2WAWA

Crystal structure of mycobacterium tuberculosis rv0371c homolog from mycobacterium sp. strain jc1
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
198
structure length
197
Chain Sequence
LRSRVTGVVLAAGYSRRLGTPKQLLPLGDTTLLGATLAMARRCPFDQLIVTLGGAADEVLEKVELDGLDIVLVDDAGLGSSSLKSALTWVDPTAEGIVLMLGDQPGITASAVASLIAGGRGATIAVCEYANGIGHPFWVSRGVFGDLAELHGDKGVWRLIESGRHGVRRIRVDADVPLDVDTWDDYERLLASVVRLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords MOBA RELATE PROTEIN
publication title Crystal Structure of Mycobacterium Tuberculosis Rv0371C Homolog from Mycobacterium Sp. Strain Jc1
rcsb
total genus 61
structure length 197
sequence length 198
ec nomenclature
pdb deposition date 2009-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2wawA00
1G8OA 1YP2A 2PX7A 5C36A 2V0JA 1WSZA 3V8YA 1QWJA 5C1HA 2Z86A 1GX4A 2GGOA 1IIMA 1LZJA 4KRVA 2P72A 1G3LA 4EVWA 3Q80A 2VS5A 2RJ6A 4M2AA 4EEGA 2A8UA 4IRPA 1NQIB 2FYBA 1INIA 3CKQA 4Y7TA 4DDZA 4FREA 1K4VA 1R7VA 2JCKA 4EEMA 1V82A 5EJZA 3U0XA 4ASYA 1E5KA 4CVHA 4EEAA 2WVMA 1H7FA 1GX0A 1YP4A 4FRBA 5AJPA 2QGIA 2RJ0A 2FFUA 3ZGGA 1ZHJA 1W57A 1HM8A 4KQLA 2V0IA 4G3SA 1JVGA 1ZDGA 2O1GA 3SXEA 1H7GA 1R80A 3TQDA 4FRDA 2ZU9A 2AECA 2XMHA 1VGZA 4KC2A 4HO8A 5BXCA 3FOQA 1ZCYA 2XWLA 1G93A 2OI6A 4KC4A 4DE7A 2OEFA 2QH5A 4UEGA 1S4NA 2X60A 2YCMA 2YQCA 3OH3A 4D48A 3OGZA 5HS2A 3CKVA 1VGTA 4JD0A 2Y4JA 4AYLA 3ZLKA 1LVWA 1TW1A 3I0GA 2O1HA 1NF5B 1FGGA 2OI5A 2Y4LA 1S4PA 5C4DA 4KPZA 3I0CA 1H7EA 2W0WA 1W55A 4EE5A 5C4EA 3V0LA 2ZU7A 1WT1A 4LW3A 3OC9A 2I5EA 1FOAA 3JUJA 2PA4A 1ZDFA 2VS4A 2XMEA 5FTSA 3RSBA 2Y7AA 3CKJA 2AM4A 3N9WA 3OH2A 4Y62A 2D7IA 5C4FA 3JTJA 1O0RA 3IOHA 4Y7GA 2P73A 1FXJA 3PNNA 5AJNA 3V0NA 1TVYA 4FRMA 4FRAA 1VZUA 2WAWA 4FQWA 4ZDQA 2XWNA 2V0KA 1WT3A 3NGWA 2FFVA 3SXBA 5C47A 3BCVA 5C48A 1XHBA 4HO4A 3CGXA 4FRPA 1ZJ1A 4FROA 2E8BA 4D0ZA 2RJ1A 2I7BA 3SX7A 2RJ4A 1TZFA 5EJ1A 1HV9A 3PKQA 1G95A 3V91A 3Q4SA 2AH9A 2WE9A 1H7HA 1GQ9A 1FG5N 2W0VA 2GGQA 4CJBA 1H4CA 1FO9A 1WT2A 4BMAA 2V0LA 4R7PA 3F1CA 3POLA 5L6SA 1INJA 2NXVA 2Y6PA 4L41C 3V90A 2YQHA 5CQMX 4YS8A 1QGQA 3OKRA 1LL0A 2Z87A 2BO8A 5C8RA 2WVLA 4AAWA 3SX5A 5C1LA 4BQHA 1O7QA 1H5SA 1ZCUA 1FWYA 4FCEA 4AYJA 1GWWA 1PZTA 1NHEB 2V0HA 4EE3A 1VH1A 1G9RA 3ZGFA 1V84A 4HO0A 3SXCA 5IDSA 4CJ8A 1NWGB 1QG8A 1ON6A 3TZTA 1OQMB 3EE5A 5C3AA 1H5SD 3LW6A 4C2SA 1R7TA 4D11A 2YESA 2DPWA 5CMHA 4HO5A 3I0FA 4FRLA 1VICA 1SS9A 1YROB 4KPXA 1JV3A 1LZ7A 3DK5A 1ZI4A 1VZXA 1VH3A 2D0JA 3V0QA 1WT0A 4B4GA 2ZU8A 1G1LA 3D5NA 2FYAA 2BO4A 2MZBA 3KIAA 1HM0A 2D7RA 2YC3A 2FY7A 4K6RA 4B42A 4HOCA 4M2BA 3I0JA 3I0EA 2FYDB 4HCQA 3E25A 1OMXA 2FYCB 2RJ7A 3U2TA 4Y63A 4DECA 5C4CA 2OEGA 3I0IX 1G23A 4NAIA 1H5RA 3SPTA 1FXOA 1ZI1A 4G3QA 4ARWA 1ZCTA 4HO3A 3I0DA 4KT7A 3HL3A 4B2XA 5IFYA 1R81A 1LZIA 3OH1A 4G87A 2OI7A 1H7LA 3RMVA 5IDTA 5C3BA 1G97A 2P6WA 1ON8A 2RJ5A 3GUEA 4HG6A 1FGXA 3F1YA 3T7NA 2JCLA 1MP4A 1VGUA 4Y6UA 5FU8A 4J18A 2AM3A 1JVDA 2JCOA 4M4KA 1O7OA 3U2WA 4Y64A 4ECMA 2YQJA 3D8VA 3R2WA 4P02A 2JCJA 3SX3A 3I0HA 1NKHB 3SXAA 2ICXA 4Y7VA 3CKOA 2VD4A 1KWSA 1S4OA 3CU0A 5J49A 5I1FA 1VGWA 3T7MA 5C4BA 1GQCA 1PZYB 2VXMA 3SXGA 3R3IA 1ZJ0A 4LW6A 1GA8A 1HJLA 3JUKA 2XWMA 2Y4KA 4Y9XA 2X5ZA 1H7TA 4M28A 5DDTA 1G0RA 4NAKA 1GWVA 2VS3A 2BO6A 1MC3A 3PKPA 3U2XA 1FR9A 4EE4A 1QGSA 1H3MA 2X5SA 1IINA 1H5SB 3QVBA 4D0TA 4EEOA 4Y7FA 2RITA 1W77A 3E26A 3V0MA 2RJ9A 1R7XA 2Y4MA 1VPAA 5FUHA 1MP3A 4P00A 1VM8A 1H5TB 4Y7UA 2AE7A 4IRQA 3V8ZA 4HO6A 1FRWA 1OMZA 3ST8A 2E3DA 1H5TA 1EYRA 3U2VA 1HM9A 1JYKA 5C3DA 2PGVA 5CQPA 2YC5A 2WEEA 1NMMB 1R82A 4FRQA 5CQOA 1FO8A 2APCA 3I0KA 2AM5A 1R7UA 