3V90A

Structure of t82m glycogenin mutant truncated at residue 270
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
266
structure length
260
Chain Sequence
MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTSRRLAVLTTPQVSDTMRKALEIVFDEVITVDILDSGDSAHLTLMKRPELGVMLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFEREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHVASEQGSFDGGDQGLLNTFFNSWATTDIRKHLPFIYNLSSISIYSYLPAFKAFGANAKVVHFLGQTKPWNYTYDTKTKSVRSMTHPQFLNVWWDIFTTSVVPLLQQFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycogenin-1
publication title Structural and biochemical insight into glycogenin inactivation by the glycogenosis-causing T82M mutation.
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 85
structure length 260
sequence length 266
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2011-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3v90A00
4XWIA 3DK5A 1V83A 5CQMX 2XMHA 3R2WA 3GUEA 4G3QA 4R7PA 4FRAA 2UX8A 2Z86A 2A8UA 4HO2A 1G95A 4EE5A 1G1LA 3SX7A 1FWYA 2PX7A 4KPXA 4UEGA 3EE5A 1LVWA 4Y7GA 1S4PA 1LZIA 2ICYA 4ECMA 1ZJOA 4Y7FA 2VD4A 4KC4A 2JCOA 2VXMA 3QVBA 3PNNA 1QGSA 1ZI3A 3JUJA 3KIAA 1XZ6A 4FREA 1JYKA 2VSIA 1ZJPA 3CKJA 4IRQA 2O1HA 4D0TA 1EYRA 3V0OA 2VS3A 1NWGB 1VZUA 1H7LA 3I0DA 3PKQA 3TZTA 1ZJ2A 2ICXA 1OMXA 2JCLA 4FQWA 1G23A 3OGZA 1QG8A 2VSHA 2MZBA 1JVGA 1Z90A 2RJ7A 1H7FA 5FTSA 2XWLA 4GBPA 2PA4A 2XMEA 2V0JA 2YC5A 4Y62A 4CJBA 4AYJA 3U2XA 2X65A 2AH9A 3U2WA 3SX5A 1XHBA 3SXCA 1WT2A 4D11A 2FYBA 4Y63A 5FTVA 2FFUA 4G87A 1G8OA 4HO0A 2I5EA 3CU0A 3CKQA 1H5SD 1VZTA 4IRPA 4JD0A 2RIZA 3RMVA 3DUVA 1HM0A 4AAWA 1WT3A 5I1FA 3Q80A 2RJ5A 4HO6A 3ST8A 4L41C 2W0VA 5FUHA 1FGXA 2YQJA 2AESA 2VFZA 4Y64A 2I7BA 2Y6PA 5J49A 4B4BA 2WE9A 4DE7A 2RJ8A 1OQMB 1JVDA 4NALA 5HS2A 2BO8A 1GA8A 2Y4KA 3USRA 3NGWA 4B3UA 2V0IA 3BRKX 4EE3A 1HJLA 1K4VA 1VGWA 1O7OA 4Y6NA 1MP4A 1NHEB 5C38A 4FRLA 4JISA 4KXOA 4B2WA 5C47A 1H7GA 3I0KA 4HO3A 2RJ4A 1GQ9A 5C1HA 2RJ9A 3IOIA 2OI5A 2ZU7A 3IOHA 3U2TA 1FZWA 1S4OA 4E1KA 1PZYB 4AYLA 1O7QA 1V84A 5C3BA 4ASYA 5DDVA 3V90A 4D48A 4EEOA 5C1LA 5IDSA 1FO8A 2AM5A 2X5ZA 4MYBA 5C48A 3RMWA 1YP2A 3ZF8A 1H5TB 1VZXA 2GGQA 2QKXA 2WGZA 5EJZA 3ZLKA 3OH2A 2VXLA 3T7MA 1TVYA 1H7EA 5C4FA 1R7YA 1INJA 4J18A 4KT7A 5C1GA 1LL0A 3I0EA 2FYCB 1H5SB 3Q4SA 4B2XA 1WT0A 3IOJA 3V0NA 4KC2A 1HV9A 5C4CA 2APCA 4KNRA 1G93A 1LZ7A 3LW6A 2NXVA 3OH0A 1ZJ0A 4CJCA 2D7RA 1I52A 5FU0A 4FROA 4B42A 1LZ0A 4P00A 4MNDA 3I0GA 1FXOA 2W0WA 4LW6A 5AJOA 3O3PA 2JCKA 2FY7A 2QGIA 1ZCVA 4BQHA 1ZI1A 4D0ZA 3OH4A 1ZI4A 3ZGGA 3ZGFA 1VH1A 1H4EA 2PGYA 2GGOA 2RJ0A 5CQLX 3V0PA 2X5SA 3ZLLA 3T7NA 1ZJ1A 3K8EA 2V0LA 2WVKA 1ZJ3A 3K8DA 1TW1A 3V0QA 1VGUA 4M28A 1ON8A 3F1YA 3CKNA 2RIYA 5EJ1A 1JYLA 1ZHJA 5DDTA 3RSBA 5C4BA 2P72A 3SXAA 2BO4A 2WVMA 3SX8A 1H5TA 3V0MA 4AC3A 4KQLA 2P6WA 4DDZA 2YQSA 3JTJA 3PKPA 2FFVA 4HO4A 1H5SA 3I0JA 3FOQA 3OKRA 1WVCA 5CMHA 5IDTA 4EEMA 1NF5B 2AGDA 1NKHB 1H4DA 1ZIZA 4G3PA 1HM9A 2RJ1A 1S4NA 1H7HA 3V91A 5FV9A 3SPTA 3OH1A 3V8YA 4D11C 1FXJA 1QGQA 1GQCA 1YP3A 1ZI5A 4B5BA 5CQNX 3I0IX 4FRMA 4NANA 2Y4LA 2Q4JA 4M2BA 2XWNA 4BMAA 1SS9A 4HO9A 1FGGA 1H4CA 3CKOA 1W55A 1NMMB 3OAMA 4HO8A 3Q7UA 5FYEA 1KWSA 5C4EA 1ZCYA 2O1GA 5AJNA 2CU2A 4ZDQA 5C8RA 5L6VA 3POLA 1FOAA 4HOCA 1H7TA 4FCUA 2ZU8A 3E25A 3SXBA 4B4MA 3OH3A 1YP4A 1H3MA 1VGZA 1WT1A 3I0FA 1GX0A 3U0XA 1MC3A 2E8BA 2AECA 4HO5A 2WAWA 2XWMA 1G0RA 1QWJA 3D8VA 3R3IA 4LW3A 2VS5A 4KNXA 3SXDA 3N9WA 5CMGX 1HJJA 4CJ8A 1H5RB 1VGTA 1FG5N 1YROB 4CVHA 1VICA 5FU8A 3I0HA 4K6RA 3CKVA 5CMFX 4Y7TA 1FR9A 2OI7A 4M4KA 4FRBA 2AE7A 4FCEA 4DECA 1ON6A 4ASJA 4Y7UA 3BCVA 2OI6A 