2APCA

Crystal structure of n-acetylglucosaminyltransferase i in complex with udp-glcnac phosphonate
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
342
structure length
342
Chain Sequence
AVIPILVIACDRSTVRRCLDKLLHYRPSAELFPIIVSQDCGHEETAQVIASYGSAVTHIRQPDLSNIAVQPDHRKFQGYYKIARHYRWALGQIFHNFNYPAAVVVEDDLEVAPDFFEYFQATYPLLKADPSLWCVSAWNDNGKEQMVDSSKPELLYRTDFFPGLGWLLLAELWAELEPKWPKAFWDDWMRRPEQRKGRACVRPEISRTMTFGRKGVSHGQFFDQHLKFIKLNQQFVPFTQLDLSYLQQEAYDRDFLARVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIVTFLFRGRRVHLAPPQTWDGYDPSWT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminylt
publication title X-ray Crystal Structures of Rabbit N-acetylglucosaminyltransferase I (GnT I) in Complex with Donor Substrate Analogues.
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 113
structure length 342
sequence length 342
ec nomenclature ec 2.4.1.101: Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase.
pdb deposition date 2005-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.180.20 Alpha Beta Roll 2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1 N-Acetylglucosaminyltransferase I, Domain 2 2apcA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2apcA01
3V0LA 4B2XA 3V0OA 1FOAA 3I0FA 4CJ8A 1HM8A 4ZDQA 3JUKA 1FZWA 4KT7A 2Z87A 2VS3A 4B5BA 2APCA 1LL3A 2UX8A 1SS9A 4P02A 5FUHA 2Z86A 3U0YA 4B4BA 1O0RA 3SXBA 3IOHA 3OH1A 2I5KA 1GX4A 1JVDA 2AE7A 1H4DA 4HO4A 2V0KA 3U2XA 4CVHA 1H7HA 4Y7GA 3V90A 1LZJA 1MC3A 5CMFX 3U2TA 1OQMB 1YP2A 1NWGB 3SXCA 3V8YA 4HO6A 1TW1A 1VGUA 3JUJA 5CMIA 4Y9XA 2FY7A 2OI6A 3V0NA 5EJ1A 4Y6NA 5C3DA 1G95A 2AGDA 2PGYA 2AM5A 1O7QA 5CQOA 5J49A 4D11A 1TVYA 2X65A 3PKQA 2VSIA 4UEGA 3T7NA 5FTVA 1VZTA 1V83A 1VGZA 1PZTA 1ZHJA 2P6WA 5C3AA 4KQLA 2P73A 2O1HA 3KIAA 3T7OA 1TW5A 1Z90A 3USQA 5JQQA 1QG8A 3SXEA 3TZTA 1H5SA 1WSZA 4FRBA 1ON6A 2D0JA 3JTJA 3V0QA 1NHEB 1R7UA 2RIYA 2VXMA 3I0KA 5DDTA 1R7TA 1ON8A 3U2UA 3OKRA 2P72A 3FWWA 2XWLA 2YESA 5CQNX 2GGQA 4M2AA 4FRQA 1G2VA 4FRPA 1VZUA 4L41C 4EEAA 4D11C 2OEGA 3V0PA 4ECMA 2FYDB 4B42A 4KPXA 5IFYA 1R7VA 2WEEA 1NF5B 2VFZA 3CU0A 1WVCA 5FU0A 2AH9A 1VH1A 2MZBA 3D8VA 2YC3A 1VM8A 3RMWA 1HJLA 3SX5A 1H5SC 4P00A 3GUEA 4LW6A 3SX3A 4JD0A 2XWMA 4D0ZA 2FYBA 5CQPA 5CQMX 1FXJA 5C49A 1GWWA 3U0XA 1YP4A 4HO0A 4KXOA 1E5KA 2RJ9A 3OAMA 4ASJA 4FQWA 3QVBA 4K6RA 1GX0A 5HS2A 1LL0A 2Y7AA 4AC3A 2QGIA 3R3IA 1HJJA 3RMVA 1H7FA 2A8UA 4HO9A 1IINA 1JV3A 2Y4JA 1EYRA 4G87A 4EE5A 4EVWA 1LVWA 2ZU9A 1K4VA 4J18A 1OMZA 3RSBA 1S4PA 4EE4A 3I0IX 1H5TB 4AYJA 4FRAA 1H7EA 1ZI3A 4MNDA 2BO8A 4C2SA 2ICXA 1G8OA 4G3SA 2OI7A 3D5NA 5C1HA 4D48A 1R82A 1OMXA 4Y7VA 4HCQA 2RJ0A 2FFVA 3CKVA 3PKPA 3I0DA 2ZU7A 2YQJA 1WT0A 2PX7A 3OH0A 4KNXA 2O1GA 1I52A 2V0JA 1H3MA 2FYCB 2I5EA 4YS8A 1NKHB 3I0GA 4FRHA 4D0TA 5EIYA 1ZJ2A 1H5RA 1G9RA 1WT1A 4M28A 2WAWA 4M4KA 4Y7FA 4FCUA 5C8RA 3OH4A 3OGZA 1G97A 4Y64A 2VSHA 4HO2A 3ZGGA 3SPTA 2Y4MA 1WT2A 3CKQA 5IDTA 3K8EA 1PZYB 3OH2A 4KC2A 4B2WA 2OEFA 2X5ZA 3ZF8A 2Q4JA 3CKOA 1H5SB 4KC1A 5C38A 4FROA 1ZDFA 4NAIA 3DUVA 5DDVA 3V91A 4NALA 1VICA 5C47A 1XZ6A 4BQHA 4R7PA 1G93A 1IIMA 2W0VA 3DJ4A 2PA4A 2WVKA 5C3BA 4JISA 2AM4A 5IDSA 4DE7A 5C4CA 1GQCA 1JVGA 2RIXA 4AYLA 3N9WA 2D7IA 1MP3A 4FREA 3F1YA 5FTSA 2AECA 3SX8A 3V0MA 5FV9A 2ICYA 4B4MA 5C4DA 2BO6A 1H5SD 3IOJA 2RJ8A 5C1GA 3O3PA 3HL3A 4Y7TA 4Y6UA 5AJPA 3V8ZA 5I1FA 2RJ5A 3BCVA 1HV9A 4AAWA 1O23B 1VH3A 3T7MA 1YP3A 2D7RA 1ZJPA 4HOCA 1WT3A 3U2VA 2RJ1A 2VS4A 2E8BA 2ZU8A 3SXDA 4IRPA 1ZCTA 3D98A 1KWSA 4B3UA 1HM0A 2RJ4A 2WE9A 2XMEA 1W77A 2GGOA 2BO7A 3I0CA 3F1CA 2VXLA 3ZGFA 2V0IA 2PGVA 1JYLA 4EE3A 2WVLA 1GA8A 3I0HA 4KPZA 2A8WA 3POLA 3OH3A 1FR8A 2YQSA 1LL2A 2NXVA 3LW6A 1VZXA 4NANA 5AJOA 3SXGA 1NMMB 4HO3A 1ZIZA 4B4GA 4KC4A 2YQCA 1LZ0A 1G1LA 1S4NA 2JCKA 4CJCA 1O7OA 4KNRA 4M2BA 4E1KA 3U2WA 3USRA 4IRQA 2JCLA 1XHBA 4NAKA 5FU8A 1H7QA 3NGWA 1FG5N 2YQHA 3SXAA 4MYBA 1FO8A 1S4OA 4XWIA 2XWNA 2E3DA 2Y6PA 3EE5A 3R2WA 1ZCVA 1ZI5A 3ZLLA 4ARWA 3OC9A 1FGGA 1H7GA 3CKJA 5L6VA 2CU2A 5FYEA 1INJA 5CMJA 2RJ7A 2JCOA 1LZIA 1QGSA 2WGZA 3CKNA 4ASYA 1ZCYA 1FO9A 1R80A 2I7BA 1EZIA 1H5RB 1FR9A 1H7TA 4DECA 1GWVA 1TZFA 