5CMFX 2RJ8A 3V0PA 2VXLA 3OH4A 1LL3A 4B3UA 1Z90A 2CU2A 5C38A 1MP5A 1HJJA 2I5KA 2PGYA 1ZJ3A 5DDVA 3OH0A 1XZ6A 1ZCVA 1TW5A 2RIYA 2QKXA 5CMIA 1ZI5A 3USQA 1H5RB 1H4DA 1ZI3A 4B4BA 4B4MA 3CKNA 5CQNX 1VZTA 4B5BA 2ICYA 5L6VA 3D98A 2X65A 5FV9A 4JISA 2RIXA 3BRKX 1ZJ2A 1JYLA 4HO9A 1ZJOA 4GBPA 2VSHA 3Q7UA 5FTVA 1V83A 5EIYA 4FCUA 3ZF8A 2RIZA 1LL2A 4MNDA 4G3PA 5CMJA 3T7OA 4MYBA 4Y6NA 3U0YA 4NALA 1FZWA 2Q4JA 1ZIZA 4B2WA 3SXDA 1YP3A 2BO7A 3FWWA 1LZ0A 3ZLLA 5JQQA 1H7QA 5CMGX 3I0LA 2VFZA 2AGDA 5CQLX 3IOJA 4HO2A 4KNXA 4FRHA 1R7YA 1H5SC 2YQSA 4AC3A 4CJCA 1EZIA 2AESA 3OAMA 4KXOA 2WGZA 2VSIA 3IOIA 3USRA 4NANA 3U2UA 2WVKA 1H4EA 3DJ4A 4KC1A 5C1GA 1G2VA 5FYEA 3SX8A 4XWIA 2O1FA 3RMWA 1O23B 2UX8A 4E1KA 1I52A 3K8EA 5C49A 3O3PA 2A8WA 3V0OA 4D11C 1ZJPA 5FU0A 1JV1A 4ASJA 3K8DA 5AJOA 1FR8A 3DUVA 1WVCA 4KNRA
chains in the Genus database with same CATH superfamily
1G8OA 1YP2A 2PX7A 5C36A 2V0JA 1WSZA 3V8YA 1QWJA 5C1HA 2Z86A 1GX4A 2GGOA 1IIMA 1LZJA 4KRVA 2P72A 1G3LA 4EVWA 3Q80A 2VS5A 2RJ6A 4M2AA 4EEGA 2A8UA 4IRPA 1NQIB 2FYBA 1INIA 3CKQA 4Y7TA 4DDZA 4FREA 4O6NA 1K4VA 1R7VA 2JCKA 4EEMA 1V82A 5EJZA 3U0XA 4ASYA 1E5KA 4CVHA 2J0BA 4EEAA 2WVMA 1H7FA 1GX0A 1YP4A 4FRBA 5AJPA 2QGIA 2RJ0A 2FFUA 3ZGGA 1ZHJA 2J0AA 1W57A 1HM8A 4KQLA 2V0IA 4G3SA 1JVGA 1ZDGA 2O1GA 3SXEA 1H7GA 1R80A 3TQDA 4FRDA 2ZU9A 2AECA 2VK9A 2XMHA 1VGZA 4KC2A 4HO8A 5BXCA 3FOQA 1ZCYA 2XWLA 1G93A 2OI6A 4KC4A 4DE7A 2OEFA 2QH5A 4UEGA 1S4NA 2X60A 2YCMA 2YQCA 3OH3A 4D48A 3OGZA 5HS2A 3CKVA 1VGTA 4JD0A 2Y4JA 4AYLA 3ZLKA 1LVWA 1TW1A 3I0GA 2O1HA 1NF5B 1FGGA 2OI5A 2Y4LA 1S4PA 5C4DA 4KPZA 3I0CA 1H7EA 2W0WA 1W55A 4EE5A 5C4EA 3V0LA 2ZU7A 1WT1A 4LW3A 3OC9A 2I5EA 1FOAA 3JUJA 2PA4A 1ZDFA 2VS4A 2XMEA 5FTSA 3RSBA 2Y7AA 3CKJA 2AM4A 3N9WA 3OH2A 4Y62A 2D7IA 5C4FA 3JTJA 1O0RA 3IOHA 4Y7GA 2P73A 1FXJA 5D91A 3PNNA 5AJNA 3V0NA 1TVYA 4FRMA 4FRAA 1VZUA 2WAWA 4FQWA 4ZDQA 2XWNA 2V0KA 1WT3A 3NGWA 2FFVA 3SXBA 5C47A 3BCVA 5C48A 1XHBA 4HO4A 3CGXA 4FRPA 1ZJ1A 4FROA 2E8BA 4D0ZA 5D92A 2RJ1A 2I7BA 3SX7A 2RJ4A 1TZFA 5EJ1A 1HV9A 3PKQA 1G95A 4FIXA 3V91A 3Q4SA 2AH9A 2WE9A 1H7HA 1GQ9A 1FG5N 2W0VA 2GGQA 4CJBA 1H4CA 1FO9A 1WT2A 4Q7CA 4BMAA 2V0LA 4R7PA 3F1CA 3POLA 5L6SA 1INJA 2NXVA 2Y6PA 4L41C 3V90A 2YQHA 5CQMX 4YS8A 1QGQA 3OKRA 1LL0A 2Z87A 2BO8A 5C8RA 2WVLA 4AAWA 3SX5A 5C1LA 4BQHA 1O7QA 1H5SA 1ZCUA 1FWYA 4FCEA 4AYJA 1GWWA 1PZTA 1NHEB 2V0HA 4EE3A 1VH1A 1G9RA 3ZGFA 1V84A 4HO0A 3SXCA 5IDSA 4CJ8A 1NWGB 1QG8A 1ON6A 3TZTA 1OQMB 3EE5A 4MIXA 5C3AA 1H5SD 3LW6A 4C2SA 1R7TA 4D11A 2YESA 2DPWA 5CMHA 4HO5A 3I0FA 4FRLA 1VICA 1SS9A 1YROB 4KPXA 1JV3A 1LZ7A 3DK5A 1ZI4A 1VZXA 1VH3A 2D0JA 3V0QA 1WT0A 4B4GA 2ZU8A 1G1LA 3D5NA 2FYAA 2BO4A 2MZBA 3KIAA 1HM0A 2D7RA 2YC3A 2FY7A 4K6RA 4B42A 4HOCA 4M2BA 3I0JA 3I0EA 2FYDB 4HCQA 3E25A 1OMXA 2FYCB 2RJ7A 3U2TA 4Y63A 4DECA 5C4CA 2OEGA 3I0IX 1G23A 4NAIA 1H5RA 3SPTA 1FXOA 1ZI1A 4G3QA 4ARWA 1ZCTA 4HO3A 3I0DA 4KT7A 3HL3A 2C0NA 4B2XA 5IFYA 1R81A 1LZIA 3OH1A 4G87A 2OI7A 1H7LA 3RMVA 5IDTA 5C3BA 1G97A 2P6WA 1ON8A 2RJ5A 3GUEA 4HG6A 1FGXA 3F1YA 3T7NA 2JCLA 1MP4A 1VGUA 4Y6UA 5FU8A 4J18A 2AM3A 1JVDA 2JCOA 4M4KA 1O7OA 3U2WA 4Y64A 4ECMA 2YQJA 3D8VA 3R2WA 4P02A 2JCJA 3SX3A 3I0HA 1NKHB 3SXAA 2ICXA 4Y7VA 3CKOA 2VD4A 1KWSA 1S4OA 3CU0A 5J49A 5I1FA 1VGWA 3T7MA 5C4BA 1GQCA 1PZYB 2VXMA 3SXGA 3R3IA 1ZJ0A 4LW6A 1GA8A 1HJLA 3JUKA 2XWMA 2Y4KA 4Y9XA 2X5ZA 1H7TA 4M28A 5DDTA 1G0RA 4NAKA 1GWVA 2VS3A 2BO6A 1MC3A 3PKPA 3U2XA 1FR9A 4EE4A 1QGSA 1H3MA 2X5SA 1IINA 1H5SB 3QVBA 4D0TA 4EEOA 4Y7FA 2RITA 1W77A 3E26A 3V0MA 2RJ9A 1R7XA 2Y4MA 1VPAA 5FUHA 1MP3A 4P00A 1VM8A 1H5TB 4Y7UA 2AE7A 