1R7VA 1VH3A 1WSZA 1ZDFA 1E5KA 3E26A 2YESA 5JQQA 1R81A 2QH5A 5BXCA 1R7UA 2A8WA 4NAKA 5CQPA 2Z87A 2FYAA 3V0LA 1LL3A 1W57A 2O1FA 1JV3A 2YCMA 1V82A 4FRQA 2V0HA 3I0CA 4KPZA 2P73A 1O23B 2WEEA 3SXEA 1R7XA 5C4DA 4KRVA 2I5KA 5C3DA 2YQHA 1PZTA 4FRHA 1GX4A 2D0JA 1W77A 4Y7VA 1FRWA 3TQDA 2AM4A 4Y9XA 2VS4A 1IIMA 1H7QA 2Y4MA 3D98A 1G97A 3F1CA 3U2VA 3U0YA 4EE4A 1JV1A 3D5NA 2AM3A 4C2SA 1H5RA 5C49A 1GWVA 1GWWA 1ZCTA 4YS8A 2V0KA 2OEGA 1G3LA 2ZU9A 4HG6A 4FRPA 2YQCA 1EZIA 2FYDB 4M2AA 1FO9A 1ZCUA 1LL2A 2JCJA 1R80A 4Y6UA 2E3DA 1FR8A 1OMZA 1ZDGA 5AJPA 5IFYA 3T7OA 1O0RA 2X60A 2OEFA 5CMIA 3U2UA 4ARWA 3HL3A 2DPWA 5CMJA 5CQOA 3JUKA 4FRDA 1MP3A 4KC1A 4G3SA 3FWWA 2RIXA 1G9RA 1H5SC 1HM8A 5C36A 1VM8A 3I0LA 3V8ZA 3SX3A 3OC9A 3DJ4A 4EEGA 2D7IA 2YC3A 1MP5A 2PGVA 5C3AA 3CGXA 2Y7AA 2WVLA 1VPAA 2BO6A 4NAIA 2RJ6A 1TZFA 3USQA 4B4GA 1NQIB 5EIYA 2Y4JA 1LZJA 1R82A 4P02A 1TW5A 2RITA 4HCQA 3SXGA 4EVWA 1G2VA 1INIA 4EEAA 5L6SA 2BO7A 1R7TA 1IINA
chains in the Genus database with same CATH superfamily
4XWIA 3DK5A 1V83A 5CQMX 2XMHA 3R2WA 3GUEA 4G3QA 4R7PA 4FRAA 2UX8A 2Z86A 2A8UA 4HO2A 1G95A 4EE5A 1G1LA 3SX7A 1FWYA 2PX7A 4KPXA 4UEGA 3EE5A 1LVWA 4Y7GA 1S4PA 1LZIA 2ICYA 4ECMA 1ZJOA 4Y7FA 2VD4A 4KC4A 2JCOA 2VXMA 3QVBA 4FIYA 3PNNA 1QGSA 1ZI3A 3JUJA 3KIAA 1XZ6A 4FREA 1JYKA 2VSIA 1ZJPA 3CKJA 4IRQA 2O1HA 4D0TA 1EYRA 3V0OA 2VS3A 1NWGB 1VZUA 1H7LA 3I0DA 3PKQA 3TZTA 1ZJ2A 2ICXA 1OMXA 2JCLA 4FQWA 1G23A 3OGZA 1QG8A 2VSHA 2MZBA 1JVGA 1Z90A 2RJ7A 1H7FA 5FTSA 2XWLA 4GBPA 2PA4A 2XMEA 2V0JA 2YC5A 4Y62A 4CJBA 4AYJA 3U2XA 2X65A 2AH9A 3U2WA 3SX5A 1XHBA 3SXCA 1WT2A 4D11A 2FYBA 4Y63A 5FTVA 2FFUA 4G87A 1G8OA 4HO0A 2I5EA 3CU0A 3CKQA 1H5SD 1VZTA 4IRPA 4JD0A 2RIZA 3RMVA 3DUVA 1HM0A 4AAWA 1WT3A 5I1FA 3Q80A 2RJ5A 4HO6A 3ST8A 4L41C 2W0VA 5FUHA 1FGXA 2YQJA 2AESA 2VFZA 4Y64A 2I7BA 2Y6PA 5J49A 4B4BA 2WE9A 4DE7A 2RJ8A 1OQMB 1JVDA 4NALA 5HS2A 2BO8A 1GA8A 2Y4KA 3USRA 3NGWA 4B3UA 2V0IA 3BRKX 4EE3A 1HJLA 1K4VA 1VGWA 1O7OA 4Y6NA 1MP4A 1NHEB 5C38A 4FRLA 4JISA 4KXOA 4B2WA 5C47A 1H7GA 4MIXA 3I0KA 4HO3A 2RJ4A 1GQ9A 5C1HA 2RJ9A 3IOIA 2OI5A 2ZU7A 3IOHA 3U2TA 1FZWA 1S4OA 4E1KA 1PZYB 4AYLA 1O7QA 1V84A 5C3BA 4ASYA 5DDVA 3V90A 4D48A 4EEOA 5C1LA 5IDSA 1FO8A 2AM5A 2X5ZA 4MYBA 5C48A 3RMWA 1YP2A 3ZF8A 1H5TB 1VZXA 2GGQA 2QKXA 2WGZA 5EJZA 3ZLKA 3OH2A 2VXLA 3T7MA 1TVYA 1H7EA 5C4FA 1R7YA 1INJA 4J18A 4KT7A 5C1GA 1LL0A 3I0EA 2FYCB 1H5SB 3Q4SA 4B2XA 1WT0A 3IOJA 3V0NA 4KC2A 1HV9A 5C4CA 2APCA 4KNRA 1G93A 1LZ7A 3LW6A 2NXVA 3OH0A 1ZJ0A 4CJCA 2D7RA 1I52A 5FU0A 4FROA 4B42A 1LZ0A 4P00A 4MNDA 3I0GA 1FXOA 2W0WA 4LW6A 5AJOA 3O3PA 2JCKA 2FY7A 2QGIA 1ZCVA 4BQHA 1ZI1A 4D0ZA 3OH4A 1ZI4A 3ZGGA 3ZGFA 1VH1A 1H4EA 2PGYA 2GGOA 2RJ0A 5CQLX 3V0PA 2X5SA 3ZLLA 4O6NA 3T7NA 1ZJ1A 3K8EA 2V0LA 2WVKA 1ZJ3A 3K8DA 1TW1A 3V0QA 1VGUA 4M28A 1ON8A 3F1YA 3CKNA 2RIYA 5EJ1A 1JYLA 1ZHJA 5DDTA 3RSBA 5C4BA 2P72A 3SXAA 2BO4A 2WVMA 3SX8A 1H5TA 3V0MA 4AC3A 4KQLA 2P6WA 4DDZA 2YQSA 3JTJA 3PKPA 2FFVA 4HO4A 1H5SA 3I0JA 3FOQA 3OKRA 1WVCA 5CMHA 5IDTA 4EEMA 1NF5B 2AGDA 1NKHB 1H4DA 1ZIZA 4G3PA 1HM9A 2RJ1A 1S4NA 1H7HA 3V91A 5FV9A 3SPTA 3OH1A 3V8YA 4D11C 1FXJA 1QGQA 1GQCA 1YP3A 1ZI5A 4FIXA 4B5BA 5CQNX 3I0IX 4FRMA 4NANA 2Y4LA 2Q4JA 4O6MA 4M2BA 2XWNA 4BMAA 1SS9A 4HO9A 1FGGA 1H4CA 3CKOA 1W55A 1NMMB 3OAMA 4HO8A 3Q7UA 5FYEA 1KWSA 5C4EA 1ZCYA 2O1GA 5AJNA 2CU2A 4ZDQA 5C8RA 5L6VA 3POLA 1FOAA 4HOCA 1H7TA 4FCUA 2ZU8A 3E25A 3SXBA 4B4MA 3OH3A 5D91A 1YP4A 1H3MA 1VGZA 1WT1A 3I0FA 1GX0A 3U0XA 1MC3A 2E8BA 2AECA 4HO5A 2WAWA 2XWMA 1G0RA 1QWJA 3D8VA 3R3IA 4LW3A 2VS5A 4KNXA 3SXDA 3N9WA 5CMGX 1HJJA 4CJ8A 1H5RB 1VGTA 1FG5N 1YROB 4CVHA 1VICA 