4GBPA 2OI5A 2X5SA 3FOQA 2BO4A 1VGTA 2RJ6A 4EEOA 5CQLX 1V82A 1MP4A 1ZI1A 3I0LA 1G3LA 3I0JA 1H7LA 1ZDGA 5CMGX 5C36A 3Q7UA 4EEMA 2FFUA 1ZJ3A 2FYAA 1R7YA 2VS5A 1VGWA 1MP5A 3Q4SA 2Y4LA 1ZJOA 1FRWA 4Y62A 1FXOA 2WVMA 3TQDA 1FWYA 4FRDA 5C48A 3Q80A 4KRVA 4FCEA 2VD4A 2W0WA 1QGQA 2O1FA 5CMHA 4HO8A 3SX7A 1W55A 3IOIA 3ST8A 1JV1A 1QWJA 1FGXA 1ZJ1A 1ZJ0A 4FRMA 1YROB 1G23A 2QH5A 1ZCUA 3K8DA 2V0HA 4Y7UA 5C4EA 4G3PA 2V0LA 1G0RA 1HM9A 2YCMA 3PNNA 3BRKX 2AESA 2XMHA 4BMAA 1H4CA 5AJNA 1INIA 1ZI4A 3DK5A 2QKXA 1R81A 4Y63A 4DDZA 1GQ9A 1LZ7A 4CJBA 3E26A 1W57A 5L6SA 4HG6A 2RIZA 4HO5A 2DPWA 1H4EA 2JCJA 5C4BA 3CGXA 4FRLA 2Y4KA 5C4FA 3ZLKA 2X60A 2YC5A 1VPAA 2RITA 4G3QA 1V84A 5BXCA 5C1LA 3E25A 1R7XA 1JYKA 2AM3A 4EEGA 1NQIB 3I0EA 4LW3A 5EJZA 1H5TA
chains in the Genus database with same CATH superfamily
3V0LA 4B2XA 3V0OA 1FOAA 1ZSWA 3B59A 1KNDA 3I0FA 4JH5A 1HM8A 4CJ8A 1SQDA 3EY7A 4ZDQA 4G6XA 4IR0A 3JUKA 2P25A 1FZWA 4KT7A 3KOLA 2Z87A 3W0UA 3OUMA 2VS3A 2RK9A 1JIEA 4B5BA 2WL3A 2APCA 1LL3A 2UX8A 1SS9A 1KNFA 4P02A 2Z86A 5FUHA 3U0YA 4B4BA 1O0RA 2RK0A 1KW9B 3SXBA 1LQKA 3IOHA 3OH1A 2I5KA 1GX4A 1JVDA 2AE7A 3ZW5A 1H4DA 4HO4A 2V0KA 1MPYA 3U2XA 4CVHA 1H7HA 1R9CA 4Y7GA 3V90A 1LZJA 1MC3A 5CMFX 3U2TA 1OQMB 1YP2A 1NWGB 3SXCA 3HUHA 3V8YA 3RRIA 4HO6A 1TW1A 1VGUA 3JUJA 5CMIA 4Y9XA 2QH0A 4PAVA 3RHEA 2FY7A 4Z6ZA 1QINA 2OI6A 3V0NA 1LGTA 5EJ1A 4Y6NA 3FCDA 5C3DA 1G95A 2AGDA 2PGYA 2AM5A 1O7QA 3GHJA 5CQOA 3HNQA 5J49A 5BWGA 4D11A 1TVYA 2X65A 3HPVA 3PKQA 2VSIA 1EIRA 4UEGA 5FTVA 4JH8A 1VZTA 3T7NA 1V83A 1VGZA 1PZTA 1ZHJA 1KWCB 2P6WA 5C3AA 1F1XA 4KQLA 4N04A 2A4WA 2P73A 2A4XA 2O1HA 3KIAA 3T7OA 3ECKA 5C4PA 1TW5A 1Z90A 5C68A 3USQA 5JQQA 4NB1A 1QG8A 1NPBA 3SXEA 3TZTA 2ZI8A 1H5SA 1WSZA 4FRBA 1JC5A 5CB9A 1ON6A 2D0JA 3JTJA 3V0QA 2Q48A 1NHEB 3HPYA 1R7UA 2RIYA 2VXMA 3GM5A 3I0KA 5DDTA 4Z6RA 1R7TA 1ON8A 3U2UA 3L20A 3OKRA 3ZGJA 4NB0A 4PV5A 2P72A 3FWWA 2XWLA 2YESA 5CQNX 2GGQA 5D92A 4KYHA 2ZW7A 2EI0A 3R6AA 2ZW6A 4M2AA 4FRQA 1G2VA 4FRPA 2P7MA 1VZUA 4L41C 4EEAA 4D11C 3LM4A 2OEGA 4Z6PA 3V0PA 4ECMA 1XQAA 2FYDB 4B42A 4KPXA 5IFYA 1R7VA 2WEEA 1NF5B 2VFZA 3CU0A 1WVCA 5FU0A 1K4NA 2AH9A 1VH1A 4KYKA 2MZBA 2R6UA 3D8VA 2YC3A 1VM8A 3RMWA 1HJLA 3SX5A 1H5SC 4P00A 3GUEA 1Q0CA 4GHGA 4LW6A 3SX3A 4JD0A 2XWMA 4D0ZA 2FYBA 5CQPA 5CQMX 1EIQA 1LQOA 1FXJA 5C49A 5D4FA 3P8AA 1GWWA 3U0XA 1YP4A 4HO0A 4KXOA 3PKXA 1TG5A 1E5KA 4IAGA 2RJ9A 3OAMA 4ASJA 4FQWA 4HC5A 4JH9A 3QVBA 4K6RA 1FA7A 1GX0A 5HS2A 1LL0A 2Y7AA 4AC3A 2QGIA 4MYMA 3R3IA 1HJJA 3RMVA 1H7FA 2A8UA 4Z6NA 1F9ZA 4HO9A 1IINA 1JV3A 2Y4JA 1EYRA 4MTTA 4G87A 4EE5A 4EVWA 1LVWA 2ZU9A 1K4VA 4J18A 1OMZA 3RSBA 2IG9A 1S4PA 1BH5A 2IGAA 4RT5A 4EE4A 4MTSA 4Z6WA 2WL9A 3I0IX 1H5TB 3CT8A 4AYJA 4FRAA 1H7EA 1ZI3A 4FIXA 4MNDA 2BO8A 4C2SA 2ICXA 1G8OA 4Q7CA 3E5DA 1ECSA 1JIFA 4G3SA 1U69A 2OI7A 3D5NA 4HUZA 5C1HA 4D48A 1KWBB 1R82A 1OMXA 4Y7VA 4HCQA 2RJ0A 3W0TA 3R4QA 4GHHA 2FFVA 3CKVA 3PKPA 5CTOA 3I0DA 2ZU7A 2YQJA 2EI2A 3E0RA 1WT0A 2PX7A 3ECJA 3OH0A 2ZW5A 4KNXA 2O1GA 1I52A 1T47A 2V0JA 1H3MA 2FYCB 1XY7A 2P7QA 1Q0OA 3BZAA 2I5EA 4QB5A 2J0BA 4YS8A 1NKHB 3I0GA 4FRHA 4D0TA 5EIYA 1ZJ2A 1H5RA 1G9RA 1WT1A 4M28A 4JH7A 2WAWA 4M4KA 4OPNA 4Y7FA 4FCUA 5C8RA 3OH4A 5HCWA 3OGZA 1G97A 4Y64A 3ISQA 2VSHA 4HO2A 2P7LA 3ZGGA 3OJNA 3SPTA 2Y4MA 1WT2A 3ZI1A 3CKQA 4GYMA 3VB0A 5IDTA 3K8EA 1PZYB 1KMZA 4Z6QA 3OH2A 4KC2A 4B2WA 2OEFA 2X5ZA 3ZF8A 4JH4A 2Q4JA 3CKOA 1H5SB 4KC1A 2ZW4A 5C38A 2EI3A 4FROA 4GHCA 5DFGA 1ZDFA 4NAIA 3DUVA 5DDVA 2ZHPA 3V91A 4NALA 1VICA 3IUZA 1XZ6A 5C47A 1LQPA 3G12A 4BQHA 4GHFA 3PKWA 4R7PA 1TWUA 1FA6A 1G93A 1KW6B 1IIMA 2W0VA 2PA4A 2WVKA 3DJ4A 5C3BA 4JISA 4GHEA 2AM4A 2EI1A 5IDSA 4DE7A 5C4CA 1FROA 1GQCA 2P7PA 1JVGA 2RIXA 4AYLA 3N9WA 5EC3A 2D7IA 1MP3A 3SK2A 4FREA 4NVSA 3F1YA 5FTSA 2AECA 3SX8A 3V0MA 2QQZA 5FV9A 2ICYA 4B4MA 5C4DA 2BO6A 1H5SD 3IOJA 2RJ8A 5C1GA 3O3PA 3HL3A 4Y7TA 1F1RA 4Z04A 1KW3B 4Y6UA 2J0AA 5AJPA 3V8ZA 5I1FA 5DHWA 1KMYA 4Z6UA 2RJ5A 1DHYA 3OJTA 3BCVA 1HV9A 4AAWA 1O23B 4JH6A 1XRKA 1VH3A 3HDPA 3T7MA 1YP3A 2QNTA 2D7RA 1ZJPA 4HOCA 1WT3A 3VW9A 2RJ1A 3U2VA 2VS4A 5D91A 1NKIA 2RJBA 2E8BA 2ZU8A 3SXDA 1HANA 1EILA 4IRPA 