4IRQA 3V8ZA 4HO6A 1FRWA 1OMZA 3ST8A 2E3DA 1H5TA 1EYRA 3U2VA 1HM9A 1JYKA 5C3DA 2PGVA 5CQPA 2YC5A 2WEEA 1NMMB 1R82A 4FRQA 5CQOA 1FO8A 2APCA 3I0KA 2AM5A 1R7UA 5CMFX 2RJ8A 3V0PA 2VXLA 3OH4A 1LL3A 4B3UA 1Z90A 2CU2A 5C38A 1MP5A 1HJJA 2I5KA 2PGYA 1ZJ3A 5DDVA 3OH0A 1XZ6A 1ZCVA 1TW5A 2RIYA 2QKXA 5CMIA 1ZI5A 3USQA 1H5RB 1H4DA 1ZI3A 4B4BA 4B4MA 3CKNA 5CQNX 4O6MA 1VZTA 4B5BA 2ICYA 5L6VA 3D98A 2X65A 5FV9A 4JISA 2RIXA 3BRKX 1ZJ2A 1JYLA 4HO9A 1ZJOA 4GBPA 2VSHA 3Q7UA 5FTVA 1V83A 5EIYA 4FCUA 3ZF8A 2RIZA 1LL2A 4MNDA 4G3PA 5CMJA 3T7OA 4FIYA 4MYBA 4Y6NA 3U0YA 4NALA 1FZWA 2Q4JA 1ZIZA 4B2WA 3SXDA 1YP3A 2BO7A 3FWWA 1LZ0A 3ZLLA 5JQQA 1H7QA 5CMGX 3I0LA 2VFZA 2AGDA 5CQLX 3IOJA 4HO2A 4KNXA 4FRHA 1R7YA 1H5SC 2YQSA 4AC3A 4CJCA 1EZIA 2AESA 3OAMA 4KXOA 2WGZA 2VSIA 3IOIA 3USRA 4NANA 3U2UA 2WVKA 1H4EA 3DJ4A 4KC1A 5C1GA 1G2VA 5FYEA 3SX8A 4XWIA 2O1FA 3RMWA 1O23B 2UX8A 4E1KA 1I52A 3K8EA 5C49A 3O3PA 2A8WA 3V0OA 4D11C 1ZJPA 5FU0A 1JV1A 4ASJA 3K8DA 5AJOA 1FR8A 3DUVA 1WVCA 4KNRA
chains in the Genus database with same CATH topology
1G8OA 1YP2A 2PX7A 5C36A 2V0JA 1WSZA 3V8YA 1QWJA 5C1HA 2Z86A 1GX4A 2GGOA 1IIMA 1LZJA 4KRVA 2P72A 1G3LA 4EVWA 3Q80A 2VS5A 2RJ6A 4M2AA 4EEGA 2A8UA 4IRPA 1NQIB 2FYBA 1INIA 3CKQA 4Y7TA 4DDZA 4FREA 4O6NA 1K4VA 1R7VA 2JCKA 4EEMA 1V82A 5EJZA 3U0XA 4ASYA 1E5KA 4CVHA 2J0BA 4EEAA 2WVMA 1H7FA 1GX0A 1YP4A 4FRBA 5AJPA 2QGIA 2RJ0A 2FFUA 3ZGGA 1ZHJA 2J0AA 1W57A 1HM8A 4KQLA 2V0IA 4G3SA 1JVGA 1ZDGA 2O1GA 3SXEA 1H7GA 1R80A 3TQDA 4FRDA 2ZU9A 2AECA 2VK9A 2XMHA 1VGZA 4KC2A 4HO8A 5BXCA 3FOQA 1ZCYA 2XWLA 1G93A 2OI6A 4KC4A 4DE7A 2OEFA 2QH5A 4UEGA 1S4NA 2X60A 2YCMA 2YQCA 3OH3A 4D48A 3OGZA 5HS2A 3CKVA 1VGTA 4JD0A 2Y4JA 4AYLA 3ZLKA 1LVWA 1TW1A 3I0GA 2O1HA 1NF5B 1FGGA 2OI5A 2Y4LA 1S4PA 5C4DA 4KPZA 3I0CA 1H7EA 2W0WA 1W55A 4EE5A 5C4EA 3V0LA 2ZU7A 1WT1A 4LW3A 3OC9A 2I5EA 1FOAA 3JUJA 2PA4A 1ZDFA 2VS4A 2XMEA 5FTSA 3RSBA 2Y7AA 3CKJA 2AM4A 3N9WA 3OH2A 4Y62A 2D7IA 5C4FA 3JTJA 1O0RA 3IOHA 4Y7GA 2P73A 1FXJA 5D91A 3PNNA 5AJNA 3V0NA 1TVYA 4FRMA 4FRAA 1VZUA 2WAWA 4FQWA 4ZDQA 2XWNA 2V0KA 1WT3A 3NGWA 2FFVA 3SXBA 5C47A 3BCVA 5C48A 1XHBA 4HO4A 3CGXA 4FRPA 1ZJ1A 4FROA 2E8BA 4D0ZA 5D92A 2RJ1A 2I7BA 3SX7A 2RJ4A 1TZFA 5EJ1A 1HV9A 3PKQA 1G95A 4FIXA 3V91A 3Q4SA 2AH9A 2WE9A 1H7HA 1GQ9A 1FG5N 2W0VA 2GGQA 4CJBA 1H4CA 1FO9A 1WT2A 4Q7CA 4BMAA 2V0LA 4R7PA 3F1CA 3POLA 5L6SA 1INJA 2NXVA 2Y6PA 4L41C 3V90A 2YQHA 5CQMX 4YS8A 1QGQA 3OKRA 1LL0A 2Z87A 2BO8A 5C8RA 2WVLA 4AAWA 3SX5A 5C1LA 4BQHA 1O7QA 1H5SA 1ZCUA 1FWYA 4FCEA 4AYJA 1GWWA 1PZTA 1NHEB 2V0HA 4EE3A 1VH1A 1G9RA 3ZGFA 1V84A 4HO0A 3SXCA 5IDSA 4CJ8A 1NWGB 1QG8A 1ON6A 3TZTA 1OQMB 3EE5A 4MIXA 5C3AA 1H5SD 3LW6A 4C2SA 1R7TA 4D11A 2YESA 2DPWA 5CMHA 4HO5A 3I0FA 4FRLA 1VICA 1SS9A 1YROB 4KPXA 1JV3A 1LZ7A 3DK5A 1ZI4A 1VZXA 1VH3A 2D0JA 3V0QA 1WT0A 4B4GA 2ZU8A 1G1LA 3D5NA 2FYAA 2BO4A 2MZBA 3KIAA 1HM0A 2D7RA 2YC3A 2FY7A 4K6RA 4B42A 4HOCA 4M2BA 3I0JA 3I0EA 2FYDB 4HCQA 3E25A 1OMXA 2FYCB 2RJ7A 3U2TA 4Y63A 4DECA 5C4CA 2OEGA 3I0IX 1G23A 4NAIA 1H5RA 3SPTA 1FXOA 1ZI1A 4G3QA 4ARWA 1ZCTA 4HO3A 3I0DA 4KT7A 3HL3A 2C0NA 4B2XA 5IFYA 1R81A 1LZIA 3OH1A 4G87A 2OI7A 1H7LA 3RMVA 5IDTA 5C3BA 1G97A 2P6WA 1ON8A 2RJ5A 3GUEA 4HG6A 1FGXA 3F1YA 3T7NA 2JCLA 1MP4A 1VGUA 4Y6UA 5FU8A 4J18A 2AM3A 1JVDA 2JCOA 4M4KA 1O7OA 3U2WA 4Y64A 4ECMA 2YQJA 3D8VA 3R2WA 4P02A 2JCJA 3SX3A 3I0HA 1NKHB 3SXAA 2ICXA 4Y7VA 3CKOA 2VD4A 1KWSA 1S4OA 3CU0A 5J49A 5I1FA 1VGWA 3T7MA 5C4BA 1GQCA 1PZYB 2VXMA 3SXGA 3R3IA 1ZJ0A 4LW6A 1GA8A 1HJLA 3JUKA 2XWMA 2Y4KA 4Y9XA 2X5ZA 1H7TA 4M28A 5DDTA 1G0RA 4NAKA 1GWVA 2VS3A 2BO6A 1MC3A 3PKPA 3U2XA 