3V90A

Structure of t82m glycogenin mutant truncated at residue 270
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
266
structure length
260
Chain Sequence
MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTSRRLAVLTTPQVSDTMRKALEIVFDEVITVDILDSGDSAHLTLMKRPELGVMLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFEREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHVASEQGSFDGGDQGLLNTFFNSWATTDIRKHLPFIYNLSSISIYSYLPAFKAFGANAKVVHFLGQTKPWNYTYDTKTKSVRSMTHPQFLNVWWDIFTTSVVPLLQQFGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycogenin-1
publication title Structural and biochemical insight into glycogenin inactivation by the glycogenosis-causing T82M mutation.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transferase
total genus 85
structure length 260
sequence length 266
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2011-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3v90A00
1FRWA 1H5SD 3CU0A 5L6VA 2A8WA 1LL2A 5DDVA 4UEGA 3USRA 4B42A 1VGWA 5HS2A 1YP3A 2YC3A 4GBPA 1JYLA 3OKRA 1LZJA 5AJOA 3U2UA 5L6SA 1GA8A 1H5TA 3RMVA 3OH0A 1WVCA 5EJ1A 2RJ4A 3I0EA 4FRLA 5FTSA 2D0JA 5C8RA 1S4OA 4EEOA 1INJA 1O23B 3PNNA 1V84A 5BXCA 2WE9A 4HO4A 2VS4A 2ICXA 3LW6A 4DE7A 3FOQA 1QGQA 1Z90A 5C4EA 1VM8A 3V0QA 2FYCB 1VZXA 2WVKA 3SXGA 3V0LA 3D5NA 5I1FA 4BMAA 2YCMA 1I52A 2OI5A 5C1GA 3SX5A 4G3PA 3I0GA 4KQLA 2V0LA 2VXMA 4HO6A 4MYBA 5C4CA 1QWJA 4KNRA 3I0DA 1GX4A 2OEGA 2Y6PA 3U0YA 3PKQA 1TW1A 2Y4KA 2FFUA 4HO9A 3OH4A 2BO4A 2ZU8A 2AM3A 3I0CA 1EYRA 3I0IX 2RIYA 3I0FA 2VXLA 4B3UA 3V8ZA 5C4DA 2FY7A 2XMHA 4G3SA 3OC9A 5J49A 4B5BA 1VGZA 2APCA 2X60A 4C2SA 5CQOA 2FYAA 4D0TA 1H4CA 3Q80A 4ASYA 1WT0A 2OEFA 1YROB 2PGVA 4L41C 1R7UA 2W0VA 2VSIA 2O1HA 1VPAA 2X5ZA 4J18A 4FRQA 1GX0A 1IINA 3I0LA 3JUKA 2I7BA 3PKPA 3ZGFA 5CMGX 3D98A 2MZBA 2O1GA 4HO5A 2YQCA 2P72A 2XWMA 4G87A 3GUEA 2RJ8A 