5F6QA 1ZCTA 3D98A 1KWSA 4B3UA 1HM0A 2RJ4A 2WE9A 2XMEA 1W77A 2GGOA 2BO7A 3I0CA 4GHDA 2VXLA 3F1CA 3ZGFA 3BQXA 2V0IA 1JC4A 2PGVA 1JYLA 4EE3A 2WVLA 1GA8A 3I0HA 4KPZA 2A8WA 3HQ0A 3POLA 3OH3A 5CJ3A 1FR8A 2YQSA 4LQBA 1LL2A 2NXVA 3LW6A 1VZXA 4NANA 5AJOA 3SXGA 1NMMB 4HO3A 1ZIZA 4B4GA 4KC4A 2YQCA 1FA8A 2RBBA 3OJJA 1LZ0A 1G1LA 1S4NA 4MTRA 1BYLA 2JCKA 4CJCA 1O7OA 4KNRA 1TFZA 4X2AA 4M2BA 4E1KA 3U2WA 3USRA 3OJKA 1NNRA 4IRQA 3OA4A 2JCLA 1XHBA 4Z6OA 4NAKA 4O6MA 5FU8A 1H7QA 3NGWA 2PJSA 4JH2A 1FG5N 2YQHA 3SXAA 4Z6LA 4MYBA 1FO8A 1S4OA 4XWIA 4JH3A 2XWNA 2E3DA 2Y6PA 2R5VA 4Z6TA 3EE5A 3R2WA 1ZCVA 1ZI5A 3ZLLA 4ARWA 3OC9A 1FGGA 4Z6MA 1H7GA 3CKJA 1SS4A 4MIXA 5DRHA 2CU2A 5L6VA 5FYEA 1INJA 5CMJA 2RJ7A 1QIPA 2JCOA 1KLLA 2ZA0A 2C21A 1LZIA 1QGSA 4NB2A 2WGZA 3CKNA 1SP8A 4ASYA 1ZCYA 2VK9A 1FO9A 2P7KA 1R80A 1F1UA 2I7BA 1EZIA 1H5RB 1FR9A 1H7TA 4DECA 1GWVA 1TZFA 3OULA 4GBPA 2OI5A 2X5SA 3FOQA 2BO4A 1CJXA 1VGTA 2RJ6A 4EEOA 5CQLX 2EHZA 1V82A 1SQIA 1MP4A 4NAYA 1ZI1A 1G3LA 3I0LA 5KEFA 3I0JA 1SP9A 2C0NA 1H7LA 1ZDGA 5CMGX 1F1VA 3Q7UA 5C36A 4EEMA 2FFUA 1ZJ3A 2FYAA 1R7YA 2VS5A 1VGWA 1MP5A 3Q4SA 2Y4LA 1U6LA 2ZYQA 4FIYA 1ZJOA 1EWJA 1QTOA 1FRWA 4Y62A 1FXOA 4O6NA 2WVMA 3TQDA 1FWYA 4NAZA 4FRDA 5C48A 3Q80A 4KRVA 4FCEA 2VD4A 2W0WA 1QGQA 2O1FA 1FA5A 5CMHA 4HO8A 3SX7A 1W55A 1TSJA 3EY8A 3IOIA 3ST8A 4JH1A 3OPYA 1JV1A 4JD1A 1QWJA 1FGXA 1ZJ1A 1ZJ0A 4FRMA 1YROB 1G23A 2QH5A 1ZCUA 3K8DA 2V0HA 4Y7UA 5C4EA 4MTQA 4G3PA 2V0LA 1G0RA 1HM9A 2YCMA 3PNNA 3BRKX 3OPYB 2AESA 2XMHA 4BMAA 1H4CA 5AJNA 1INIA 1ZI4A 1MH6A 3DK5A 2QKXA 1R81A 4Y63A 4DDZA 1GQ9A 4Z6SA 1LZ7A 4CJBA 3E26A 1LKDA 1W57A 5L6SA 3L7TA 4HG6A 1NIQB 2RIZA 4HO5A 3OXHA 5BWHA 2DPWA 1H4EA 2JCJA 2P7OA 5C4BA 4Z6VA 3CGXA 4FRLA 3RMUA 2I7RA 2Y4KA 5C6XA 5C4FA 1KW8B 3LHOA 5D7ZA 3OAJA 2X60A 2YC5A 1VPAA 3ZLKA 2RITA 4G3QA 1V84A 5BXCA 5C1LA 3PKVA 3E25A 1R7XA 1JYKA 2AM3A 4EEGA 1NQIB 3I0EA 4LW3A 5EJZA 1H5TA
chains in the Genus database with same CATH topology
3V0LA 4B2XA 3V0OA 1FOAA 3I0FA 4CJ8A 1HM8A 4ZDQA 3JUKA 1FZWA 4KT7A 2Z87A 2VS3A 4B5BA 2APCA 1LL3A 2UX8A 1SS9A 4P02A 5FUHA 2Z86A 3U0YA 4B4BA 1O0RA 3SXBA 3IOHA 3OH1A 2I5KA 1GX4A 1JVDA 2AE7A 1H4DA 4HO4A 2V0KA 3U2XA 4CVHA 1H7HA 4Y7GA 3V90A 1LZJA 1MC3A 5CMFX 3U2TA 1OQMB 1YP2A 1NWGB 3SXCA 3V8YA 4HO6A 1TW1A 1VGUA 3JUJA 5CMIA 4Y9XA 2FY7A 2OI6A 3V0NA 5EJ1A 4Y6NA 5C3DA 1G95A 2AGDA 2PGYA 2AM5A 1O7QA 5CQOA 5J49A 4D11A 1TVYA 2X65A 3PKQA 2VSIA 4UEGA 3T7NA 5FTVA 1VZTA 1V83A 1VGZA 1PZTA 1ZHJA 2P6WA 5C3AA 4KQLA 2P73A 2O1HA 3KIAA 3T7OA 1TW5A 1Z90A 3USQA 5JQQA 1QG8A 3SXEA 3TZTA 1H5SA 1WSZA 4FRBA 1ON6A 2D0JA 3JTJA 3V0QA 1NHEB 1R7UA 2RIYA 2VXMA 3I0KA 5DDTA 1R7TA 1ON8A 3U2UA 3OKRA 2P72A 3FWWA 2XWLA 2YESA 5CQNX 2GGQA 5D92A 4M2AA 4FRQA 1G2VA 4FRPA 1VZUA 4L41C 4EEAA 4D11C 2OEGA 3V0PA 4ECMA 2FYDB 4B42A 4KPXA 5IFYA 1R7VA 2WEEA 1NF5B 2VFZA 3CU0A 1WVCA 5FU0A 2AH9A 1VH1A 2MZBA 3D8VA 2YC3A 1VM8A 3RMWA 1HJLA 3SX5A 1H5SC 4P00A 3GUEA 4LW6A 3SX3A 4JD0A 2XWMA 4D0ZA 2FYBA 5CQPA 5CQMX 1FXJA 5C49A 1GWWA 3U0XA 1YP4A 4HO0A 4KXOA 1E5KA 2RJ9A 3OAMA 4ASJA 4FQWA 3QVBA 4K6RA 1GX0A 5HS2A 1LL0A 2Y7AA 4AC3A 2QGIA 3R3IA 1HJJA 3RMVA 1H7FA 2A8UA 4HO9A 1IINA 1JV3A 2Y4JA 1EYRA 4G87A 4EE5A 4EVWA 1LVWA 2ZU9A 1K4VA 4J18A 1OMZA 3RSBA 1S4PA 4EE4A 3I0IX 1H5TB 4AYJA 4FRAA 1H7EA 1ZI3A 4FIXA 4MNDA 2BO8A 4C2SA 2ICXA 1G8OA 4Q7CA 4G3SA 2OI7A 3D5NA 5C1HA 4D48A 1R82A 1OMXA 4Y7VA 4HCQA 2RJ0A 2FFVA 3CKVA 3PKPA 3I0DA 2ZU7A 2YQJA 1WT0A 2PX7A 3OH0A 4KNXA 2O1GA 1I52A 2V0JA 1H3MA 2FYCB 2I5EA 2J0BA 4YS8A 1NKHB 3I0GA 4FRHA 4D0TA 5EIYA 1ZJ2A 1H5RA 1G9RA 1WT1A 4M28A 2WAWA 4M4KA 4Y7FA 4FCUA 5C8RA 3OH4A 3OGZA 1G97A 4Y64A 2VSHA 4HO2A 3ZGGA 3SPTA 2Y4MA 1WT2A 3CKQA 5IDTA 3K8EA 1PZYB 3OH2A 4KC2A 4B2WA 2OEFA 2X5ZA 3ZF8A 2Q4JA 3CKOA 1H5SB 4KC1A 5C38A 4FROA 1ZDFA 4NAIA 3DUVA 5DDVA 3V91A 4NALA 1VICA 5C47A 1XZ6A 4BQHA 4R7PA 1G93A 1IIMA 2W0VA 3DJ4A 2PA4A 2WVKA 5C3BA 4JISA 2AM4A 5IDSA 4DE7A 5C4CA 1GQCA 1JVGA 2RIXA 4AYLA 3N9WA 2D7IA 1MP3A 4FREA 3F1YA 5FTSA 2AECA 3SX8A 3V0MA 5FV9A 2ICYA 4B4MA 5C4DA 2BO6A 1H5SD 3IOJA 2RJ8A 5C1GA 3O3PA 3HL3A 4Y7TA 4Y6UA 2J0AA 5AJPA 3V8ZA 5I1FA 2RJ5A 3BCVA 1HV9A 