1FR9A 4EE4A 1QGSA 1H3MA 2X5SA 1IINA 1H5SB 3QVBA 4D0TA 4EEOA 4Y7FA 2RITA 1W77A 3E26A 3V0MA 2RJ9A 1R7XA 2Y4MA 1VPAA 5FUHA 1MP3A 4P00A 1VM8A 1H5TB 4Y7UA 2AE7A 4IRQA 3V8ZA 4HO6A 1FRWA 1OMZA 3ST8A 2E3DA 1H5TA 1EYRA 3U2VA 1HM9A 1JYKA 5C3DA 2PGVA 5CQPA 2YC5A 2WEEA 1NMMB 1R82A 4FRQA 5CQOA 1FO8A 2APCA 3I0KA 2AM5A 1R7UA 5CMFX 2RJ8A 3V0PA 2VXLA 3OH4A 1LL3A 4B3UA 1Z90A 2CU2A 5C38A 1MP5A 1HJJA 2I5KA 2PGYA 1ZJ3A 5DDVA 3OH0A 1XZ6A 1ZCVA 1TW5A 2RIYA 2QKXA 5CMIA 1ZI5A 3USQA 1H5RB 1H4DA 1ZI3A 4B4BA 4B4MA 3CKNA 5CQNX 4O6MA 1VZTA 4B5BA 2ICYA 5L6VA 3D98A 2X65A 5FV9A 4JISA 2RIXA 3BRKX 1ZJ2A 1JYLA 4HO9A 1ZJOA 4GBPA 2VSHA 3Q7UA 5FTVA 1V83A 5EIYA 4FCUA 3ZF8A 2RIZA 1LL2A 4MNDA 4G3PA 5CMJA 3T7OA 4FIYA 4MYBA 4Y6NA 3U0YA 4NALA 1FZWA 2Q4JA 1ZIZA 4B2WA 3SXDA 1YP3A 2BO7A 3FWWA 1LZ0A 3ZLLA 5JQQA 1H7QA 5CMGX 3I0LA 2VFZA 2AGDA 5CQLX 3IOJA 4HO2A 4KNXA 4FRHA 1R7YA 1H5SC 2YQSA 4AC3A 4CJCA 1EZIA 2AESA 3OAMA 4KXOA 2WGZA 2VSIA 3IOIA 3USRA 4NANA 3U2UA 2WVKA 1H4EA 3DJ4A 4KC1A 5C1GA 1G2VA 5FYEA 3SX8A 4XWIA 2O1FA 3RMWA 1O23B 2UX8A 4E1KA 1I52A 3K8EA 5C49A 3O3PA 2A8WA 3V0OA 4D11C 1ZJPA 5FU0A 1JV1A 4ASJA 3K8DA 5AJOA 1FR8A 3DUVA 1WVCA 4KNRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G8O A;  1YP2 A;  2PX7 A;  5C36 A;  2V0J A;  1WSZ A;  3V8Y A;  1QWJ A;  5C1H A;  2Z86 A;  1GX4 A;  2GGO A;  1IIM A;  1LZJ A;  4KRV A;  2P72 A;  1G3L A;  4EVW A;  3Q80 A;  2VS5 A;  2RJ6 A;  4M2A A;  4EEG A;  2A8U A;  4IRP A;  1NQI B;  2FYB A;  1INI A;  3CKQ A;  4Y7T A;  4DDZ A;  4FRE A;  1K4V A;  1R7V A;  2JCK A;  4EEM A;  1V82 A;  5EJZ A;  3U0X A;  4ASY A;  1E5K A;  4CVH A;  4EEA A;  2WVM A;  1H7F A;  1GX0 A;  1YP4 A;  4FRB A;  5AJP A;  2QGI A;  2RJ0 A;  2FFU A;  3ZGG A;  1ZHJ A;  1W57 A;  1HM8 A;  4KQL A;  2V0I A;  4G3S A;  1JVG A;  1ZDG A;  2O1G A;  3SXE A;  1H7G A;  1R80 A;  3TQD A;  4FRD A;  2ZU9 A;  2AEC A;  2XMH A;  1VGZ A;  4KC2 A;  4HO8 A;  5BXC A;  3FOQ A;  1ZCY A;  2XWL A;  1G93 A;  2OI6 A;  4KC4 A;  4DE7 A;  2OEF A;  2QH5 A;  4UEG A;  1S4N A;  2X60 A;  2YCM A;  2YQC A;  3OH3 A;  4D48 A;  3OGZ A;  5HS2 A;  3CKV A;  1VGT A;  4JD0 A;  2Y4J A;  4AYL A;  3ZLK A;  1LVW A;  1TW1 A;  3I0G A;  2O1H A;  1NF5 B;  1FGG A;  2OI5 A;  2Y4L A;  1S4P A;  5C4D A;  4KPZ A;  3I0C A;  1H7E A;  2W0W A;  1W55 A;  4EE5 A;  5C4E A;  3V0L A;  2ZU7 A;  1WT1 A;  4LW3 A;  3OC9 A;  2I5E A;  1FOA A;  3JUJ A;  2PA4 A;  1ZDF A;  2VS4 A;  2XME A;  5FTS A;  3RSB A;  2Y7A A;  3CKJ A;  2AM4 A;  3N9W A;  3OH2 A;  4Y62 A;  2D7I A;  5C4F A;  3JTJ A;  1O0R A;  3IOH A;  4Y7G A;  2P73 A;  1FXJ A;  3PNN A;  5AJN A;  3V0N A;  1TVY A;  4FRM A;  4FRA A;  1VZU A;  2WAW A;  4FQW A;  4ZDQ A;  2XWN A;  2V0K A;  1WT3 A;  3NGW A;  2FFV A;  3SXB A;  5C47 A;  3BCV A;  5C48 A;  1XHB A;  4HO4 A;  3CGX A;  4FRP A;  1ZJ1 A;  4FRO A;  2E8B A;  4D0Z A;  2RJ1 A;  2I7B A;  3SX7 A;  2RJ4 A;  1TZF A;  5EJ1 A;  1HV9 A;  3PKQ A;  1G95 A;  3V91 A;  3Q4S A;  2AH9 A;  2WE9 A;  1H7H A;  1GQ9 A;  1FG5 N;  2W0V A;  2GGQ A;  4CJB A;  1H4C A;  1FO9 A;  1WT2 A;  4BMA A;  2V0L A;  4R7P A;  3F1C A;  3POL A;  5L6S A;  1INJ A;  2NXV A;  2Y6P A;  4L41 C;  3V90 A;  2YQH A;  5CQM X;  4YS8 A;  1QGQ A;  3OKR A;  1LL0 A;  2Z87 A;  2BO8 A;  5C8R A;  2WVL A;  4AAW A;  3SX5 A;  5C1L A;  4BQH A;  1O7Q A;  1H5S A;  1ZCU A;  1FWY A;  4FCE A;  4AYJ A;  1GWW A;  1PZT A;  1NHE B;  2V0H A;  4EE3 A;  1VH1 A;  1G9R A;  3ZGF A;  1V84 A;  4HO0 A;  3SXC A;  5IDS A;  4CJ8 A;  1NWG B;  1QG8 A;  1ON6 A;  3TZT A;  1OQM B;  3EE5 A;  5C3A A;  1H5S D;  3LW6 A;  4C2S A;  1R7T A;  4D11 A;  2YES A;  