1VGTA 2UX8A 4ZDQA 5C49A 1H4DA 1NF5B 2WVMA 2CU2A 4Y7FA 5C3AA 1O0RA 3RMWA 1V82A 1ZJPA 3I0KA 4D11A 1H5RB 1MP5A 1ZJ2A 1E5KA 1FGGA 3ZGGA 1ZIZA 1VGUA 4K6RA 4D48A 3ZF8A 3OAMA 3CKJA 3CKNA 1GWVA 1G23A 1H7QA 1ZDFA 5CQMX 2JCOA 3V0MA 1XZ6A 3V0NA 1H7GA 4M2BA 4M28A 1H7LA 1K4VA 1V83A 4M2AA 3SXAA 3SXEA 3NGWA 3V91A 3ZLLA 3SXDA 1O7QA 1S4PA 1ZCTA 4CJBA 4G3QA 1MP3A 3T7MA 5C38A 1VZTA 1H5RA 4KXOA 4NANA 2I5KA 3V0OA 1H4EA 4Y6UA 4Y7VA 4Y7GA 2FYBA 1LZ0A 5C36A 1JV3A 5AJNA 1WT3A 4Y64A 4FRMA 4HO2A 1PZYB 2QKXA 1VZUA 2BO6A 2AE7A 5AJPA 2VSHA 3CKOA 3N9WA 5EIYA 3CKQA 4HO0A 1OMZA 2W0WA 4M4KA 2GGOA 2YESA 1NQIB 3D8VA 4KPZA 4D11C 1G0RA 1G9RA 1FWYA 4KPXA 4AC3A 1FGXA 2WGZA 3T7NA 1G93A 3SX3A 2VS3A 1WT1A 5CMHA 1SS9A 4B2XA 4IRQA 1R7TA 3POLA 2ZU9A 4FQWA 1FOAA 3K8DA 2RIXA 4LW3A 1FR8A 2E3DA 4CVHA 1LZ7A 4NALA 1H3MA 4B4GA 3V8YA 1O7OA 5DDTA 1OQMB 2QGIA 1ZCVA 1G1LA 3U2TA 1FO8A 1ZJ0A 3DUVA 3R3IA 4MNDA 1NKHB 5C1HA 2A8UA 1ZJOA 4FRPA 2VS5A 3SX7A 5FYEA 3SXBA 2Z86A 2P6WA 4P02A 1G2VA 5CMIA 1ZI1A 1S4NA 2NXVA 2OI7A 1WT2A 2Y4MA 1YP4A 4DDZA 3EE5A 1JYKA 5C3BA 4CJ8A 1VH3A 1FG5N 1R82A 4R7PA 1JVGA 2PGYA 3U2WA 1ON6A 1H5SB 2Y7AA 1R80A 2AM5A 5C4BA 3BCVA 3TQDA 1JV1A 4EEAA 3E25A 3USQA 3OH3A 2RJ7A 4EE4A 5CMJA 2VFZA 4AAWA 1GQ9A 3JUJA 4B4BA 5CQNX 1NHEB 1W77A 3Q4SA 4FREA 3F1CA 5C4FA 4EEMA 1MP4A 2GGQA 2RIZA 3T7OA 1LL0A 4Y7TA 2WEEA 1ZJ1A 2X5SA 1ZI3A 3OH2A 4HO3A 2ZU7A 4BQHA 4YS8A 1WSZA 4EEGA 2AGDA 4HOCA 1GQCA 2RJ6A 2RJ9A 1GWWA 1G8OA 4Y9XA 1ZI5A 1QG8A 2V0HA 4NAKA 1HJJA 1EZIA 1G97A 5FTVA 4JD0A 2Y4JA 2X65A 4FROA 4HO8A 3U2XA 1H7HA 3CGXA 5FUHA 4P00A 1TVYA 3DK5A 1VH1A 4FRAA 2WAWA 3K8EA 3JTJA 3FWWA 4FRBA 3U0XA 3SX8A 3V90A 1R7YA 2AECA 3I0JA 5C48A 2OI6A 4HG6A 1HM0A 4E1KA 2Z87A 3KIAA 3Q7UA 1NMMB 1YP2A 1R81A 5IDSA 4JISA 1IIMA 1XHBA 5FU8A 4FCEA 4KC1A 2JCKA 2PX7A 4IRPA 5FV9A 2V0KA 1H5SC 4Y63A 4AYJA 3IOJA 2XMEA 2VD4A 1LZIA 4FCUA 2BO7A 3OGZA 