5FU8A 3I0HA 2C0NA 4K6RA 3CKVA 5CMFX 4Y7TA 1FR9A 2OI7A 4M4KA 4FRBA 2AE7A 4FCEA 4DECA 1ON6A 4ASJA 4Y7UA 3BCVA 2OI6A 1R7VA 1VH3A 1WSZA 1ZDFA 1E5KA 3E26A 2YESA 5JQQA 1R81A 2J0BA 2QH5A 5BXCA 1R7UA 2A8WA 4NAKA 5CQPA 2Z87A 2FYAA 3V0LA 1LL3A 1W57A 2O1FA 1JV3A 2YCMA 1V82A 4FRQA 2V0HA 3I0CA 4KPZA 2P73A 1O23B 2WEEA 3SXEA 1R7XA 5C4DA 4KRVA 2VK9A 2I5KA 5C3DA 2YQHA 1PZTA 4FRHA 1GX4A 2D0JA 1W77A 4Y7VA 1FRWA 3TQDA 2AM4A 4Y9XA 2VS4A 1IIMA 1H7QA 2Y4MA 3D98A 1G97A 3F1CA 5D92A 3U2VA 3U0YA 4EE4A 1JV1A 3D5NA 2AM3A 4C2SA 1H5RA 5C49A 1GWVA 1GWWA 1ZCTA 4YS8A 2V0KA 2OEGA 1G3LA 2ZU9A 4HG6A 4FRPA 2YQCA 1EZIA 2FYDB 4M2AA 1FO9A 1ZCUA 1LL2A 2JCJA 1R80A 4Y6UA 2E3DA 1FR8A 1OMZA 1ZDGA 5AJPA 5IFYA 3T7OA 1O0RA 2X60A 2J0AA 2OEFA 5CMIA 3U2UA 4ARWA 3HL3A 2DPWA 5CMJA 5CQOA 3JUKA 4FRDA 1MP3A 4Q7CA 4KC1A 4G3SA 3FWWA 2RIXA 1G9RA 1H5SC 1HM8A 5C36A 1VM8A 3I0LA 3V8ZA 3SX3A 3OC9A 3DJ4A 4EEGA 2D7IA 2YC3A 1MP5A 2PGVA 5C3AA 3CGXA 2Y7AA 2WVLA 1VPAA 2BO6A 4NAIA 2RJ6A 1TZFA 3USQA 4B4GA 1NQIB 5EIYA 2Y4JA 1LZJA 1R82A 4P02A 1TW5A 2RITA 4HCQA 3SXGA 4EVWA 1G2VA 1INIA 4EEAA 5L6SA 2BO7A 1R7TA 1IINA
chains in the Genus database with same CATH topology
4XWIA 3DK5A 1V83A 5CQMX 2XMHA 3R2WA 3GUEA 4G3QA 4R7PA 4FRAA 2UX8A 2Z86A 2A8UA 4HO2A 1G95A 4EE5A 1G1LA 3SX7A 1FWYA 2PX7A 4KPXA 4UEGA 3EE5A 1LVWA 4Y7GA 1S4PA 1LZIA 2ICYA 4ECMA 1ZJOA 4Y7FA 2VD4A 4KC4A 2JCOA 2VXMA 3QVBA 4FIYA 3PNNA 1QGSA 1ZI3A 3JUJA 3KIAA 1XZ6A 4FREA 1JYKA 2VSIA 1ZJPA 3CKJA 4IRQA 2O1HA 4D0TA 1EYRA 3V0OA 2VS3A 1NWGB 1VZUA 1H7LA 3I0DA 3PKQA 3TZTA 1ZJ2A 2ICXA 1OMXA 2JCLA 4FQWA 1G23A 3OGZA 1QG8A 2VSHA 2MZBA 1JVGA 1Z90A 2RJ7A 1H7FA 5FTSA 2XWLA 4GBPA 2PA4A 2XMEA 2V0JA 2YC5A 4Y62A 4CJBA 4AYJA 3U2XA 2X65A 2AH9A 3U2WA 3SX5A 1XHBA 3SXCA 1WT2A 4D11A 2FYBA 4Y63A 5FTVA 2FFUA 4G87A 1G8OA 4HO0A 2I5EA 3CU0A 3CKQA 1H5SD 1VZTA 4IRPA 4JD0A 2RIZA 3RMVA 3DUVA 1HM0A 4AAWA 1WT3A 5I1FA 3Q80A 2RJ5A 4HO6A 3ST8A 4L41C 2W0VA 5FUHA 1FGXA 2YQJA 2AESA 2VFZA 4Y64A 2I7BA 2Y6PA 5J49A 4B4BA 2WE9A 4DE7A 2RJ8A 1OQMB 1JVDA 4NALA 5HS2A 2BO8A 1GA8A 2Y4KA 3USRA 3NGWA 4B3UA 2V0IA 3BRKX 4EE3A 1HJLA 1K4VA 1VGWA 1O7OA 4Y6NA 1MP4A 1NHEB 5C38A 4FRLA 4JISA 4KXOA 4B2WA 5C47A 1H7GA 4MIXA 3I0KA 4HO3A 2RJ4A 1GQ9A 5C1HA 2RJ9A 3IOIA 2OI5A 2ZU7A 3IOHA 3U2TA 1FZWA 1S4OA 4E1KA 1PZYB 4AYLA 1O7QA 1V84A 5C3BA 4ASYA 5DDVA 3V90A 4D48A 4EEOA 5C1LA 5IDSA 1FO8A 2AM5A 2X5ZA 4MYBA 5C48A 3RMWA 1YP2A 3ZF8A 1H5TB 1VZXA 2GGQA 2QKXA 2WGZA 5EJZA 3ZLKA 3OH2A 2VXLA 3T7MA 1TVYA 1H7EA 5C4FA 1R7YA 1INJA 4J18A 4KT7A 5C1GA 1LL0A 3I0EA 2FYCB 1H5SB 3Q4SA 4B2XA 1WT0A 3IOJA 3V0NA 4KC2A 1HV9A 5C4CA 2APCA 4KNRA 1G93A 1LZ7A 3LW6A 2NXVA 3OH0A 1ZJ0A 4CJCA 2D7RA 1I52A 5FU0A 4FROA 4B42A 1LZ0A 4P00A 4MNDA 3I0GA 1FXOA 2W0WA 4LW6A 5AJOA 3O3PA 2JCKA 2FY7A 2QGIA 1ZCVA 4BQHA 1ZI1A 4D0ZA 3OH4A 1ZI4A 3ZGGA 3ZGFA 1VH1A 1H4EA 2PGYA 2GGOA 2RJ0A 5CQLX 3V0PA 2X5SA 3ZLLA 4O6NA 3T7NA 1ZJ1A 3K8EA 2V0LA 2WVKA 1ZJ3A 3K8DA 1TW1A 3V0QA 1VGUA 4M28A 1ON8A 3F1YA 3CKNA 2RIYA 5EJ1A 1JYLA 1ZHJA 5DDTA 3RSBA 5C4BA 2P72A 3SXAA 2BO4A 2WVMA 3SX8A 1H5TA 3V0MA 4AC3A 4KQLA 2P6WA 4DDZA 2YQSA 3JTJA 3PKPA 2FFVA 4HO4A 1H5SA 3I0JA 3FOQA 3OKRA 1WVCA 5CMHA 5IDTA 4EEMA 1NF5B 2AGDA 1NKHB 1H4DA 1ZIZA 4G3PA 1HM9A 2RJ1A 1S4NA 1H7HA 3V91A 5FV9A 3SPTA 3OH1A 3V8YA 4D11C 1FXJA 1QGQA 1GQCA 1YP3A 1ZI5A 4FIXA 4B5BA 5CQNX 3I0IX 4FRMA 4NANA 2Y4LA 2Q4JA 4O6MA 4M2BA 2XWNA 4BMAA 1SS9A 4HO9A 1FGGA 1H4CA 3CKOA 1W55A 1NMMB 3OAMA 4HO8A 3Q7UA 5FYEA 1KWSA 5C4EA 1ZCYA 2O1GA 5AJNA 2CU2A 4ZDQA 5C8RA 5L6VA 3POLA 1FOAA 4HOCA 1H7TA 4FCUA 2ZU8A 3E25A 3SXBA 4B4MA 3OH3A 5D91A 1YP4A 1H3MA 1VGZA 1WT1A 3I0FA 1GX0A 3U0XA 