4AAWA 1O23B 1VH3A 3T7MA 1YP3A 2D7RA 1ZJPA 4HOCA 1WT3A 3U2VA 2RJ1A 2VS4A 5D91A 2E8BA 2ZU8A 3SXDA 4IRPA 1ZCTA 3D98A 1KWSA 4B3UA 1HM0A 2RJ4A 2WE9A 2XMEA 1W77A 2GGOA 2BO7A 3I0CA 3F1CA 2VXLA 3ZGFA 2V0IA 2PGVA 1JYLA 4EE3A 2WVLA 1GA8A 3I0HA 4KPZA 2A8WA 3POLA 3OH3A 1FR8A 2YQSA 1LL2A 2NXVA 3LW6A 1VZXA 4NANA 5AJOA 3SXGA 1NMMB 4HO3A 1ZIZA 4B4GA 4KC4A 2YQCA 1LZ0A 1G1LA 1S4NA 2JCKA 4CJCA 1O7OA 4KNRA 4M2BA 4E1KA 3U2WA 3USRA 4IRQA 2JCLA 1XHBA 4NAKA 4O6MA 5FU8A 1H7QA 3NGWA 1FG5N 2YQHA 3SXAA 4MYBA 1FO8A 1S4OA 4XWIA 2XWNA 2E3DA 2Y6PA 3EE5A 3R2WA 1ZCVA 1ZI5A 3ZLLA 4ARWA 3OC9A 1FGGA 1H7GA 3CKJA 4MIXA 5L6VA 2CU2A 5FYEA 1INJA 5CMJA 2RJ7A 2JCOA 1LZIA 1QGSA 2WGZA 3CKNA 4ASYA 1ZCYA 2VK9A 1FO9A 1R80A 2I7BA 1EZIA 1H5RB 1FR9A 1H7TA 4DECA 1GWVA 1TZFA 4GBPA 2OI5A 2X5SA 3FOQA 2BO4A 1VGTA 2RJ6A 4EEOA 5CQLX 1V82A 1MP4A 1ZI1A 3I0LA 1G3LA 3I0JA 2C0NA 1H7LA 1ZDGA 5CMGX 5C36A 3Q7UA 4EEMA 2FFUA 1ZJ3A 2FYAA 1R7YA 2VS5A 1VGWA 1MP5A 3Q4SA 2Y4LA 4FIYA 1ZJOA 1FRWA 4Y62A 1FXOA 4O6NA 2WVMA 3TQDA 1FWYA 4FRDA 5C48A 3Q80A 4KRVA 4FCEA 2VD4A 2W0WA 1QGQA 2O1FA 5CMHA 4HO8A 3SX7A 1W55A 3IOIA 3ST8A 1JV1A 1QWJA 1FGXA 1ZJ1A 1ZJ0A 4FRMA 1YROB 1G23A 2QH5A 1ZCUA 3K8DA 2V0HA 4Y7UA 5C4EA 4G3PA 2V0LA 1G0RA 1HM9A 2YCMA 3PNNA 3BRKX 2AESA 2XMHA 4BMAA 1H4CA 5AJNA 1INIA 1ZI4A 3DK5A 2QKXA 1R81A 4Y63A 4DDZA 1GQ9A 1LZ7A 4CJBA 3E26A 1W57A 5L6SA 4HG6A 2RIZA 4HO5A 2DPWA 1H4EA 2JCJA 5C4BA 3CGXA 4FRLA 2Y4KA 5C4FA 3ZLKA 2X60A 2YC5A 1VPAA 2RITA 4G3QA 1V84A 5BXCA 5C1LA 3E25A 1R7XA 1JYKA 2AM3A 4EEGA 1NQIB 3I0EA 4LW3A 5EJZA 1H5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V0L A;  4B2X A;  3V0O A;  1FOA A;  3I0F A;  4CJ8 A;  1HM8 A;  4ZDQ A;  3JUK A;  1FZW A;  4KT7 A;  2Z87 A;  2VS3 A;  4B5B A;  2APC A;  1LL3 A;  2UX8 A;  1SS9 A;  4P02 A;  5FUH A;  2Z86 A;  3U0Y A;  4B4B A;  1O0R A;  3SXB A;  3IOH A;  3OH1 A;  2I5K A;  1GX4 A;  1JVD A;  2AE7 A;  1H4D A;  4HO4 A;  2V0K A;  3U2X A;  4CVH A;  1H7H A;  4Y7G A;  3V90 A;  1LZJ A;  1MC3 A;  5CMF X;  3U2T A;  1OQM B;  1YP2 A;  1NWG B;  3SXC A;  3V8Y A;  4HO6 A;  1TW1 A;  1VGU A;  3JUJ A;  5CMI A;  4Y9X A;  2FY7 A;  2OI6 A;  3V0N A;  5EJ1 A;  4Y6N A;  5C3D A;  1G95 A;  2AGD A;  2PGY A;  2AM5 A;  1O7Q A;  5CQO A;  5J49 A;  4D11 A;  1TVY A;  2X65 A;  3PKQ A;  2VSI A;  4UEG A;  3T7N A;  5FTV A;  1VZT A;  1V83 A;  1VGZ A;  1PZT A;  1ZHJ A;  2P6W A;  5C3A A;  4KQL A;  2P73 A;  2O1H A;  3KIA A;  3T7O A;  1TW5 A;  1Z90 A;  3USQ A;  5JQQ A;  1QG8 A;  3SXE A;  3TZT A;  1H5S A;  1WSZ A;  4FRB A;  1ON6 A;  2D0J A;  3JTJ A;  3V0Q A;  1NHE B;  1R7U A;  2RIY A;  2VXM A;  3I0K A;  5DDT A;  1R7T A;  1ON8 A;  3U2U A;  3OKR A;  2P72 A;  3FWW A;  2XWL A;  2YES A;  5CQN X;  2GGQ A;  4M2A A;  4FRQ A;  1G2V A;  4FRP A;  1VZU A;  4L41 C;  4EEA A;  4D11 C;  2OEG A;  3V0P A;  4ECM A;  2FYD B;  4B42 A;  4KPX A;  5IFY A;  1R7V A;  2WEE A;  1NF5 B;  2VFZ A;  3CU0 A;  1WVC A;  5FU0 A;  2AH9 A;  1VH1 A;  2MZB A;  3D8V A;  2YC3 A;  1VM8 A;  3RMW A;  1HJL A;  3SX5 A;  1H5S C;  4P00 A;  3GUE A;  4LW6 A;  3SX3 A;  4JD0 A;  2XWM A;  4D0Z A;  2FYB A;  5CQP A;  5CQM X;  1FXJ A;  5C49 A;  1GWW A;  3U0X A;  1YP4 A;  4HO0 A;  4KXO A;  1E5K A;  2RJ9 A;  3OAM A;  4ASJ A;  4FQW A;  3QVB A;  4K6R A;  1GX0 A;  5HS2 A;  1LL0 A;  2Y7A A;  4AC3 A;  2QGI A;  3R3I A;  1HJJ A;  3RMV A;  1H7F A;  2A8U A;  4HO9 A;  1IIN A;  1JV3 A;  2Y4J A;  1EYR A;  4G87 A;  4EE5 A;  4EVW A;  1LVW A;  2ZU9 A;  1K4V A;  4J18 A;  1OMZ A;  3RSB A;  1S4P A;  4EE4 A;  3I0I X;  1H5T B;  4AYJ A;  4FRA A;  1H7E A;  1ZI3 A;  4MND A;  2BO8 A;  4C2S A;  2ICX A;  1G8O A;  4G3S A;  2OI7 A;  3D5N A;  5C1H A;  4D48 A;  1R82 A;  1OMX A;  4Y7V A;  4HCQ A;  2RJ0 A;  2FFV A;  3CKV A;  3PKP A;  3I0D A;  2ZU7 A;  2YQJ A;  1WT0 A;  2PX7 A;  3OH0 A;  4KNX A;  2O1G A;  1I52 A;  2V0J A;  1H3M A;  2FYC B;  2I5E A;  4YS8 A;  1NKH B;  3I0G A;  4FRH A;  4D0T A;  5EIY A;  1ZJ2 A;  1H5R A;  1G9R A;  1WT1 A;  4M28 A;  2WAW A;  4M4K A;  4Y7F A;  4FCU A;  5C8R A;  3OH4 A;  3OGZ A;  1G97 A;  4Y64 A;  2VSH A;  4HO2 A;  3ZGG A;  3SPT A;  2Y4M A;  1WT2 A;  3CKQ A;  