1MC3A 4CJCA 2XWNA 3BRKX 5C1LA 4ARWA 3ST8A 2YC5A 3V0PA 4EVWA 4KC2A 4KNXA 3SXCA 1VICA 4AYLA 1ZJ3A 1FO9A 5CMFX 1HV9A 3RSBA 2E8BA 4EE5A 1NWGB 4DECA 1TW5A 5FU0A 5IFYA 5C47A 1HM8A 1H7EA 1FXJA 1G95A 3R2WA 3QVBA 2O1FA 2RJ1A 2RITA 2YQSA 2Q4JA 4Y62A 1LVWA 1FXOA 1ZI4A 2DPWA 2V0IA 2WVLA 2RJ0A 3SPTA 5CQLX 1FZWA 2V0JA 2AM4A 2P73A 1LL3A 2QH5A 2FFVA 2JCJA 4ASJA 1W55A 1ZCYA 1QGSA 1R7XA 3TZTA 1KWSA 4Y7UA 3CKVA 1W57A 1H7TA 1PZTA 3IOIA 1ZCUA 5CQPA 3O3PA 4ECMA 3HL3A 5JQQA 4Y6NA 1HJLA 2YQHA 2YQJA 2JCLA 1H7FA 1INIA 3E26A 1H5SA 1ZDGA 1JVDA 4LW6A 3I0HA 4B2WA 1ON8A 4KC4A 4KT7A 2PA4A 4FRHA 2ICYA 2I5EA 2D7IA 3IOHA 1R7VA 4HCQA 4NAIA 2Y4LA 4KRVA 4D0ZA 4EE3A 2BO8A 2AESA 4FRDA 2D7RA 5C3DA 4B4MA 2RJ5A 1OMXA 1ZHJA 3DJ4A 1H5TB 4XWIA 1FR9A 5IDTA 2XWLA 2AH9A 3ZLKA 5EJZA 1G3LA 3U2VA 3F1YA 1TZFA 2FYDB 3OH1A 1HM9A
chains in the Genus database with same CATH superfamily
1FRWA 1H5SD 3CU0A 5L6VA 2A8WA 1LL2A 5DDVA 4UEGA 3USRA 4B42A 1VGWA 5HS2A 1YP3A 2YC3A 4GBPA 1JYLA 3OKRA 1LZJA 5AJOA 3U2UA 5L6SA 1GA8A 1H5TA 3RMVA 3OH0A 1WVCA 5EJ1A 2RJ4A 3I0EA 4FRLA 5FTSA 2D0JA 5C8RA 1S4OA 4EEOA 1INJA 1O23B 3PNNA 1V84A 5BXCA 2WE9A 4HO4A 2VS4A 2ICXA 3LW6A 4DE7A 3FOQA 1QGQA 1Z90A 5C4EA 1VM8A 3V0QA 2FYCB 1VZXA 2WVKA 3SXGA 3V0LA 3D5NA 5I1FA 4BMAA 2YCMA 1I52A 2OI5A 5C1GA 3SX5A 4G3PA 3I0GA 4KQLA 2V0LA 2VXMA 4HO6A 4MYBA 5C4CA 1QWJA 4KNRA 3I0DA 1GX4A 2OEGA 2Y6PA 3U0YA 3PKQA 1TW1A 2Y4KA 2FFUA 4HO9A 3OH4A 2BO4A 2ZU8A 2AM3A 3I0CA 1EYRA 3I0IX 2RIYA 3I0FA 2VXLA 4B3UA 3V8ZA 5C4DA 2FY7A 2XMHA 4G3SA 3OC9A 5J49A 4B5BA 1VGZA 2APCA 2X60A 4C2SA 5CQOA 2FYAA 4D0TA 1H4CA 3Q80A 4ASYA 1WT0A 2OEFA 1YROB 2PGVA 4L41C 1R7UA 2W0VA 2VSIA 2O1HA 1VPAA 2X5ZA 4J18A 4FRQA 1GX0A 1IINA 3I0LA 3JUKA 2I7BA 3PKPA 3ZGFA 5CMGX 3D98A 2MZBA 2O1GA 4HO5A 2YQCA 2P72A 2XWMA 4G87A 3GUEA 2RJ8A 1VGTA 5D92A 2UX8A 4ZDQA 5C49A 1H4DA 1NF5B 2WVMA 2CU2A 4Y7FA 5C3AA 1O0RA 3RMWA 