1MC3A 2E8BA 2AECA 4HO5A 2WAWA 2XWMA 1G0RA 1QWJA 3D8VA 3R3IA 4LW3A 2VS5A 4KNXA 3SXDA 3N9WA 5CMGX 1HJJA 4CJ8A 1H5RB 1VGTA 1FG5N 1YROB 4CVHA 1VICA 5FU8A 3I0HA 2C0NA 4K6RA 3CKVA 5CMFX 4Y7TA 1FR9A 2OI7A 4M4KA 4FRBA 2AE7A 4FCEA 4DECA 1ON6A 4ASJA 4Y7UA 3BCVA 2OI6A 1R7VA 1VH3A 1WSZA 1ZDFA 1E5KA 3E26A 2YESA 5JQQA 1R81A 2J0BA 2QH5A 5BXCA 1R7UA 2A8WA 4NAKA 5CQPA 2Z87A 2FYAA 3V0LA 1LL3A 1W57A 2O1FA 1JV3A 2YCMA 1V82A 4FRQA 2V0HA 3I0CA 4KPZA 2P73A 1O23B 2WEEA 3SXEA 1R7XA 5C4DA 4KRVA 2VK9A 2I5KA 5C3DA 2YQHA 1PZTA 4FRHA 1GX4A 2D0JA 1W77A 4Y7VA 1FRWA 3TQDA 2AM4A 4Y9XA 2VS4A 1IIMA 1H7QA 2Y4MA 3D98A 1G97A 3F1CA 5D92A 3U2VA 3U0YA 4EE4A 1JV1A 3D5NA 2AM3A 4C2SA 1H5RA 5C49A 1GWVA 1GWWA 1ZCTA 4YS8A 2V0KA 2OEGA 1G3LA 2ZU9A 4HG6A 4FRPA 2YQCA 1EZIA 2FYDB 4M2AA 1FO9A 1ZCUA 1LL2A 2JCJA 1R80A 4Y6UA 2E3DA 1FR8A 1OMZA 1ZDGA 5AJPA 5IFYA 3T7OA 1O0RA 2X60A 2J0AA 2OEFA 5CMIA 3U2UA 4ARWA 3HL3A 2DPWA 5CMJA 5CQOA 3JUKA 4FRDA 1MP3A 4Q7CA 4KC1A 4G3SA 3FWWA 2RIXA 1G9RA 1H5SC 1HM8A 5C36A 1VM8A 3I0LA 3V8ZA 3SX3A 3OC9A 3DJ4A 4EEGA 2D7IA 2YC3A 1MP5A 2PGVA 5C3AA 3CGXA 2Y7AA 2WVLA 1VPAA 2BO6A 4NAIA 2RJ6A 1TZFA 3USQA 4B4GA 1NQIB 5EIYA 2Y4JA 1LZJA 1R82A 4P02A 1TW5A 2RITA 4HCQA 3SXGA 4EVWA 1G2VA 1INIA 4EEAA 5L6SA 2BO7A 1R7TA 1IINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XWI A;  3DK5 A;  1V83 A;  5CQM X;  2XMH A;  3R2W A;  3GUE A;  4G3Q A;  4R7P A;  4FRA A;  2UX8 A;  2Z86 A;  2A8U A;  4HO2 A;  1G95 A;  4EE5 A;  1G1L A;  3SX7 A;  1FWY A;  2PX7 A;  4KPX A;  4UEG A;  3EE5 A;  1LVW A;  4Y7G A;  1S4P A;  1LZI A;  2ICY A;  4ECM A;  1ZJO A;  4Y7F A;  2VD4 A;  4KC4 A;  2JCO A;  2VXM A;  3QVB A;  3PNN A;  1QGS A;  1ZI3 A;  3JUJ A;  3KIA A;  1XZ6 A;  4FRE A;  1JYK A;  2VSI A;  1ZJP A;  3CKJ A;  4IRQ A;  2O1H A;  4D0T A;  1EYR A;  3V0O A;  2VS3 A;  1NWG B;  1VZU A;  1H7L A;  3I0D A;  3PKQ A;  3TZT A;  1ZJ2 A;  2ICX A;  1OMX A;  2JCL A;  4FQW A;  1G23 A;  3OGZ A;  1QG8 A;  2VSH A;  2MZB A;  1JVG A;  1Z90 A;  2RJ7 A;  1H7F A;  5FTS A;  2XWL A;  4GBP A;  2PA4 A;  2XME A;  2V0J A;  2YC5 A;  4Y62 A;  4CJB A;  4AYJ A;  3U2X A;  2X65 A;  2AH9 A;  3U2W A;  3SX5 A;  1XHB A;  3SXC A;  1WT2 A;  4D11 A;  2FYB A;  4Y63 A;  5FTV A;  2FFU A;  4G87 A;  1G8O A;  4HO0 A;  2I5E A;  3CU0 A;  3CKQ A;  1H5S D;  1VZT A;  4IRP A;  4JD0 A;  2RIZ A;  3RMV A;  3DUV A;  1HM0 A;  4AAW A;  1WT3 A;  5I1F A;  3Q80 A;  2RJ5 A;  4HO6 A;  3ST8 A;  4L41 C;  2W0V A;  5FUH A;  1FGX A;  2YQJ A;  2AES A;  2VFZ A;  4Y64 A;  2I7B A;  2Y6P A;  5J49 A;  4B4B A;  2WE9 A;  4DE7 A;  2RJ8 A;  1OQM B;  1JVD A;  4NAL A;  5HS2 A;  2BO8 A;  1GA8 A;  2Y4K A;  3USR A;  3NGW A;  4B3U A;  2V0I A;  3BRK X;  4EE3 A;  1HJL A;  1K4V A;  1VGW A;  1O7O A;  4Y6N A;  1MP4 A;  1NHE B;  5C38 A;  4FRL A;  4JIS A;  4KXO A;  4B2W A;  5C47 A;  1H7G A;  3I0K A;  4HO3 A;  2RJ4 A;  1GQ9 A;  5C1H A;  2RJ9 A;  3IOI A;  2OI5 A;  2ZU7 A;  3IOH A;  3U2T A;  1FZW A;  1S4O A;  4E1K A;  1PZY B;  4AYL A;  1O7Q A;  1V84 A;  5C3B A;  4ASY A;  5DDV A;  3V90 A;  4D48 A;  4EEO A;  5C1L A;  5IDS A;  1FO8 A;  2AM5 A;  2X5Z A;  4MYB A;  5C48 A;  3RMW A;  1YP2 A;  3ZF8 A;  1H5T B;  1VZX A;  2GGQ A;  2QKX A;  2WGZ A;  5EJZ A;  3ZLK A;  3OH2 A;  2VXL A;  3T7M A;  1TVY A;  1H7E A;  5C4F A;  1R7Y A;  1INJ A;  4J18 A;  4KT7 A;  5C1G A;  1LL0 A;  3I0E A;  2FYC B;  1H5S B;  3Q4S A;  4B2X A;  1WT0 A;  3IOJ A;  3V0N A;  4KC2 A;  1HV9 A;  5C4C A;  2APC A;  4KNR A;  1G93 A;  1LZ7 A;  3LW6 A;  2NXV A;  3OH0 A;  1ZJ0 A;  4CJC A;  2D7R A;  1I52 A;  5FU0 A;  4FRO A;  4B42 A;  1LZ0 A;  4P00 A;  4MND A;  3I0G A;  