2DPW A;  5CMH A;  4HO5 A;  3I0F A;  4FRL A;  1VIC A;  1SS9 A;  1YRO B;  4KPX A;  1JV3 A;  1LZ7 A;  3DK5 A;  1ZI4 A;  1VZX A;  1VH3 A;  2D0J A;  3V0Q A;  1WT0 A;  4B4G A;  2ZU8 A;  1G1L A;  3D5N A;  2FYA A;  2BO4 A;  2MZB A;  3KIA A;  1HM0 A;  2D7R A;  2YC3 A;  2FY7 A;  4K6R A;  4B42 A;  4HOC A;  4M2B A;  3I0J A;  3I0E A;  2FYD B;  4HCQ A;  3E25 A;  1OMX A;  2FYC B;  2RJ7 A;  3U2T A;  4Y63 A;  4DEC A;  5C4C A;  2OEG A;  3I0I X;  1G23 A;  4NAI A;  1H5R A;  3SPT A;  1FXO A;  1ZI1 A;  4G3Q A;  4ARW A;  1ZCT A;  4HO3 A;  3I0D A;  4KT7 A;  3HL3 A;  4B2X A;  5IFY A;  1R81 A;  1LZI A;  3OH1 A;  4G87 A;  2OI7 A;  1H7L A;  3RMV A;  5IDT A;  5C3B A;  1G97 A;  2P6W A;  1ON8 A;  2RJ5 A;  3GUE A;  4HG6 A;  1FGX A;  3F1Y A;  3T7N A;  2JCL A;  1MP4 A;  1VGU A;  4Y6U A;  5FU8 A;  4J18 A;  2AM3 A;  1JVD A;  2JCO A;  4M4K A;  1O7O A;  3U2W A;  4Y64 A;  4ECM A;  2YQJ A;  3D8V A;  3R2W A;  4P02 A;  2JCJ A;  3SX3 A;  3I0H A;  1NKH B;  3SXA A;  2ICX A;  4Y7V A;  3CKO A;  2VD4 A;  1KWS A;  1S4O A;  3CU0 A;  5J49 A;  5I1F A;  1VGW A;  3T7M A;  5C4B A;  1GQC A;  1PZY B;  2VXM A;  3SXG A;  3R3I A;  1ZJ0 A;  4LW6 A;  1GA8 A;  1HJL A;  3JUK A;  2XWM A;  2Y4K A;  4Y9X A;  2X5Z A;  1H7T A;  4M28 A;  5DDT A;  1G0R A;  4NAK A;  1GWV A;  2VS3 A;  2BO6 A;  1MC3 A;  3PKP A;  3U2X A;  1FR9 A;  4EE4 A;  1QGS A;  1H3M A;  2X5S A;  1IIN A;  1H5S B;  3QVB A;  4D0T A;  4EEO A;  4Y7F A;  2RIT A;  1W77 A;  3E26 A;  3V0M A;  2RJ9 A;  1R7X A;  2Y4M A;  1VPA A;  5FUH A;  1MP3 A;  4P00 A;  1VM8 A;  1H5T B;  4Y7U A;  2AE7 A;  4IRQ A;  3V8Z A;  4HO6 A;  1FRW A;  1OMZ A;  3ST8 A;  2E3D A;  1H5T A;  1EYR A;  3U2V A;  1HM9 A;  1JYK A;  5C3D A;  2PGV A;  5CQP A;  2YC5 A;  2WEE A;  1NMM B;  1R82 A;  4FRQ A;  5CQO A;  1FO8 A;  2APC A;  3I0K A;  2AM5 A;  1R7U A;  5CMF X;  2RJ8 A;  3V0P A;  2VXL A;  3OH4 A;  1LL3 A;  4B3U A;  1Z90 A;  2CU2 A;  5C38 A;  1MP5 A;  1HJJ A;  2I5K A;  2PGY A;  1ZJ3 A;  5DDV A;  3OH0 A;  1XZ6 A;  1ZCV A;  1TW5 A;  2RIY A;  2QKX A;  5CMI A;  1ZI5 A;  3USQ A;  1H5R B;  1H4D A;  1ZI3 A;  4B4B A;  4B4M A;  3CKN A;  5CQN X;  1VZT A;  4B5B A;  2ICY A;  5L6V A;  3D98 A;  2X65 A;  5FV9 A;  4JIS A;  2RIX A;  3BRK X;  1ZJ2 A;  1JYL A;  4HO9 A;  1ZJO A;  4GBP A;  2VSH A;  3Q7U A;  5FTV A;  1V83 A;  5EIY A;  4FCU A;  3ZF8 A;  2RIZ A;  1LL2 A;  4MND A;  4G3P A;  5CMJ A;  3T7O A;  4MYB A;  4Y6N A;  3U0Y A;  4NAL A;  1FZW A;  2Q4J A;  1ZIZ A;  4B2W A;  3SXD A;  1YP3 A;  2BO7 A;  3FWW A;  1LZ0 A;  3ZLL A;  5JQQ A;  1H7Q A;  5CMG X;  3I0L A;  2VFZ A;  2AGD A;  5CQL X;  3IOJ A;  4HO2 A;  4KNX A;  4FRH A;  1R7Y A;  1H5S C;  2YQS A;  4AC3 A;  4CJC A;  1EZI A;  2AES A;  3OAM A;  4KXO A;  2WGZ A;  2VSI A;  3IOI A;  3USR A;  4NAN A;  3U2U A;  2WVK A;  1H4E A;  3DJ4 A;  4KC1 A;  5C1G A;  1G2V A;  5FYE A;  3SX8 A;  4XWI A;  2O1F A;  3RMW A;  1O23 B;  2UX8 A;  4E1K A;  1I52 A;  3K8E A;  5C49 A;  3O3P A;  2A8W A;  3V0O A;  4D11 C;  1ZJP A;  5FU0 A;  1JV1 A;  4ASJ A;  3K8D A;  5AJO A;  1FR8 A;  3DUV A;  1WVC A;  4KNR A; 
#chains in the Genus database with same CATH topology