5IDT A;  3K8E A;  1PZY B;  3OH2 A;  4KC2 A;  4B2W A;  2OEF A;  2X5Z A;  3ZF8 A;  2Q4J A;  3CKO A;  1H5S B;  4KC1 A;  5C38 A;  4FRO A;  1ZDF A;  4NAI A;  3DUV A;  5DDV A;  3V91 A;  4NAL A;  1VIC A;  5C47 A;  1XZ6 A;  4BQH A;  4R7P A;  1G93 A;  1IIM A;  2W0V A;  3DJ4 A;  2PA4 A;  2WVK A;  5C3B A;  4JIS A;  2AM4 A;  5IDS A;  4DE7 A;  5C4C A;  1GQC A;  1JVG A;  2RIX A;  4AYL A;  3N9W A;  2D7I A;  1MP3 A;  4FRE A;  3F1Y A;  5FTS A;  2AEC A;  3SX8 A;  3V0M A;  5FV9 A;  2ICY A;  4B4M A;  5C4D A;  2BO6 A;  1H5S D;  3IOJ A;  2RJ8 A;  5C1G A;  3O3P A;  3HL3 A;  4Y7T A;  4Y6U A;  5AJP A;  3V8Z A;  5I1F A;  2RJ5 A;  3BCV A;  1HV9 A;  4AAW A;  1O23 B;  1VH3 A;  3T7M A;  1YP3 A;  2D7R A;  1ZJP A;  4HOC A;  1WT3 A;  3U2V A;  2RJ1 A;  2VS4 A;  2E8B A;  2ZU8 A;  3SXD A;  4IRP A;  1ZCT A;  3D98 A;  1KWS A;  4B3U A;  1HM0 A;  2RJ4 A;  2WE9 A;  2XME A;  1W77 A;  2GGO A;  2BO7 A;  3I0C A;  3F1C A;  2VXL A;  3ZGF A;  2V0I A;  2PGV A;  1JYL A;  4EE3 A;  2WVL A;  1GA8 A;  3I0H A;  4KPZ A;  2A8W A;  3POL A;  3OH3 A;  1FR8 A;  2YQS A;  1LL2 A;  2NXV A;  3LW6 A;  1VZX A;  4NAN A;  5AJO A;  3SXG A;  1NMM B;  4HO3 A;  1ZIZ A;  4B4G A;  4KC4 A;  2YQC A;  1LZ0 A;  1G1L A;  1S4N A;  2JCK A;  4CJC A;  1O7O A;  4KNR A;  4M2B A;  4E1K A;  3U2W A;  3USR A;  4IRQ A;  2JCL A;  1XHB A;  4NAK A;  5FU8 A;  1H7Q A;  3NGW A;  1FG5 N;  2YQH A;  3SXA A;  4MYB A;  1FO8 A;  1S4O A;  4XWI A;  2XWN A;  2E3D A;  2Y6P A;  3EE5 A;  3R2W A;  1ZCV A;  1ZI5 A;  3ZLL A;  4ARW A;  3OC9 A;  1FGG A;  1H7G A;  3CKJ A;  5L6V A;  2CU2 A;  5FYE A;  1INJ A;  5CMJ A;  2RJ7 A;  2JCO A;  1LZI A;  1QGS A;  2WGZ A;  3CKN A;  4ASY A;  1ZCY A;  1FO9 A;  1R80 A;  2I7B A;  1EZI A;  1H5R B;  1FR9 A;  1H7T A;  4DEC A;  1GWV A;  1TZF A;  4GBP A;  2OI5 A;  2X5S A;  3FOQ A;  2BO4 A;  1VGT A;  2RJ6 A;  4EEO A;  5CQL X;  1V82 A;  1MP4 A;  1ZI1 A;  3I0L A;  1G3L A;  3I0J A;  1H7L A;  1ZDG A;  5CMG X;  5C36 A;  3Q7U A;  4EEM A;  2FFU A;  1ZJ3 A;  2FYA A;  1R7Y A;  2VS5 A;  1VGW A;  1MP5 A;  3Q4S A;  2Y4L A;  1ZJO A;  1FRW A;  4Y62 A;  1FXO A;  2WVM A;  3TQD A;  1FWY A;  4FRD A;  5C48 A;  3Q80 A;  4KRV A;  4FCE A;  2VD4 A;  2W0W A;  1QGQ A;  2O1F A;  5CMH A;  4HO8 A;  3SX7 A;  1W55 A;  3IOI A;  3ST8 A;  1JV1 A;  1QWJ A;  1FGX A;  1ZJ1 A;  1ZJ0 A;  4FRM A;  1YRO B;  1G23 A;  2QH5 A;  1ZCU A;  3K8D A;  2V0H A;  4Y7U A;  5C4E A;  4G3P A;  2V0L A;  1G0R A;  1HM9 A;  2YCM A;  3PNN A;  3BRK X;  2AES A;  2XMH A;  4BMA A;  1H4C A;  5AJN A;  1INI A;  1ZI4 A;  3DK5 A;  2QKX A;  1R81 A;  4Y63 A;  4DDZ A;  1GQ9 A;  1LZ7 A;  4CJB A;  3E26 A;  1W57 A;  5L6S A;  4HG6 A;  2RIZ A;  4HO5 A;  2DPW A;  1H4E A;  2JCJ A;  5C4B A;  3CGX A;  4FRL A;  2Y4K A;  5C4F A;  3ZLK A;  2X60 A;  2YC5 A;  1VPA A;  2RIT A;  4G3Q A;  1V84 A;  5BXC A;  5C1L A;  3E25 A;  1R7X A;  1JYK A;  2AM3 A;  4EEG A;  1NQI B;  3I0E A;  4LW3 A;  5EJZ A;  1H5T A; 
#chains in the Genus database with same CATH topology
 3V0L A;  4B2X A;  3V0O A;  1FOA A;  1ZSW A;  3B59 A;  1KND A;  3I0F A;  4JH5 A;  1HM8 A;  4CJ8 A;  1SQD A;  3EY7 A;  4ZDQ A;  4G6X A;  4IR0 A;  3JUK A;  2P25 A;  1FZW A;  4KT7 A;  3KOL A;  2Z87 A;  3W0U A;  3OUM A;  2VS3 A;  2RK9 A;  1JIE A;  4B5B A;  2WL3 A;  2APC A;  1LL3 A;  2UX8 A;  1SS9 A;  1KNF A;  4P02 A;  2Z86 A;  5FUH A;  3U0Y A;  4B4B A;  1O0R A;  2RK0 A;  1KW9 B;  3SXB A;  1LQK A;  3IOH A;  3OH1 A;  2I5K A;  1GX4 A;  1JVD A;  2AE7 A;  3ZW5 A;  1H4D A;  4HO4 A;  2V0K A;  1MPY A;  3U2X A;  4CVH A;  1H7H A;  1R9C A;  4Y7G A;  3V90 A;  1LZJ A;  1MC3 A;  5CMF X;  3U2T A;  1OQM B;  1YP2 A;  1NWG B;  3SXC A;  3HUH A;  3V8Y A;  3RRI A;  4HO6 A;  1TW1 A;  1VGU A;  3JUJ A;  5CMI A;  4Y9X A;  2QH0 A;  4PAV A;  3RHE A;  2FY7 A;  4Z6Z A;  1QIN A;  2OI6 A;  3V0N A;  1LGT A;  5EJ1 A;  4Y6N A;  3FCD A;  5C3D A;  1G95 A;  2AGD A;  2PGY A;  2AM5 A;  1O7Q A;  3GHJ A;  5CQO A;  3HNQ A;  5J49 A;  5BWG A;  4D11 A;  1TVY A;  2X65 A;  3HPV A;  3PKQ A;  2VSI A;  1EIR A;  4UEG A;  5FTV A;  4JH8 A;  1VZT A;  3T7N A;  1V83 A;  1VGZ A;  1PZT A;  1ZHJ A;  1KWC B;  2P6W