1FXO A;  2W0W A;  4LW6 A;  5AJO A;  3O3P A;  2JCK A;  2FY7 A;  2QGI A;  1ZCV A;  4BQH A;  1ZI1 A;  4D0Z A;  3OH4 A;  1ZI4 A;  3ZGG A;  3ZGF A;  1VH1 A;  1H4E A;  2PGY A;  2GGO A;  2RJ0 A;  5CQL X;  3V0P A;  2X5S A;  3ZLL A;  3T7N A;  1ZJ1 A;  3K8E A;  2V0L A;  2WVK A;  1ZJ3 A;  3K8D A;  1TW1 A;  3V0Q A;  1VGU A;  4M28 A;  1ON8 A;  3F1Y A;  3CKN A;  2RIY A;  5EJ1 A;  1JYL A;  1ZHJ A;  5DDT A;  3RSB A;  5C4B A;  2P72 A;  3SXA A;  2BO4 A;  2WVM A;  3SX8 A;  1H5T A;  3V0M A;  4AC3 A;  4KQL A;  2P6W A;  4DDZ A;  2YQS A;  3JTJ A;  3PKP A;  2FFV A;  4HO4 A;  1H5S A;  3I0J A;  3FOQ A;  3OKR A;  1WVC A;  5CMH A;  5IDT A;  4EEM A;  1NF5 B;  2AGD A;  1NKH B;  1H4D A;  1ZIZ A;  4G3P A;  1HM9 A;  2RJ1 A;  1S4N A;  1H7H A;  3V91 A;  5FV9 A;  3SPT A;  3OH1 A;  3V8Y A;  4D11 C;  1FXJ A;  1QGQ A;  1GQC A;  1YP3 A;  1ZI5 A;  4B5B A;  5CQN X;  3I0I X;  4FRM A;  4NAN A;  2Y4L A;  2Q4J A;  4M2B A;  2XWN A;  4BMA A;  1SS9 A;  4HO9 A;  1FGG A;  1H4C A;  3CKO A;  1W55 A;  1NMM B;  3OAM A;  4HO8 A;  3Q7U A;  5FYE A;  1KWS A;  5C4E A;  1ZCY A;  2O1G A;  5AJN A;  2CU2 A;  4ZDQ A;  5C8R A;  5L6V A;  3POL A;  1FOA A;  4HOC A;  1H7T A;  4FCU A;  2ZU8 A;  3E25 A;  3SXB A;  4B4M A;  3OH3 A;  1YP4 A;  1H3M A;  1VGZ A;  1WT1 A;  3I0F A;  1GX0 A;  3U0X A;  1MC3 A;  2E8B A;  2AEC A;  4HO5 A;  2WAW A;  2XWM A;  1G0R A;  1QWJ A;  3D8V A;  3R3I A;  4LW3 A;  2VS5 A;  4KNX A;  3SXD A;  3N9W A;  5CMG X;  1HJJ A;  4CJ8 A;  1H5R B;  1VGT A;  1FG5 N;  1YRO B;  4CVH A;  1VIC A;  5FU8 A;  3I0H A;  4K6R A;  3CKV A;  5CMF X;  4Y7T A;  1FR9 A;  2OI7 A;  4M4K A;  4FRB A;  2AE7 A;  4FCE A;  4DEC A;  1ON6 A;  4ASJ A;  4Y7U A;  3BCV A;  2OI6 A;  1R7V A;  1VH3 A;  1WSZ A;  1ZDF A;  1E5K A;  3E26 A;  2YES A;  5JQQ A;  1R81 A;  2QH5 A;  5BXC A;  1R7U A;  2A8W A;  4NAK A;  5CQP A;  2Z87 A;  2FYA A;  3V0L A;  1LL3 A;  1W57 A;  2O1F A;  1JV3 A;  2YCM A;  1V82 A;  4FRQ A;  2V0H A;  3I0C A;  4KPZ A;  2P73 A;  1O23 B;  2WEE A;  3SXE A;  1R7X A;  5C4D A;  4KRV A;  2I5K A;  5C3D A;  2YQH A;  1PZT A;  4FRH A;  1GX4 A;  2D0J A;  1W77 A;  4Y7V A;  1FRW A;  3TQD A;  2AM4 A;  4Y9X A;  2VS4 A;  1IIM A;  1H7Q A;  2Y4M A;  3D98 A;  1G97 A;  3F1C A;  3U2V A;  3U0Y A;  4EE4 A;  1JV1 A;  3D5N A;  2AM3 A;  4C2S A;  1H5R A;  5C49 A;  1GWV A;  1GWW A;  1ZCT A;  4YS8 A;  2V0K A;  2OEG A;  1G3L A;  2ZU9 A;  4HG6 A;  4FRP A;  2YQC A;  1EZI A;  2FYD B;  4M2A A;  1FO9 A;  1ZCU A;  1LL2 A;  2JCJ A;  1R80 A;  4Y6U A;  2E3D A;  1FR8 A;  1OMZ A;  1ZDG A;  5AJP A;  5IFY A;  3T7O A;  1O0R A;  2X60 A;  2OEF A;  5CMI A;  3U2U A;  4ARW A;  3HL3 A;  2DPW A;  5CMJ A;  5CQO A;  3JUK A;  4FRD A;  1MP3 A;  4KC1 A;  4G3S A;  3FWW A;  2RIX A;  1G9R A;  1H5S C;  1HM8 A;  5C36 A;  1VM8 A;  3I0L A;  3V8Z A;  3SX3 A;  3OC9 A;  3DJ4 A;  4EEG A;  2D7I A;  2YC3 A;  1MP5 A;  2PGV A;  5C3A A;  3CGX A;  2Y7A A;  2WVL A;  1VPA A;  2BO6 A;  4NAI A;  2RJ6 A;  1TZF A;  3USQ A;  4B4G A;  1NQI B;  5EIY A;  2Y4J A;  1LZJ A;  1R82 A;  4P02 A;  1TW5 A;  2RIT A;  4HCQ A;  3SXG A;  4EVW A;  1G2V A;  1INI A;  4EEA A;  5L6S A;  2BO7 A;  1R7T A;  1IIN A; 
#chains in the Genus database with same CATH topology