 1G8O A;  1YP2 A;  2PX7 A;  5C36 A;  2V0J A;  1WSZ A;  3V8Y A;  1QWJ A;  5C1H A;  2Z86 A;  1GX4 A;  2GGO A;  1IIM A;  1LZJ A;  4KRV A;  2P72 A;  1G3L A;  4EVW A;  3Q80 A;  2VS5 A;  2RJ6 A;  4M2A A;  4EEG A;  2A8U A;  4IRP A;  1NQI B;  2FYB A;  1INI A;  3CKQ A;  4Y7T A;  4DDZ A;  4FRE A;  4O6N A;  1K4V A;  1R7V A;  2JCK A;  4EEM A;  1V82 A;  5EJZ A;  3U0X A;  4ASY A;  1E5K A;  4CVH A;  2J0B A;  4EEA A;  2WVM A;  1H7F A;  1GX0 A;  1YP4 A;  4FRB A;  5AJP A;  2QGI A;  2RJ0 A;  2FFU A;  3ZGG A;  1ZHJ A;  2J0A A;  1W57 A;  1HM8 A;  4KQL A;  2V0I A;  4G3S A;  1JVG A;  1ZDG A;  2O1G A;  3SXE A;  1H7G A;  1R80 A;  3TQD A;  4FRD A;  2ZU9 A;  2AEC A;  2VK9 A;  2XMH A;  1VGZ A;  4KC2 A;  4HO8 A;  5BXC A;  3FOQ A;  1ZCY A;  2XWL A;  1G93 A;  2OI6 A;  4KC4 A;  4DE7 A;  2OEF A;  2QH5 A;  4UEG A;  1S4N A;  2X60 A;  2YCM A;  2YQC A;  3OH3 A;  4D48 A;  3OGZ A;  5HS2 A;  3CKV A;  1VGT A;  4JD0 A;  2Y4J A;  4AYL A;  3ZLK A;  1LVW A;  1TW1 A;  3I0G A;  2O1H A;  1NF5 B;  1FGG A;  2OI5 A;  2Y4L A;  1S4P A;  5C4D A;  4KPZ A;  3I0C A;  1H7E A;  2W0W A;  1W55 A;  4EE5 A;  5C4E A;  3V0L A;  2ZU7 A;  1WT1 A;  4LW3 A;  3OC9 A;  2I5E A;  1FOA A;  3JUJ A;  2PA4 A;  1ZDF A;  2VS4 A;  2XME A;  5FTS A;  3RSB A;  2Y7A A;  3CKJ A;  2AM4 A;  3N9W A;  3OH2 A;  4Y62 A;  2D7I A;  5C4F A;  3JTJ A;  1O0R A;  3IOH A;  4Y7G A;  2P73 A;  1FXJ A;  5D91 A;  3PNN A;  5AJN A;  3V0N A;  1TVY A;  4FRM A;  4FRA A;  1VZU A;  2WAW A;  4FQW A;  4ZDQ A;  2XWN A;  2V0K A;  1WT3 A;  3NGW A;  2FFV A;  3SXB A;  5C47 A;  3BCV A;  5C48 A;  1XHB A;  4HO4 A;  3CGX A;  4FRP A;  1ZJ1 A;  4FRO A;  2E8B A;  4D0Z A;  5D92 A;  2RJ1 A;  2I7B A;  3SX7 A;  2RJ4 A;  1TZF A;  5EJ1 A;  1HV9 A;  3PKQ A;  1G95 A;  4FIX A;  3V91 A;  3Q4S A;  2AH9 A;  2WE9 A;  1H7H A;  1GQ9 A;  1FG5 N;  2W0V A;  2GGQ A;  4CJB A;  1H4C A;  1FO9 A;  1WT2 A;  4Q7C A;  4BMA A;  2V0L A;  4R7P A;  3F1C A;  3POL A;  5L6S A;  1INJ A;  2NXV A;  2Y6P A;  4L41 C;  3V90 A;  2YQH A;  5CQM X;  4YS8 A;  1QGQ A;  3OKR A;  1LL0 A;  2Z87 A;  2BO8 A;  5C8R A;  2WVL A;  4AAW A;  3SX5 A;  5C1L A;  4BQH A;  1O7Q A;  1H5S A;  1ZCU A;  1FWY A;  4FCE A;  4AYJ A;  1GWW A;  1PZT A;  1NHE B;  2V0H A;  4EE3 A;  1VH1 A;  1G9R A;  3ZGF A;  1V84 A;  4HO0 A;  3SXC A;  5IDS A;  4CJ8 A;  1NWG B;  1QG8 A;  1ON6 A;  3TZT A;  1OQM B;  3EE5 A;  4MIX A;  5C3A A;  1H5S D;  3LW6 A;  4C2S A;  1R7T A;  4D11 A;  2YES A;  2DPW A;  5CMH A;  4HO5 A;  3I0F A;  4FRL A;  1VIC A;  1SS9 A;  1YRO B;  4KPX A;  1JV3 A;  1LZ7 A;  3DK5 A;  1ZI4 A;  1VZX A;  1VH3 A;  2D0J A;  3V0Q A;  1WT0 A;  4B4G A;  2ZU8 A;  1G1L A;  3D5N A;  2FYA A;  2BO4 A;  2MZB A;  3KIA A;  1HM0 A;  2D7R A;  2YC3 A;  2FY7 A;  4K6R A;  4B42 A;  4HOC A;  4M2B A;  3I0J A;  3I0E A;  2FYD B;  4HCQ A;  3E25 A;  1OMX A;  2FYC B;  2RJ7 A;  3U2T A;  4Y63 A;  4DEC A;  5C4C A;  2OEG A;  3I0I X;  1G23 A;  4NAI A;  1H5R A;  3SPT A;  1FXO A;  1ZI1 A;  4G3Q A;  4ARW A;  1ZCT A;  4HO3 A;  3I0D A;  4KT7 A;  3HL3 A;  2C0N A;  4B2X A;  5IFY A;  1R81 A;  1LZI A;  3OH1 A;  4G87 A;  2OI7 A;  1H7L A;  3RMV A;  5IDT A;  5C3B A;  1G97 A;  2P6W A;  1ON8 A;  2RJ5 A;  3GUE A;  4HG6 A;  1FGX A;  3F1Y A;  3T7N A;  2JCL A;  1MP4 A;  1VGU A;  4Y6U A;  5FU8 A;  4J18 A;  2AM3 A;  1JVD A;  2JCO A;  4M4K A;  1O7O A;  3U2W A;  4Y64 A;  4ECM A;  2YQJ A;  3D8V A;  3R2W A;  4P02 A;  2JCJ A;  3SX3 A;  3I0H A;  1NKH B;  3SXA A;  2ICX A;  4Y7V A;  3CKO A;  2VD4 A;  1KWS A;  1S4O A;  3CU0 A;  5J49 A;  5I1F A;  1VGW A;  3T7M A;  5C4B A;  1GQC A;  1PZY B;  2VXM A;  3SXG A;  3R3I A;  1ZJ0 A;  4LW6 A;  1GA8 A;  1HJL A;  3JUK A;  2XWM A;  2Y4K A;  4Y9X A;  2X5Z A;  1H7T A;  4M28 A;  5DDT A;  1G0R A;  4NAK A;  1GWV A;  2VS3 A;  2BO6 A;  1MC3 A;  3PKP A;  3U2X A;  1FR9 A;  4EE4 A;  1QGS A;  1H3M A;  2X5S A;  1IIN A;  1H5S B;  3QVB A;  4D0T A;  4EEO A;  4Y7F A;  2RIT A;  1W77 A;  3E26 A;  3V0M A;  2RJ9 A;  1R7X A;  2Y4M A;  1VPA A;  5FUH A;  1MP3 A;  4P00 A;  1VM8 A;  1H5T B;  4Y7U A;  2AE7 