A;  5C3A A;  1F1X A;  4KQL A;  4N04 A;  2A4W A;  2P73 A;  2A4X A;  2O1H A;  3KIA A;  3T7O A;  3ECK A;  5C4P A;  1TW5 A;  1Z90 A;  5C68 A;  3USQ A;  5JQQ A;  4NB1 A;  1QG8 A;  1NPB A;  3SXE A;  3TZT A;  2ZI8 A;  1H5S A;  1WSZ A;  4FRB A;  1JC5 A;  5CB9 A;  1ON6 A;  2D0J A;  3JTJ A;  3V0Q A;  2Q48 A;  1NHE B;  3HPY A;  1R7U A;  2RIY A;  2VXM A;  3GM5 A;  3I0K A;  5DDT A;  4Z6R A;  1R7T A;  1ON8 A;  3U2U A;  3L20 A;  3OKR A;  3ZGJ A;  4NB0 A;  4PV5 A;  2P72 A;  3FWW A;  2XWL A;  2YES A;  5CQN X;  2GGQ A;  5D92 A;  4KYH A;  2ZW7 A;  2EI0 A;  3R6A A;  2ZW6 A;  4M2A A;  4FRQ A;  1G2V A;  4FRP A;  2P7M A;  1VZU A;  4L41 C;  4EEA A;  4D11 C;  3LM4 A;  2OEG A;  4Z6P A;  3V0P A;  4ECM A;  1XQA A;  2FYD B;  4B42 A;  4KPX A;  5IFY A;  1R7V A;  2WEE A;  1NF5 B;  2VFZ A;  3CU0 A;  1WVC A;  5FU0 A;  1K4N A;  2AH9 A;  1VH1 A;  4KYK A;  2MZB A;  2R6U A;  3D8V A;  2YC3 A;  1VM8 A;  3RMW A;  1HJL A;  3SX5 A;  1H5S C;  4P00 A;  3GUE A;  1Q0C A;  4GHG A;  4LW6 A;  3SX3 A;  4JD0 A;  2XWM A;  4D0Z A;  2FYB A;  5CQP A;  5CQM X;  1EIQ A;  1LQO A;  1FXJ A;  5C49 A;  5D4F A;  3P8A A;  1GWW A;  3U0X A;  1YP4 A;  4HO0 A;  4KXO A;  3PKX A;  1TG5 A;  1E5K A;  4IAG A;  2RJ9 A;  3OAM A;  4ASJ A;  4FQW A;  4HC5 A;  4JH9 A;  3QVB A;  4K6R A;  1FA7 A;  1GX0 A;  5HS2 A;  1LL0 A;  2Y7A A;  4AC3 A;  2QGI A;  4MYM A;  3R3I A;  1HJJ A;  3RMV A;  1H7F A;  2A8U A;  4Z6N A;  1F9Z A;  4HO9 A;  1IIN A;  1JV3 A;  2Y4J A;  1EYR A;  4MTT A;  4G87 A;  4EE5 A;  4EVW A;  1LVW A;  2ZU9 A;  1K4V A;  4J18 A;  1OMZ A;  3RSB A;  2IG9 A;  1S4P A;  1BH5 A;  2IGA A;  4RT5 A;  4EE4 A;  4MTS A;  4Z6W A;  2WL9 A;  3I0I X;  1H5T B;  3CT8 A;  4AYJ A;  4FRA A;  1H7E A;  1ZI3 A;  4FIX A;  4MND A;  2BO8 A;  4C2S A;  2ICX A;  1G8O A;  4Q7C A;  3E5D A;  1ECS A;  1JIF A;  4G3S A;  1U69 A;  2OI7 A;  3D5N A;  4HUZ A;  5C1H A;  4D48 A;  1KWB B;  1R82 A;  1OMX A;  4Y7V A;  4HCQ A;  2RJ0 A;  3W0T A;  3R4Q A;  4GHH A;  2FFV A;  3CKV A;  3PKP A;  5CTO A;  3I0D A;  2ZU7 A;  2YQJ A;  2EI2 A;  3E0R A;  1WT0 A;  2PX7 A;  3ECJ A;  3OH0 A;  2ZW5 A;  4KNX A;  2O1G A;  1I52 A;  1T47 A;  2V0J A;  1H3M A;  2FYC B;  1XY7 A;  2P7Q A;  1Q0O A;  3BZA A;  2I5E A;  4QB5 A;  2J0B A;  4YS8 A;  1NKH B;  3I0G A;  4FRH A;  4D0T A;  5EIY A;  1ZJ2 A;  1H5R A;  1G9R A;  1WT1 A;  4M28 A;  4JH7 A;  2WAW A;  4M4K A;  4OPN A;  4Y7F A;  4FCU A;  5C8R A;  3OH4 A;  5HCW A;  3OGZ A;  1G97 A;  4Y64 A;  3ISQ A;  2VSH A;  4HO2 A;  2P7L A;  3ZGG A;  3OJN A;  3SPT A;  2Y4M A;  1WT2 A;  3ZI1 A;  3CKQ A;  4GYM A;  3VB0 A;  5IDT A;  3K8E A;  1PZY B;  1KMZ A;  4Z6Q A;  3OH2 A;  4KC2 A;  4B2W A;  2OEF A;  2X5Z A;  3ZF8 A;  4JH4 A;  2Q4J A;  3CKO A;  1H5S B;  4KC1 A;  2ZW4 A;  5C38 A;  2EI3 A;  4FRO A;  4GHC A;  5DFG A;  1ZDF A;  4NAI A;  3DUV A;  5DDV A;  2ZHP A;  3V91 A;  4NAL A;  1VIC A;  3IUZ A;  1XZ6 A;  5C47 A;  1LQP A;  3G12 A;  4BQH A;  4GHF A;  3PKW A;  4R7P A;  1TWU A;  1FA6 A;  1G93 A;  1KW6 B;  1IIM A;  2W0V A;  2PA4 A;  2WVK A;  3DJ4 A;  5C3B A;  4JIS A;  4GHE A;  2AM4 A;  2EI1 A;  5IDS A;  4DE7 A;  5C4C A;  1FRO A;  1GQC A;  2P7P A;  1JVG A;  2RIX A;  4AYL A;  3N9W A;  5EC3 A;  2D7I A;  1MP3 A;  3SK2 A;  4FRE A;  4NVS A;  3F1Y A;  5FTS A;  2AEC A;  3SX8 A;  3V0M A;  2QQZ A;  5FV9 A;  2ICY A;  4B4M A;  5C4D A;  2BO6 A;  1H5S D;  3IOJ A;  2RJ8 A;  5C1G A;  3O3P A;  3HL3 A;  4Y7T A;  1F1R A;  4Z04 A;  1KW3 B;  4Y6U A;  2J0A A;  5AJP A;  3V8Z A;  5I1F A;  5DHW A;  1KMY A;  4Z6U A;  2RJ5 A;  1DHY A;  3OJT A;  3BCV A;  1HV9 A;  4AAW A;  1O23 B;  4JH6 A;  1XRK A;  1VH3 A;  3HDP A;  3T7M A;  1YP3 A;  2QNT A;  2D7R A;  1ZJP A;  4HOC A;  1WT3 A;  3VW9 A;  2RJ1 A;  3U2V A;  2VS4 A;  5D91 A;  1NKI A;  2RJB A;  2E8B A;  2ZU8 A;  3SXD A;  1HAN A;  1EIL A;  4IRP A;  5F6Q A;  1ZCT A;  3D98 A;  1KWS A;  4B3U A;  1HM0 A;  2RJ4 A;  2WE9 A;  2XME A;  1W77 A;  2GGO A;  2BO7 A;  3I0C A;  4GHD A;  2VXL A;  3F1C A;  3ZGF A;  3BQX A;  2V0I A;  1JC4 A;  2PGV A;  1JYL A;  4EE3 A;  2WVL A;  1GA8 A;  3I0H A;  4KPZ A;  2A8W A;  3HQ0 A;  3POL A;  3OH3 A;  5CJ3 A;  