 4XWI A;  3DK5 A;  1V83 A;  5CQM X;  2XMH A;  3R2W A;  3GUE A;  4G3Q A;  4R7P A;  4FRA A;  2UX8 A;  2Z86 A;  2A8U A;  4HO2 A;  1G95 A;  4EE5 A;  1G1L A;  3SX7 A;  1FWY A;  2PX7 A;  4KPX A;  4UEG A;  3EE5 A;  1LVW A;  4Y7G A;  1S4P A;  1LZI A;  2ICY A;  4ECM A;  1ZJO A;  4Y7F A;  2VD4 A;  4KC4 A;  2JCO A;  2VXM A;  3QVB A;  4FIY A;  3PNN A;  1QGS A;  1ZI3 A;  3JUJ A;  3KIA A;  1XZ6 A;  4FRE A;  1JYK A;  2VSI A;  1ZJP A;  3CKJ A;  4IRQ A;  2O1H A;  4D0T A;  1EYR A;  3V0O A;  2VS3 A;  1NWG B;  1VZU A;  1H7L A;  3I0D A;  3PKQ A;  3TZT A;  1ZJ2 A;  2ICX A;  1OMX A;  2JCL A;  4FQW A;  1G23 A;  3OGZ A;  1QG8 A;  2VSH A;  2MZB A;  1JVG A;  1Z90 A;  2RJ7 A;  1H7F A;  5FTS A;  2XWL A;  4GBP A;  2PA4 A;  2XME A;  2V0J A;  2YC5 A;  4Y62 A;  4CJB A;  4AYJ A;  3U2X A;  2X65 A;  2AH9 A;  3U2W A;  3SX5 A;  1XHB A;  3SXC A;  1WT2 A;  4D11 A;  2FYB A;  4Y63 A;  5FTV A;  2FFU A;  4G87 A;  1G8O A;  4HO0 A;  2I5E A;  3CU0 A;  3CKQ A;  1H5S D;  1VZT A;  4IRP A;  4JD0 A;  2RIZ A;  3RMV A;  3DUV A;  1HM0 A;  4AAW A;  1WT3 A;  5I1F A;  3Q80 A;  2RJ5 A;  4HO6 A;  3ST8 A;  4L41 C;  2W0V A;  5FUH A;  1FGX A;  2YQJ A;  2AES A;  2VFZ A;  4Y64 A;  2I7B A;  2Y6P A;  5J49 A;  4B4B A;  2WE9 A;  4DE7 A;  2RJ8 A;  1OQM B;  1JVD A;  4NAL A;  5HS2 A;  2BO8 A;  1GA8 A;  2Y4K A;  3USR A;  3NGW A;  4B3U A;  2V0I A;  3BRK X;  4EE3 A;  1HJL A;  1K4V A;  1VGW A;  1O7O A;  4Y6N A;  1MP4 A;  1NHE B;  5C38 A;  4FRL A;  4JIS A;  4KXO A;  4B2W A;  5C47 A;  1H7G A;  4MIX A;  3I0K A;  4HO3 A;  2RJ4 A;  1GQ9 A;  5C1H A;  2RJ9 A;  3IOI A;  2OI5 A;  2ZU7 A;  3IOH A;  3U2T A;  1FZW A;  1S4O A;  4E1K A;  1PZY B;  4AYL A;  1O7Q A;  1V84 A;  5C3B A;  4ASY A;  5DDV A;  3V90 A;  4D48 A;  4EEO A;  5C1L A;  5IDS A;  1FO8 A;  2AM5 A;  2X5Z A;  4MYB A;  5C48 A;  3RMW A;  1YP2 A;  3ZF8 A;  1H5T B;  1VZX A;  2GGQ A;  2QKX A;  2WGZ A;  5EJZ A;  3ZLK A;  3OH2 A;  2VXL A;  3T7M A;  1TVY A;  1H7E A;  5C4F A;  1R7Y A;  1INJ A;  4J18 A;  4KT7 A;  5C1G A;  1LL0 A;  3I0E A;  2FYC B;  1H5S B;  3Q4S A;  4B2X A;  1WT0 A;  3IOJ A;  3V0N A;  4KC2 A;  1HV9 A;  5C4C A;  2APC A;  4KNR A;  1G93 A;  1LZ7 A;  3LW6 A;  2NXV A;  3OH0 A;  1ZJ0 A;  4CJC A;  2D7R A;  1I52 A;  5FU0 A;  4FRO A;  4B42 A;  1LZ0 A;  4P00 A;  4MND A;  3I0G A;  1FXO A;  2W0W A;  4LW6 A;  5AJO A;  3O3P A;  2JCK A;  2FY7 A;  2QGI A;  1ZCV A;  4BQH A;  1ZI1 A;  4D0Z A;  3OH4 A;  1ZI4 A;  3ZGG A;  3ZGF A;  1VH1 A;  1H4E A;  2PGY A;  2GGO A;  2RJ0 A;  5CQL X;  3V0P A;  2X5S A;  3ZLL A;  4O6N A;  3T7N A;  1ZJ1 A;  3K8E A;  2V0L A;  2WVK A;  1ZJ3 A;  3K8D A;  1TW1 A;  3V0Q A;  1VGU A;  4M28 A;  1ON8 A;  3F1Y A;  3CKN A;  2RIY A;  5EJ1 A;  1JYL A;  1ZHJ A;  5DDT A;  3RSB A;  5C4B A;  2P72 A;  3SXA A;  2BO4 A;  2WVM A;  3SX8 A;  1H5T A;  3V0M A;  4AC3 A;  4KQL A;  2P6W A;  4DDZ A;  2YQS A;  3JTJ A;  3PKP A;  2FFV A;  4HO4 A;  1H5S A;  3I0J A;  3FOQ A;  3OKR A;  1WVC A;  5CMH A;  5IDT A;  4EEM A;  1NF5 B;  2AGD A;  1NKH B;  1H4D A;  1ZIZ A;  4G3P A;  1HM9 A;  2RJ1 A;  1S4N A;  1H7H A;  3V91 A;  5FV9 A;  3SPT A;  3OH1 A;  3V8Y A;  4D11 C;  1FXJ A;  1QGQ A;  1GQC A;  1YP3 A;  1ZI5 A;  4FIX A;  4B5B A;  5CQN X;  3I0I X;  4FRM A;  4NAN A;  2Y4L A;  2Q4J A;  4O6M A;  4M2B A;  2XWN A;  4BMA A;  1SS9 A;  4HO9 A;  1FGG A;  1H4C A;  3CKO A;  1W55 A;  1NMM B;  3OAM A;  4HO8 A;  3Q7U A;  5FYE A;  1KWS A;  5C4E A;  1ZCY A;  2O1G A;  5AJN A;  2CU2 A;  4ZDQ A;  5C8R A;  5L6V A;  3POL A;  1FOA A;  4HOC A;  1H7T A;  4FCU A;  2ZU8 A;  3E25 A;  3SXB A;  4B4M A;  3OH3 A;  5D91 A;  1YP4 A;  1H3M A;  1VGZ A;  1WT1 A;  3I0F A;  1GX0 A;  3U0X A;  1MC3 A;  2E8B A;  2AEC A;  4HO5 A;  2WAW A;  2XWM A;  1G0R A;  1QWJ A;  3D8V A;  3R3I A;  4LW3 A;  2VS5 A;  4KNX A;  3SXD A;  3N9W A;  5CMG X;  1HJJ A;  4CJ8 A;  1H5R B;  1VGT A;  1FG5 N;  1YRO B;  4CVH A;  1VIC A;  5FU8 A;  3I0H A;  2C0N A;  4K6R A;  3CKV A;  5CMF X;  4Y7T A;  1FR9 A;  2OI7 A;  4M4K A;  4FRB A;  2AE7 A;  4FCE