A;  4IRQ A;  3V8Z A;  4HO6 A;  1FRW A;  1OMZ A;  3ST8 A;  2E3D A;  1H5T A;  1EYR A;  3U2V A;  1HM9 A;  1JYK A;  5C3D A;  2PGV A;  5CQP A;  2YC5 A;  2WEE A;  1NMM B;  1R82 A;  4FRQ A;  5CQO A;  1FO8 A;  2APC A;  3I0K A;  2AM5 A;  1R7U A;  5CMF X;  2RJ8 A;  3V0P A;  2VXL A;  3OH4 A;  1LL3 A;  4B3U A;  1Z90 A;  2CU2 A;  5C38 A;  1MP5 A;  1HJJ A;  2I5K A;  2PGY A;  1ZJ3 A;  5DDV A;  3OH0 A;  1XZ6 A;  1ZCV A;  1TW5 A;  2RIY A;  2QKX A;  5CMI A;  1ZI5 A;  3USQ A;  1H5R B;  1H4D A;  1ZI3 A;  4B4B A;  4B4M A;  3CKN A;  5CQN X;  4O6M A;  1VZT A;  4B5B A;  2ICY A;  5L6V A;  3D98 A;  2X65 A;  5FV9 A;  4JIS A;  2RIX A;  3BRK X;  1ZJ2 A;  1JYL A;  4HO9 A;  1ZJO A;  4GBP A;  2VSH A;  3Q7U A;  5FTV A;  1V83 A;  5EIY A;  4FCU A;  3ZF8 A;  2RIZ A;  1LL2 A;  4MND A;  4G3P A;  5CMJ A;  3T7O A;  4FIY A;  4MYB A;  4Y6N A;  3U0Y A;  4NAL A;  1FZW A;  2Q4J A;  1ZIZ A;  4B2W A;  3SXD A;  1YP3 A;  2BO7 A;  3FWW A;  1LZ0 A;  3ZLL A;  5JQQ A;  1H7Q A;  5CMG X;  3I0L A;  2VFZ A;  2AGD A;  5CQL X;  3IOJ A;  4HO2 A;  4KNX A;  4FRH A;  1R7Y A;  1H5S C;  2YQS A;  4AC3 A;  4CJC A;  1EZI A;  2AES A;  3OAM A;  4KXO A;  2WGZ A;  2VSI A;  3IOI A;  3USR A;  4NAN A;  3U2U A;  2WVK A;  1H4E A;  3DJ4 A;  4KC1 A;  5C1G A;  1G2V A;  5FYE A;  3SX8 A;  4XWI A;  2O1F A;  3RMW A;  1O23 B;  2UX8 A;  4E1K A;  1I52 A;  3K8E A;  5C49 A;  3O3P A;  2A8W A;  3V0O A;  4D11 C;  1ZJP A;  5FU0 A;  1JV1 A;  4ASJ A;  3K8D A;  5AJO A;  1FR8 A;  3DUV A;  1WVC A;  4KNR A; 
#chains in the Genus database with same CATH homology
 1G8O A;  1YP2 A;  2PX7 A;  5C36 A;  2V0J A;  1WSZ A;  3V8Y A;  1QWJ A;  5C1H A;  2Z86 A;  1GX4 A;  2GGO A;  1IIM A;  1LZJ A;  4KRV A;  2P72 A;  1G3L A;  4EVW A;  3Q80 A;  2VS5 A;  2RJ6 A;  4M2A A;  4EEG A;  2A8U A;  4IRP A;  1NQI B;  2FYB A;  1INI A;  3CKQ A;  4Y7T A;  4DDZ A;  4FRE A;  4O6N A;  1K4V A;  1R7V A;  2JCK A;  4EEM A;  1V82 A;  5EJZ A;  3U0X A;  4ASY A;  1E5K A;  4CVH A;  2J0B A;  4EEA A;  2WVM A;  1H7F A;  1GX0 A;  1YP4 A;  4FRB A;  5AJP A;  2QGI A;  2RJ0 A;  2FFU A;  3ZGG A;  1ZHJ A;  2J0A A;  1W57 A;  1HM8 A;  4KQL A;  2V0I A;  4G3S A;  1JVG A;  1ZDG A;  2O1G A;  3SXE A;  1H7G A;  1R80 A;  3TQD A;  4FRD A;  2ZU9 A;  2AEC A;  2VK9 A;  2XMH A;  1VGZ A;  4KC2 A;  4HO8 A;  5BXC A;  3FOQ A;  1ZCY A;  2XWL A;  1G93 A;  2OI6 A;  4KC4 A;  4DE7 A;  2OEF A;  2QH5 A;  4UEG A;  1S4N A;  2X60 A;  2YCM A;  2YQC A;  3OH3 A;  4D48 A;  3OGZ A;  5HS2 A;  3CKV A;  1VGT A;  4JD0 A;  2Y4J A;  4AYL A;  3ZLK A;  1LVW A;  1TW1 A;  3I0G A;  2O1H A;  1NF5 B;  1FGG A;  2OI5 A;  2Y4L A;  1S4P A;  5C4D A;  4KPZ A;  3I0C A;  1H7E A;  2W0W A;  1W55 A;  4EE5 A;  5C4E A;  3V0L A;  2ZU7 A;  1WT1 A;  4LW3 A;  3OC9 A;  2I5E A;  1FOA A;  3JUJ A;  2PA4 A;  1ZDF A;  2VS4 A;  2XME A;  5FTS A;  3RSB A;  2Y7A A;  3CKJ A;  2AM4 A;  3N9W A;  3OH2 A;  4Y62 A;  2D7I A;  5C4F A;  3JTJ A;  1O0R A;  3IOH A;  4Y7G A;  2P73 A;  1FXJ A;  5D91 A;  3PNN A;  5AJN A;  3V0N A;  1TVY A;  4FRM A;  4FRA A;  1VZU A;  2WAW A;  4FQW A;  4ZDQ A;  2XWN A;  2V0K A;  1WT3 A;  3NGW A;  2FFV A;  3SXB A;  5C47 A;  3BCV A;  5C48 A;  1XHB A;  4HO4 A;  3CGX A;  4FRP A;  1ZJ1 A;  4FRO A;  2E8B A;  4D0Z A;  5D92 A;  2RJ1 A;  2I7B A;  3SX7 A;  2RJ4 A;  1TZF A;  5EJ1 A;  1HV9 A;  3PKQ A;  1G95 A;  4FIX A;  3V91 A;  3Q4S A;  2AH9 A;  2WE9 A;  1H7H A;  1GQ9 A;  1FG5 N;  2W0V A;  2GGQ A;  4CJB A;  1H4C A;  1FO9 A;  1WT2 A;  4Q7C A;  4BMA A;  2V0L A;  4R7P A;  3F1C A;  3POL A;  5L6S A;  1INJ A;  2NXV A;  2Y6P A;  4L41 C;  3V90 A;  2YQH A;  5CQM