1FR8 A;  2YQS A;  4LQB A;  1LL2 A;  2NXV A;  3LW6 A;  1VZX A;  4NAN A;  5AJO A;  3SXG A;  1NMM B;  4HO3 A;  1ZIZ A;  4B4G A;  4KC4 A;  2YQC A;  1FA8 A;  2RBB A;  3OJJ A;  1LZ0 A;  1G1L A;  1S4N A;  4MTR A;  1BYL A;  2JCK A;  4CJC A;  1O7O A;  4KNR A;  1TFZ A;  4X2A A;  4M2B A;  4E1K A;  3U2W A;  3USR A;  3OJK A;  1NNR A;  4IRQ A;  3OA4 A;  2JCL A;  1XHB A;  4Z6O A;  4NAK A;  4O6M A;  5FU8 A;  1H7Q A;  3NGW A;  2PJS A;  4JH2 A;  1FG5 N;  2YQH A;  3SXA A;  4Z6L A;  4MYB A;  1FO8 A;  1S4O A;  4XWI A;  4JH3 A;  2XWN A;  2E3D A;  2Y6P A;  2R5V A;  4Z6T A;  3EE5 A;  3R2W A;  1ZCV A;  1ZI5 A;  3ZLL A;  4ARW A;  3OC9 A;  1FGG A;  4Z6M A;  1H7G A;  3CKJ A;  1SS4 A;  4MIX A;  5DRH A;  2CU2 A;  5L6V A;  5FYE A;  1INJ A;  5CMJ A;  2RJ7 A;  1QIP A;  2JCO A;  1KLL A;  2ZA0 A;  2C21 A;  1LZI A;  1QGS A;  4NB2 A;  2WGZ A;  3CKN A;  1SP8 A;  4ASY A;  1ZCY A;  2VK9 A;  1FO9 A;  2P7K A;  1R80 A;  1F1U A;  2I7B A;  1EZI A;  1H5R B;  1FR9 A;  1H7T A;  4DEC A;  1GWV A;  1TZF A;  3OUL A;  4GBP A;  2OI5 A;  2X5S A;  3FOQ A;  2BO4 A;  1CJX A;  1VGT A;  2RJ6 A;  4EEO A;  5CQL X;  2EHZ A;  1V82 A;  1SQI A;  1MP4 A;  4NAY A;  1ZI1 A;  1G3L A;  3I0L A;  5KEF A;  3I0J A;  1SP9 A;  2C0N A;  1H7L A;  1ZDG A;  5CMG X;  1F1V A;  3Q7U A;  5C36 A;  4EEM A;  2FFU A;  1ZJ3 A;  2FYA A;  1R7Y A;  2VS5 A;  1VGW A;  1MP5 A;  3Q4S A;  2Y4L A;  1U6L A;  2ZYQ A;  4FIY A;  1ZJO A;  1EWJ A;  1QTO A;  1FRW A;  4Y62 A;  1FXO A;  4O6N A;  2WVM A;  3TQD A;  1FWY A;  4NAZ A;  4FRD A;  5C48 A;  3Q80 A;  4KRV A;  4FCE A;  2VD4 A;  2W0W A;  1QGQ A;  2O1F A;  1FA5 A;  5CMH A;  4HO8 A;  3SX7 A;  1W55 A;  1TSJ A;  3EY8 A;  3IOI A;  3ST8 A;  4JH1 A;  3OPY A;  1JV1 A;  4JD1 A;  1QWJ A;  1FGX A;  1ZJ1 A;  1ZJ0 A;  4FRM A;  1YRO B;  1G23 A;  2QH5 A;  1ZCU A;  3K8D A;  2V0H A;  4Y7U A;  5C4E A;  4MTQ A;  4G3P A;  2V0L A;  1G0R A;  1HM9 A;  2YCM A;  3PNN A;  3BRK X;  3OPY B;  2AES A;  2XMH A;  4BMA A;  1H4C A;  5AJN A;  1INI A;  1ZI4 A;  1MH6 A;  3DK5 A;  2QKX A;  1R81 A;  4Y63 A;  4DDZ A;  1GQ9 A;  4Z6S A;  1LZ7 A;  4CJB A;  3E26 A;  1LKD A;  1W57 A;  5L6S A;  3L7T A;  4HG6 A;  1NIQ B;  2RIZ A;  4HO5 A;  3OXH A;  5BWH A;  2DPW A;  1H4E A;  2JCJ A;  2P7O A;  5C4B A;  4Z6V A;  3CGX A;  4FRL A;  3RMU A;  2I7R A;  2Y4K A;  5C6X A;  5C4F A;  1KW8 B;  3LHO A;  5D7Z A;  3OAJ A;  2X60 A;  2YC5 A;  1VPA A;  3ZLK A;  2RIT A;  4G3Q A;  1V84 A;  5BXC A;  5C1L A;  3PKV A;  3E25 A;  1R7X A;  1JYK A;  2AM3 A;  4EEG A;  1NQI B;  3I0E A;  4LW3 A;  5EJZ A;  1H5T A; 
#chains in the Genus database with same CATH homology
 3V0L A;  4B2X A;  3V0O A;  1FOA A;  3I0F A;  4CJ8 A;  1HM8 A;  4ZDQ A;  3JUK A;  1FZW A;  4KT7 A;  2Z87 A;  2VS3 A;  4B5B A;  2APC A;  1LL3 A;  2UX8 A;  1SS9 A;  4P02 A;  5FUH A;  2Z86 A;  3U0Y A;  4B4B A;  1O0R A;  3SXB A;  3IOH A;  3OH1 A;  2I5K A;  1GX4 A;  1JVD A;  2AE7 A;  1H4D A;  4HO4 A;  2V0K A;  3U2X A;  4CVH A;  1H7H A;  4Y7G A;  3V90 A;  1LZJ A;  1MC3 A;  5CMF X;  3U2T A;  1OQM B;  1YP2 A;  1NWG B;  3SXC A;  3V8Y A;  4HO6 A;  1TW1 A;  1VGU A;  3JUJ A;  5CMI A;  4Y9X A;  2FY7 A;  2OI6 A;  3V0N A;  5EJ1 A;  4Y6N A;  5C3D A;  1G95 A;  2AGD A;  2PGY A;  2AM5 A;  1O7Q A;  5CQO A;  5J49 A;  4D11 A;  1TVY A;  2X65 A;  3PKQ A;  2VSI A;  4UEG A;  3T7N A;  5FTV A;  1VZT A;  1V83 A;  1VGZ A;  1PZT A;  1ZHJ A;  2P6W A;  5C3A A;  4KQL A;  2P73 A;  2O1H A;  3KIA A;  3T7O A;  1TW5 A;  1Z90 A;  3USQ A;  5JQQ A;  1QG8 A;  3SXE A;  3TZT A;  1H5S A;  1WSZ A;  4FRB A;  1ON6 A;  2D0J A;  3JTJ A;  3V0Q A;  1NHE B;  1R7U A;  2RIY A;  2VXM A;  3I0K A;  5DDT A;  1R7T A;  1ON8 A;  3U2U A;  3OKR A;  2P72 A;  3FWW A;  2XWL A;  2YES A;  5CQN X;  2GGQ A;  5D92 A;  4M2A A;  4FRQ A;  1G2V A;  4FRP A;  1VZU A;  4L41 C;  4EEA A;  4D11 C;  2OEG A;  3V0P A;  4ECM A;  2FYD B;  4B42 A;  4KPX A;  5IFY A;  1R7V A;  2WEE A;  1NF5 B;  2VFZ A;  3CU0 A;  1WVC A;  5FU0 A;  2AH9 A;  1VH1 A;  2MZB A;  3D8V A;  2YC3 A;  1VM8 A;  3RMW A;  1HJL A;  3SX5 A;  1H5S C;  4P00 A;  3GUE A;  4LW6 A;  3SX3 A;  4JD0 A;  2XWM A;  4D0Z A;  