1V82A 1ZJPA 3I0KA 4D11A 1H5RB 1MP5A 1ZJ2A 1E5KA 1FGGA 3ZGGA 1ZIZA 1VGUA 4K6RA 4D48A 3ZF8A 3OAMA 3CKJA 3CKNA 1GWVA 1G23A 1H7QA 1ZDFA 5CQMX 2JCOA 3V0MA 1XZ6A 4O6NA 3V0NA 1H7GA 4M2BA 4M28A 1H7LA 1K4VA 1V83A 4M2AA 3SXAA 3SXEA 4Q7CA 3NGWA 3V91A 3ZLLA 3SXDA 1O7QA 1S4PA 1ZCTA 4CJBA 4G3QA 1MP3A 3T7MA 5C38A 1VZTA 1H5RA 4KXOA 4NANA 2I5KA 3V0OA 1H4EA 4Y6UA 4Y7VA 4Y7GA 2FYBA 1LZ0A 5C36A 1JV3A 5AJNA 1WT3A 4Y64A 4FRMA 4HO2A 1PZYB 2QKXA 1VZUA 2BO6A 2AE7A 5AJPA 2VSHA 3CKOA 3N9WA 5EIYA 3CKQA 4HO0A 1OMZA 2W0WA 4M4KA 2GGOA 2YESA 1NQIB 3D8VA 4KPZA 4D11C 1G0RA 1G9RA 4FIXA 1FWYA 4KPXA 4AC3A 1FGXA 2WGZA 3T7NA 1G93A 3SX3A 2VS3A 1WT1A 5CMHA 1SS9A 4B2XA 4IRQA 1R7TA 3POLA 2ZU9A 4FQWA 1FOAA 3K8DA 2RIXA 4LW3A 1FR8A 2E3DA 4CVHA 1LZ7A 4NALA 1H3MA 4B4GA 3V8YA 1O7OA 5DDTA 1OQMB 2QGIA 1ZCVA 1G1LA 3U2TA 1FO8A 1ZJ0A 3DUVA 3R3IA 4MNDA 1NKHB 5C1HA 2A8UA 1ZJOA 4FRPA 2VS5A 3SX7A 5FYEA 3SXBA 2Z86A 2P6WA 4P02A 1G2VA 5CMIA 1ZI1A 1S4NA 2NXVA 2OI7A 1WT2A 2Y4MA 1YP4A 4DDZA 3EE5A 1JYKA 5C3BA 4CJ8A 1VH3A 1FG5N 1R82A 4R7PA 1JVGA 2PGYA 3U2WA 1ON6A 1H5SB 2Y7AA 1R80A 2AM5A 5C4BA 3BCVA 3TQDA 1JV1A 4EEAA 3E25A 3USQA 3OH3A 4FIYA 2RJ7A 4EE4A 4MIXA 5CMJA 2VFZA 4AAWA 1GQ9A 3JUJA 4B4BA 5CQNX 1NHEB 1W77A 3Q4SA 4FREA 3F1CA 5C4FA 4EEMA 1MP4A 2GGQA 2RIZA 3T7OA 1LL0A 4Y7TA 2WEEA 1ZJ1A 2X5SA 1ZI3A 3OH2A 4HO3A 2ZU7A 4BQHA 4YS8A 1WSZA 4EEGA 2AGDA 4HOCA 1GQCA 2RJ6A 2RJ9A 1GWWA 1G8OA 4Y9XA 1ZI5A 1QG8A 2J0BA 2V0HA 4NAKA 1HJJA 1EZIA 1G97A 5FTVA 4JD0A 2Y4JA 2X65A 4FROA 4HO8A 3U2XA 1H7HA 3CGXA 5FUHA 4P00A 1TVYA 3DK5A 1VH1A 4FRAA 2WAWA 3K8EA 3JTJA 3FWWA 4FRBA 3U0XA 3SX8A 3V90A 1R7YA 2AECA 3I0JA 5C48A 2OI6A 4HG6A 1HM0A 4E1KA 2Z87A 3KIAA 3Q7UA 1NMMB 1YP2A 1R81A 5IDSA 4JISA 1IIMA 1XHBA 5FU8A 4FCEA 4KC1A 2JCKA 5D91A 2PX7A 4IRPA 5FV9A 2V0KA 1H5SC 4Y63A 4AYJA 3IOJA 2XMEA 2VD4A 1LZIA 4FCUA 2BO7A 3OGZA 1MC3A 4CJCA 2XWNA 3BRKX 5C1LA 