;  1GWW A;  2WGZ A;  3U2W A;  2Y4J A;  3RMW A;  2X60 A;  4M2A A;  2A8U A;  1GA8 A;  3CKN A;  4FQW A;  2YQJ A;  5FUH A;  1INJ A;  2VK9 A;  2PGY A;  1LZI A;  3IOJ A;  1E5K A;  2Y7A A;  3D5N A;  2I5E A;  5IDT A;  2JCL A;  3I0K A;  2O1G A;  4IRP A;  4Y7U A;  2OI7 A;  5EJZ A;  3U0Y A;  5CMF X;  1H7Q A;  4DEC A;  4KNR A;  4KPZ A;  1G23 A;  2VFZ A;  4CJC A;  1H4E A;  2V0I A;  4ARW A;  2RJ4 A;  2YQC A;  4HO6 A;  5C49 A;  3V0N A;  4UEG A;  4E1K A;  1TW5 A;  3HL3 A;  4EE5 A;  5CQM X;  1O23 B;  5C48 A;  4FRL A;  4FRD A;  4Y9X A;  3TQD A;  2BO4 A;  1HJL A;  3OH2 A;  1ZJP A;  1IIM A;  5CMG X;  4B42 A;  1LZ0 A;  3BRK X;  4O6N A;  4EEM A;  3SX3 A;  2YQH A;  2P72 A;  1FR9 A;  1VM8 A;  1H5S C;  1H4D A;  1S4P A;  3KIA A;  2P73 A;  3SX8 A;  3Q4S A;  1OMX A;  2RIY A;  1WSZ A;  4KXO A;  1FRW A;  5C4E A;  1ZCU A;  4KPX A;  2Y4K A;  1G0R A;  1JVG A;  1V84 A;  4EE3 A;  3PKP A;  1ZDG A;  2PX7 A;  3OKR A;  1S4N A;  4NAN A;  1H5R A;  2V0L A;  4BMA A;  1VPA A;  3U2V A;  4YS8 A;  4LW6 A;  1YRO B;  1HJJ A;  2W0W A;  4B4B A;  2BO8 A;  2X65 A;  4M4K A;  1W77 A;  4HO2 A;  4O6M A;  5FV9 A;  3PKQ A;  2AM4 A;  1VZX A;  4M2B A;  3I0C A;  5J49 A;  1R7T A;  1OQM B;  1ZI4 A;  1ZCT A;  4Y6N A;  4G3P A;  2RJ6 A;  1H5T B;  2E3D A;  3NGW A;  5C4B A;  3CKO A;  3V90 A;  5C8R A;  3U2U A;  1NWG B;  1ZJ3 A;  1H5R B;  4K6R A;  3FOQ A;  5CQP A;  4AC3 A;  3SXB A;  1ZJO A;  3Q7U A;  5L6V A;  4Y6U A;  1JV3 A;  1R80 A;  3OAM A;  2O1F A;  3SXG A;  4D11 A;  2YQS A;  4BQH A;  4HO4 A;  3OC9 A;  4XWI A;  3T7O A;  3CKQ A;  4KNX A;  1YP2 A;  1ZCY A;  3E26 A;  1QGS A;  3IOI A;  1KWS A;  1QGQ A;  2FYD B;  1V83 A;  2JCK A;  1FO8 A;  1FZW A;  1VH3 A;  2WVL A;  4HG6 A;  1JV1 A;  3LW6 A;  4NAK A;  2RIT A;  5FU0 A;  1R7X A;  1WT1 A;  4HO5 A;  2VXL A;  1WT3 A;  1FG5 N;  5EIY A;  1G97 A;  5CQN X;  3V8Z A;  1FXO A;  1I52 A;  1G95 A;  4FRH A;  5L6S A;  4KT7 A;  1HM8 A;  4CJ8 A;  5C3D A;  3T7N A;  5C36 A;  1R7U A;  1G9R A;  1MP4 A;  1W55 A;  5CMH A;  4EEG A;  2RJ7 A;  2AEC A;  3V0L A;  5DDT A;  4CVH A;  3SPT A;  1ZI3 A;  3V0O A;  2VS3 A;  3SX7 A;  3RSB A;  1NQI B;  2RJ1 A;  1ZI5 A;  2D7R A;  4IRQ A;  5AJP A;  5AJN A;  1NMM B;  2ICY A;  3USR A;  3USQ A;  2Y4M A;  1FWY A;  3SXA A;  4DE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...