2FYB A;  5CQP A;  5CQM X;  1FXJ A;  5C49 A;  1GWW A;  3U0X A;  1YP4 A;  4HO0 A;  4KXO A;  1E5K A;  2RJ9 A;  3OAM A;  4ASJ A;  4FQW A;  3QVB A;  4K6R A;  1GX0 A;  5HS2 A;  1LL0 A;  2Y7A A;  4AC3 A;  2QGI A;  3R3I A;  1HJJ A;  3RMV A;  1H7F A;  2A8U A;  4HO9 A;  1IIN A;  1JV3 A;  2Y4J A;  1EYR A;  4G87 A;  4EE5 A;  4EVW A;  1LVW A;  2ZU9 A;  1K4V A;  4J18 A;  1OMZ A;  3RSB A;  1S4P A;  4EE4 A;  3I0I X;  1H5T B;  4AYJ A;  4FRA A;  1H7E A;  1ZI3 A;  4FIX A;  4MND A;  2BO8 A;  4C2S A;  2ICX A;  1G8O A;  4Q7C A;  4G3S A;  2OI7 A;  3D5N A;  5C1H A;  4D48 A;  1R82 A;  1OMX A;  4Y7V A;  4HCQ A;  2RJ0 A;  2FFV A;  3CKV A;  3PKP A;  3I0D A;  2ZU7 A;  2YQJ A;  1WT0 A;  2PX7 A;  3OH0 A;  4KNX A;  2O1G A;  1I52 A;  2V0J A;  1H3M A;  2FYC B;  2I5E A;  2J0B A;  4YS8 A;  1NKH B;  3I0G A;  4FRH A;  4D0T A;  5EIY A;  1ZJ2 A;  1H5R A;  1G9R A;  1WT1 A;  4M28 A;  2WAW A;  4M4K A;  4Y7F A;  4FCU A;  5C8R A;  3OH4 A;  3OGZ A;  1G97 A;  4Y64 A;  2VSH A;  4HO2 A;  3ZGG A;  3SPT A;  2Y4M A;  1WT2 A;  3CKQ A;  5IDT A;  3K8E A;  1PZY B;  3OH2 A;  4KC2 A;  4B2W A;  2OEF A;  2X5Z A;  3ZF8 A;  2Q4J A;  3CKO A;  1H5S B;  4KC1 A;  5C38 A;  4FRO A;  1ZDF A;  4NAI A;  3DUV A;  5DDV A;  3V91 A;  4NAL A;  1VIC A;  5C47 A;  1XZ6 A;  4BQH A;  4R7P A;  1G93 A;  1IIM A;  2W0V A;  3DJ4 A;  2PA4 A;  2WVK A;  5C3B A;  4JIS A;  2AM4 A;  5IDS A;  4DE7 A;  5C4C A;  1GQC A;  1JVG A;  2RIX A;  4AYL A;  3N9W A;  2D7I A;  1MP3 A;  4FRE A;  3F1Y A;  5FTS A;  2AEC A;  3SX8 A;  3V0M A;  5FV9 A;  2ICY A;  4B4M A;  5C4D A;  2BO6 A;  1H5S D;  3IOJ A;  2RJ8 A;  5C1G A;  3O3P A;  3HL3 A;  4Y7T A;  4Y6U A;  2J0A A;  5AJP A;  3V8Z A;  5I1F A;  2RJ5 A;  3BCV A;  1HV9 A;  4AAW A;  1O23 B;  1VH3 A;  3T7M A;  1YP3 A;  2D7R A;  1ZJP A;  4HOC A;  1WT3 A;  3U2V A;  2RJ1 A;  2VS4 A;  5D91 A;  2E8B A;  2ZU8 A;  3SXD A;  4IRP A;  1ZCT A;  3D98 A;  1KWS A;  4B3U A;  1HM0 A;  2RJ4 A;  2WE9 A;  2XME A;  1W77 A;  2GGO A;  2BO7 A;  3I0C A;  3F1C A;  2VXL A;  3ZGF A;  2V0I A;  2PGV A;  1JYL A;  4EE3 A;  2WVL A;  1GA8 A;  3I0H A;  4KPZ A;  2A8W A;  3POL A;  3OH3 A;  1FR8 A;  2YQS A;  1LL2 A;  2NXV A;  3LW6 A;  1VZX A;  4NAN A;  5AJO A;  3SXG A;  1NMM B;  4HO3 A;  1ZIZ A;  4B4G A;  4KC4 A;  2YQC A;  1LZ0 A;  1G1L A;  1S4N A;  2JCK A;  4CJC A;  1O7O A;  4KNR A;  4M2B A;  4E1K A;  3U2W A;  3USR A;  4IRQ A;  2JCL A;  1XHB A;  4NAK A;  4O6M A;  5FU8 A;  1H7Q A;  3NGW A;  1FG5 N;  2YQH A;  3SXA A;  4MYB A;  1FO8 A;  1S4O A;  4XWI A;  2XWN A;  2E3D A;  2Y6P A;  3EE5 A;  3R2W A;  1ZCV A;  1ZI5 A;  3ZLL A;  4ARW A;  3OC9 A;  1FGG A;  1H7G A;  3CKJ A;  4MIX A;  5L6V A;  2CU2 A;  5FYE A;  1INJ A;  5CMJ A;  2RJ7 A;  2JCO A;  1LZI A;  1QGS A;  2WGZ A;  3CKN A;  4ASY A;  1ZCY A;  2VK9 A;  1FO9 A;  1R80 A;  2I7B A;  1EZI A;  1H5R B;  1FR9 A;  1H7T A;  4DEC A;  1GWV A;  1TZF A;  4GBP A;  2OI5 A;  2X5S A;  3FOQ A;  2BO4 A;  1VGT A;  2RJ6 A;  4EEO A;  5CQL X;  1V82 A;  1MP4 A;  1ZI1 A;  3I0L A;  1G3L A;  3I0J A;  2C0N A;  1H7L A;  1ZDG A;  5CMG X;  5C36 A;  3Q7U A;  4EEM A;  2FFU A;  1ZJ3 A;  2FYA A;  1R7Y A;  2VS5 A;  1VGW A;  1MP5 A;  3Q4S A;  2Y4L A;  4FIY A;  1ZJO A;  1FRW A;  4Y62 A;  1FXO A;  4O6N A;  2WVM A;  3TQD A;  1FWY A;  4FRD A;  5C48 A;  3Q80 A;  4KRV A;  4FCE A;  2VD4 A;  2W0W A;  1QGQ A;  2O1F A;  5CMH A;  4HO8 A;  3SX7 A;  1W55 A;  3IOI A;  3ST8 A;  1JV1 A;  1QWJ A;  1FGX A;  1ZJ1 A;  1ZJ0 A;  4FRM A;  1YRO B;  1G23 A;  2QH5 A;  1ZCU A;  3K8D A;  2V0H A;  4Y7U A;  5C4E A;  4G3P A;  2V0L A;  1G0R A;  1HM9 A;  2YCM A;  3PNN A;  3BRK X;  2AES A;  2XMH A;  4BMA A;  1H4C A;  5AJN A;  1INI A;  1ZI4 A;  3DK5 A;  2QKX A;  1R81 A;  4Y63 A;  4DDZ A;  1GQ9 A;  1LZ7 A;  4CJB A;  3E26 A;  1W57 A;  5L6S A;  4HG6 A;  2RIZ A;  4HO5 A;  2DPW A;  1H4E A;  2JCJ A;  5C4B A;  3CGX A;  4FRL A;  2Y4K A;  5C4F A;  3ZLK A;  2X60 A;  2YC5 A;  1VPA A;  2RIT A;  4G3Q A;  1V84 A;  5BXC A;  5C1L A;  3E25 A;  1R7X A;  1JYK A;  2AM3 A;  4EEG A;  1NQI B;  3I0E A;  4LW3 A;  5EJZ A;  1H5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...