A;  4DEC A;  1ON6 A;  4ASJ A;  4Y7U A;  3BCV A;  2OI6 A;  1R7V A;  1VH3 A;  1WSZ A;  1ZDF A;  1E5K A;  3E26 A;  2YES A;  5JQQ A;  1R81 A;  2J0B A;  2QH5 A;  5BXC A;  1R7U A;  2A8W A;  4NAK A;  5CQP A;  2Z87 A;  2FYA A;  3V0L A;  1LL3 A;  1W57 A;  2O1F A;  1JV3 A;  2YCM A;  1V82 A;  4FRQ A;  2V0H A;  3I0C A;  4KPZ A;  2P73 A;  1O23 B;  2WEE A;  3SXE A;  1R7X A;  5C4D A;  4KRV A;  2VK9 A;  2I5K A;  5C3D A;  2YQH A;  1PZT A;  4FRH A;  1GX4 A;  2D0J A;  1W77 A;  4Y7V A;  1FRW A;  3TQD A;  2AM4 A;  4Y9X A;  2VS4 A;  1IIM A;  1H7Q A;  2Y4M A;  3D98 A;  1G97 A;  3F1C A;  5D92 A;  3U2V A;  3U0Y A;  4EE4 A;  1JV1 A;  3D5N A;  2AM3 A;  4C2S A;  1H5R A;  5C49 A;  1GWV A;  1GWW A;  1ZCT A;  4YS8 A;  2V0K A;  2OEG A;  1G3L A;  2ZU9 A;  4HG6 A;  4FRP A;  2YQC A;  1EZI A;  2FYD B;  4M2A A;  1FO9 A;  1ZCU A;  1LL2 A;  2JCJ A;  1R80 A;  4Y6U A;  2E3D A;  1FR8 A;  1OMZ A;  1ZDG A;  5AJP A;  5IFY A;  3T7O A;  1O0R A;  2X60 A;  2J0A A;  2OEF A;  5CMI A;  3U2U A;  4ARW A;  3HL3 A;  2DPW A;  5CMJ A;  5CQO A;  3JUK A;  4FRD A;  1MP3 A;  4Q7C A;  4KC1 A;  4G3S A;  3FWW A;  2RIX A;  1G9R A;  1H5S C;  1HM8 A;  5C36 A;  1VM8 A;  3I0L A;  3V8Z A;  3SX3 A;  3OC9 A;  3DJ4 A;  4EEG A;  2D7I A;  2YC3 A;  1MP5 A;  2PGV A;  5C3A A;  3CGX A;  2Y7A A;  2WVL A;  1VPA A;  2BO6 A;  4NAI A;  2RJ6 A;  1TZF A;  3USQ A;  4B4G A;  1NQI B;  5EIY A;  2Y4J A;  1LZJ A;  1R82 A;  4P02 A;  1TW5 A;  2RIT A;  4HCQ A;  3SXG A;  4EVW A;  1G2V A;  1INI A;  4EEA A;  5L6S A;  2BO7 A;  1R7T A;  1IIN A; 
#chains in the Genus database with same CATH homology
 4XWI A;  3DK5 A;  1V83 A;  5CQM X;  2XMH A;  3R2W A;  3GUE A;  4G3Q A;  4R7P A;  4FRA A;  2UX8 A;  2Z86 A;  2A8U A;  4HO2 A;  1G95 A;  4EE5 A;  1G1L A;  3SX7 A;  1FWY A;  2PX7 A;  4KPX A;  4UEG A;  3EE5 A;  1LVW A;  4Y7G A;  1S4P A;  1LZI A;  2ICY A;  4ECM A;  1ZJO A;  4Y7F A;  2VD4 A;  4KC4 A;  2JCO A;  2VXM A;  3QVB A;  4FIY A;  3PNN A;  1QGS A;  1ZI3 A;  3JUJ A;  3KIA A;  1XZ6 A;  4FRE A;  1JYK A;  2VSI A;  1ZJP A;  3CKJ A;  4IRQ A;  2O1H A;  4D0T A;  1EYR A;  3V0O A;  2VS3 A;  1NWG B;  1VZU A;  1H7L A;  3I0D A;  3PKQ A;  3TZT A;  1ZJ2 A;  2ICX A;  1OMX A;  2JCL A;  4FQW A;  1G23 A;  3OGZ A;  1QG8 A;  2VSH A;  2MZB A;  1JVG A;  1Z90 A;  2RJ7 A;  1H7F A;  5FTS A;  2XWL A;  4GBP A;  2PA4 A;  2XME A;  2V0J A;  2YC5 A;  4Y62 A;  4CJB A;  4AYJ A;  3U2X A;  2X65 A;  2AH9 A;  3U2W A;  3SX5 A;  1XHB A;  3SXC A;  1WT2 A;  4D11 A;  2FYB A;  4Y63 A;  5FTV A;  2FFU A;  4G87 A;  1G8O A;  4HO0 A;  2I5E A;  3CU0 A;  3CKQ A;  1H5S D;  1VZT A;  4IRP A;  4JD0 A;  2RIZ A;  3RMV A;  3DUV A;  1HM0 A;  4AAW A;  1WT3 A;  5I1F A;  3Q80 A;  2RJ5 A;  4HO6 A;  3ST8 A;  4L41 C;  2W0V A;  5FUH A;  1FGX A;  2YQJ A;  2AES A;  2VFZ A;  4Y64 A;  2I7B A;  2Y6P A;  5J49 A;  4B4B A;  2WE9 A;  4DE7 A;  2RJ8 A;  1OQM B;  1JVD A;  4NAL A;  5HS2 A;  2BO8 A;  1GA8 A;  2Y4K A;  3USR A;  3NGW A;  4B3U A;  2V0I A;  3BRK X;  4EE3 A;  1HJL A;  1K4V A;  1VGW A;  1O7O A;  4Y6N A;  1MP4 A;  1NHE B;  5C38 A;  4FRL A;  4JIS A;  4KXO A;  4B2W A;  5C47 A;  1H7G A;  4MIX A;  3I0K A;  4HO3 A;  2RJ4 A;  1GQ9 A;  5C1H A;  2RJ9 A;  3IOI A;  2OI5 A;  2ZU7 A;  3IOH A;  3U2T A;  1FZW A;  1S4O A;  4E1K A;  1PZY B;  4AYL A;  1O7Q A;  1V84 A;  5C3B A;  4ASY A;  5DDV A;  3V90 A;  4D48 A;  4EEO A;  5C1L A;  5IDS A;  1FO8 A;  2AM5 A;  2X5Z A;  4MYB A;  5C48 A;  3RMW A;  1YP2 A;  3ZF8 A;  1H5T B;  1VZX A;  2GGQ A;  2QKX A;  2WGZ A;  5EJZ A;  3ZLK A;  3OH2 A;  2VXL A;  3T7M A;  1TVY A;  1H7E A;  5C4F A;  1R7Y A;  1INJ A;  4J18 