X;  4YS8 A;  1QGQ A;  3OKR A;  1LL0 A;  2Z87 A;  2BO8 A;  5C8R A;  2WVL A;  4AAW A;  3SX5 A;  5C1L A;  4BQH A;  1O7Q A;  1H5S A;  1ZCU A;  1FWY A;  4FCE A;  4AYJ A;  1GWW A;  1PZT A;  1NHE B;  2V0H A;  4EE3 A;  1VH1 A;  1G9R A;  3ZGF A;  1V84 A;  4HO0 A;  3SXC A;  5IDS A;  4CJ8 A;  1NWG B;  1QG8 A;  1ON6 A;  3TZT A;  1OQM B;  3EE5 A;  4MIX A;  5C3A A;  1H5S D;  3LW6 A;  4C2S A;  1R7T A;  4D11 A;  2YES A;  2DPW A;  5CMH A;  4HO5 A;  3I0F A;  4FRL A;  1VIC A;  1SS9 A;  1YRO B;  4KPX A;  1JV3 A;  1LZ7 A;  3DK5 A;  1ZI4 A;  1VZX A;  1VH3 A;  2D0J A;  3V0Q A;  1WT0 A;  4B4G A;  2ZU8 A;  1G1L A;  3D5N A;  2FYA A;  2BO4 A;  2MZB A;  3KIA A;  1HM0 A;  2D7R A;  2YC3 A;  2FY7 A;  4K6R A;  4B42 A;  4HOC A;  4M2B A;  3I0J A;  3I0E A;  2FYD B;  4HCQ A;  3E25 A;  1OMX A;  2FYC B;  2RJ7 A;  3U2T A;  4Y63 A;  4DEC A;  5C4C A;  2OEG A;  3I0I X;  1G23 A;  4NAI A;  1H5R A;  3SPT A;  1FXO A;  1ZI1 A;  4G3Q A;  4ARW A;  1ZCT A;  4HO3 A;  3I0D A;  4KT7 A;  3HL3 A;  2C0N A;  4B2X A;  5IFY A;  1R81 A;  1LZI A;  3OH1 A;  4G87 A;  2OI7 A;  1H7L A;  3RMV A;  5IDT A;  5C3B A;  1G97 A;  2P6W A;  1ON8 A;  2RJ5 A;  3GUE A;  4HG6 A;  1FGX A;  3F1Y A;  3T7N A;  2JCL A;  1MP4 A;  1VGU A;  4Y6U A;  5FU8 A;  4J18 A;  2AM3 A;  1JVD A;  2JCO A;  4M4K A;  1O7O A;  3U2W A;  4Y64 A;  4ECM A;  2YQJ A;  3D8V A;  3R2W A;  4P02 A;  2JCJ A;  3SX3 A;  3I0H A;  1NKH B;  3SXA A;  2ICX A;  4Y7V A;  3CKO A;  2VD4 A;  1KWS A;  1S4O A;  3CU0 A;  5J49 A;  5I1F A;  1VGW A;  3T7M A;  5C4B A;  1GQC A;  1PZY B;  2VXM A;  3SXG A;  3R3I A;  1ZJ0 A;  4LW6 A;  1GA8 A;  1HJL A;  3JUK A;  2XWM A;  2Y4K A;  4Y9X A;  2X5Z A;  1H7T A;  4M28 A;  5DDT A;  1G0R A;  4NAK A;  1GWV A;  2VS3 A;  2BO6 A;  1MC3 A;  3PKP A;  3U2X A;  1FR9 A;  4EE4 A;  1QGS A;  1H3M A;  2X5S A;  1IIN A;  1H5S B;  3QVB A;  4D0T A;  4EEO A;  4Y7F A;  2RIT A;  1W77 A;  3E26 A;  3V0M A;  2RJ9 A;  1R7X A;  2Y4M A;  1VPA A;  5FUH A;  1MP3 A;  4P00 A;  1VM8 A;  1H5T B;  4Y7U A;  2AE7 A;  4IRQ A;  3V8Z A;  4HO6 A;  1FRW A;  1OMZ A;  3ST8 A;  2E3D A;  1H5T A;  1EYR A;  3U2V A;  1HM9 A;  1JYK A;  5C3D A;  2PGV A;  5CQP A;  2YC5 A;  2WEE A;  1NMM B;  1R82 A;  4FRQ A;  5CQO A;  1FO8 A;  2APC A;  3I0K A;  2AM5 A;  1R7U A;  5CMF X;  2RJ8 A;  3V0P A;  2VXL A;  3OH4 A;  1LL3 A;  4B3U A;  1Z90 A;  2CU2 A;  5C38 A;  1MP5 A;  1HJJ A;  2I5K A;  2PGY A;  1ZJ3 A;  5DDV A;  3OH0 A;  1XZ6 A;  1ZCV A;  1TW5 A;  2RIY A;  2QKX A;  5CMI A;  1ZI5 A;  3USQ A;  1H5R B;  1H4D A;  1ZI3 A;  4B4B A;  4B4M A;  3CKN A;  5CQN X;  4O6M A;  1VZT A;  4B5B A;  2ICY A;  5L6V A;  3D98 A;  2X65 A;  5FV9 A;  4JIS A;  2RIX A;  3BRK X;  1ZJ2 A;  1JYL A;  4HO9 A;  1ZJO A;  4GBP A;  2VSH A;  3Q7U A;  5FTV A;  1V83 A;  5EIY A;  4FCU A;  3ZF8 A;  2RIZ A;  1LL2 A;  4MND A;  4G3P A;  5CMJ A;  3T7O A;  4FIY A;  4MYB A;  4Y6N A;  3U0Y A;  4NAL A;  1FZW A;  2Q4J A;  1ZIZ A;  4B2W A;  3SXD A;  1YP3 A;  2BO7 A;  3FWW A;  1LZ0 A;  3ZLL A;  5JQQ A;  1H7Q A;  5CMG X;  3I0L A;  2VFZ A;  2AGD A;  5CQL X;  3IOJ A;  4HO2 A;  4KNX A;  4FRH A;  1R7Y A;  1H5S C;  2YQS A;  4AC3 A;  4CJC A;  1EZI A;  2AES A;  3OAM A;  4KXO A;  2WGZ A;  2VSI A;  3IOI A;  3USR A;  4NAN A;  3U2U A;  2WVK A;  1H4E A;  3DJ4 A;  4KC1 A;  5C1G A;  1G2V A;  5FYE A;  3SX8 A;  4XWI A;  2O1F A;  3RMW A;  1O23 B;  2UX8 A;  4E1K A;  1I52 A;  3K8E A;  5C49 A;  3O3P A;  2A8W A;  3V0O A;  4D11 C;  1ZJP A;  5FU0 A;  1JV1 A;  4ASJ A;  3K8D A;  5AJO A;  1FR8 A;  3DUV A;  1WVC A;  4KNR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...