A;  4KT7 A;  5C1G A;  1LL0 A;  3I0E A;  2FYC B;  1H5S B;  3Q4S A;  4B2X A;  1WT0 A;  3IOJ A;  3V0N A;  4KC2 A;  1HV9 A;  5C4C A;  2APC A;  4KNR A;  1G93 A;  1LZ7 A;  3LW6 A;  2NXV A;  3OH0 A;  1ZJ0 A;  4CJC A;  2D7R A;  1I52 A;  5FU0 A;  4FRO A;  4B42 A;  1LZ0 A;  4P00 A;  4MND A;  3I0G A;  1FXO A;  2W0W A;  4LW6 A;  5AJO A;  3O3P A;  2JCK A;  2FY7 A;  2QGI A;  1ZCV A;  4BQH A;  1ZI1 A;  4D0Z A;  3OH4 A;  1ZI4 A;  3ZGG A;  3ZGF A;  1VH1 A;  1H4E A;  2PGY A;  2GGO A;  2RJ0 A;  5CQL X;  3V0P A;  2X5S A;  3ZLL A;  4O6N A;  3T7N A;  1ZJ1 A;  3K8E A;  2V0L A;  2WVK A;  1ZJ3 A;  3K8D A;  1TW1 A;  3V0Q A;  1VGU A;  4M28 A;  1ON8 A;  3F1Y A;  3CKN A;  2RIY A;  5EJ1 A;  1JYL A;  1ZHJ A;  5DDT A;  3RSB A;  5C4B A;  2P72 A;  3SXA A;  2BO4 A;  2WVM A;  3SX8 A;  1H5T A;  3V0M A;  4AC3 A;  4KQL A;  2P6W A;  4DDZ A;  2YQS A;  3JTJ A;  3PKP A;  2FFV A;  4HO4 A;  1H5S A;  3I0J A;  3FOQ A;  3OKR A;  1WVC A;  5CMH A;  5IDT A;  4EEM A;  1NF5 B;  2AGD A;  1NKH B;  1H4D A;  1ZIZ A;  4G3P A;  1HM9 A;  2RJ1 A;  1S4N A;  1H7H A;  3V91 A;  5FV9 A;  3SPT A;  3OH1 A;  3V8Y A;  4D11 C;  1FXJ A;  1QGQ A;  1GQC A;  1YP3 A;  1ZI5 A;  4FIX A;  4B5B A;  5CQN X;  3I0I X;  4FRM A;  4NAN A;  2Y4L A;  2Q4J A;  4O6M A;  4M2B A;  2XWN A;  4BMA A;  1SS9 A;  4HO9 A;  1FGG A;  1H4C A;  3CKO A;  1W55 A;  1NMM B;  3OAM A;  4HO8 A;  3Q7U A;  5FYE A;  1KWS A;  5C4E A;  1ZCY A;  2O1G A;  5AJN A;  2CU2 A;  4ZDQ A;  5C8R A;  5L6V A;  3POL A;  1FOA A;  4HOC A;  1H7T A;  4FCU A;  2ZU8 A;  3E25 A;  3SXB A;  4B4M A;  3OH3 A;  5D91 A;  1YP4 A;  1H3M A;  1VGZ A;  1WT1 A;  3I0F A;  1GX0 A;  3U0X A;  1MC3 A;  2E8B A;  2AEC A;  4HO5 A;  2WAW A;  2XWM A;  1G0R A;  1QWJ A;  3D8V A;  3R3I A;  4LW3 A;  2VS5 A;  4KNX A;  3SXD A;  3N9W A;  5CMG X;  1HJJ A;  4CJ8 A;  1H5R B;  1VGT A;  1FG5 N;  1YRO B;  4CVH A;  1VIC A;  5FU8 A;  3I0H A;  2C0N A;  4K6R A;  3CKV A;  5CMF X;  4Y7T A;  1FR9 A;  2OI7 A;  4M4K A;  4FRB A;  2AE7 A;  4FCE A;  4DEC A;  1ON6 A;  4ASJ A;  4Y7U A;  3BCV A;  2OI6 A;  1R7V A;  1VH3 A;  1WSZ A;  1ZDF A;  1E5K A;  3E26 A;  2YES A;  5JQQ A;  1R81 A;  2J0B A;  2QH5 A;  5BXC A;  1R7U A;  2A8W A;  4NAK A;  5CQP A;  2Z87 A;  2FYA A;  3V0L A;  1LL3 A;  1W57 A;  2O1F A;  1JV3 A;  2YCM A;  1V82 A;  4FRQ A;  2V0H A;  3I0C A;  4KPZ A;  2P73 A;  1O23 B;  2WEE A;  3SXE A;  1R7X A;  5C4D A;  4KRV A;  2VK9 A;  2I5K A;  5C3D A;  2YQH A;  1PZT A;  4FRH A;  1GX4 A;  2D0J A;  1W77 A;  4Y7V A;  1FRW A;  3TQD A;  2AM4 A;  4Y9X A;  2VS4 A;  1IIM A;  1H7Q A;  2Y4M A;  3D98 A;  1G97 A;  3F1C A;  5D92 A;  3U2V A;  3U0Y A;  4EE4 A;  1JV1 A;  3D5N A;  2AM3 A;  4C2S A;  1H5R A;  5C49 A;  1GWV A;  1GWW A;  1ZCT A;  4YS8 A;  2V0K A;  2OEG A;  1G3L A;  2ZU9 A;  4HG6 A;  4FRP A;  2YQC A;  1EZI A;  2FYD B;  4M2A A;  1FO9 A;  1ZCU A;  1LL2 A;  2JCJ A;  1R80 A;  4Y6U A;  2E3D A;  1FR8 A;  1OMZ A;  1ZDG A;  5AJP A;  5IFY A;  3T7O A;  1O0R A;  2X60 A;  2J0A A;  2OEF A;  5CMI A;  3U2U A;  4ARW A;  3HL3 A;  2DPW A;  5CMJ A;  5CQO A;  3JUK A;  4FRD A;  1MP3 A;  4Q7C A;  4KC1 A;  4G3S A;  3FWW A;  2RIX A;  1G9R A;  1H5S C;  1HM8 A;  5C36 A;  1VM8 A;  3I0L A;  3V8Z A;  3SX3 A;  3OC9 A;  3DJ4 A;  4EEG A;  2D7I A;  2YC3 A;  1MP5 A;  2PGV A;  5C3A A;  3CGX A;  2Y7A A;  2WVL A;  1VPA A;  2BO6 A;  4NAI A;  2RJ6 A;  1TZF A;  3USQ A;  4B4G A;  1NQI B;  5EIY A;  2Y4J A;  1LZJ A;  1R82 A;  4P02 A;  1TW5 A;  2RIT A;  4HCQ A;  3SXG A;  4EVW A;  1G2V A;  1INI A;  4EEA A;  5L6S A;  2BO7 A;  1R7T A;  1IIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...