4ARWA 3ST8A 2YC5A 3V0PA 4EVWA 4KC2A 4KNXA 3SXCA 1VICA 4AYLA 1ZJ3A 1FO9A 5CMFX 1HV9A 3RSBA 2E8BA 4EE5A 1NWGB 4DECA 1TW5A 5FU0A 5IFYA 5C47A 1HM8A 1H7EA 1FXJA 1G95A 3R2WA 3QVBA 2O1FA 2RJ1A 2RITA 2YQSA 2Q4JA 4Y62A 1LVWA 2VK9A 1FXOA 1ZI4A 2DPWA 2V0IA 2WVLA 2RJ0A 3SPTA 4O6MA 5CQLX 1FZWA 2V0JA 2AM4A 2P73A 1LL3A 2QH5A 2FFVA 2JCJA 4ASJA 1W55A 1ZCYA 1QGSA 1R7XA 3TZTA 1KWSA 4Y7UA 3CKVA 1W57A 1H7TA 1PZTA 3IOIA 1ZCUA 5CQPA 3O3PA 4ECMA 3HL3A 5JQQA 4Y6NA 1HJLA 2YQHA 2YQJA 2J0AA 2JCLA 1H7FA 1INIA 3E26A 1H5SA 1ZDGA 1JVDA 4LW6A 3I0HA 4B2WA 1ON8A 4KC4A 4KT7A 2PA4A 2C0NA 4FRHA 2ICYA 2I5EA 2D7IA 3IOHA 1R7VA 4HCQA 4NAIA 2Y4LA 4KRVA 4D0ZA 4EE3A 2BO8A 2AESA 4FRDA 2D7RA 5C3DA 4B4MA 2RJ5A 1OMXA 1ZHJA 3DJ4A 1H5TB 4XWIA 1FR9A 5IDTA 2XWLA 2AH9A 3ZLKA 5EJZA 1G3LA 3U2VA 3F1YA 1TZFA 2FYDB 3OH1A 1HM9A
chains in the Genus database with same CATH topology
1FRWA 1H5SD 3CU0A 5L6VA 2A8WA 1LL2A 5DDVA 4UEGA 3USRA 4B42A 1VGWA 5HS2A 1YP3A 2YC3A 4GBPA 1JYLA 3OKRA 1LZJA 5AJOA 3U2UA 5L6SA 1GA8A 1H5TA 3RMVA 3OH0A 1WVCA 5EJ1A 2RJ4A 3I0EA 4FRLA 5FTSA 2D0JA 5C8RA 1S4OA 4EEOA 1INJA 1O23B 3PNNA 1V84A 5BXCA 2WE9A 4HO4A 2VS4A 2ICXA 3LW6A 4DE7A 3FOQA 1QGQA 1Z90A 5C4EA 1VM8A 3V0QA 2FYCB 1VZXA 2WVKA 3SXGA 3V0LA 3D5NA 5I1FA 4BMAA 2YCMA 1I52A 2OI5A 5C1GA 3SX5A 4G3PA 3I0GA 4KQLA 2V0LA 2VXMA 4HO6A 4MYBA 5C4CA 1QWJA 4KNRA 3I0DA 1GX4A 2OEGA 2Y6PA 3U0YA 3PKQA 1TW1A 2Y4KA 2FFUA 4HO9A 3OH4A 2BO4A 2ZU8A 2AM3A 3I0CA 1EYRA 3I0IX 2RIYA 3I0FA 2VXLA 4B3UA 3V8ZA 5C4DA 2FY7A 2XMHA 4G3SA 3OC9A 5J49A 4B5BA 1VGZA 2APCA 2X60A 4C2SA 5CQOA 2FYAA 4D0TA 1H4CA 3Q80A 4ASYA 1WT0A 2OEFA 1YROB 2PGVA 4L41C 1R7UA 2W0VA 2VSIA 2O1HA 1VPAA 2X5ZA 4J18A 4FRQA 1GX0A 1IINA 3I0LA 3JUKA 2I7BA 3PKPA 3ZGFA 5CMGX 3D98A 2MZBA 2O1GA 4HO5A 2YQCA 2P72A 2XWMA 4G87A 3GUEA 2RJ8A 1VGTA 5D92A 2UX8A 4ZDQA 5C49A 1H4DA 1NF5B 2WVMA 2CU2A 4Y7FA 5C3AA 1O0RA 3RMWA 1V82A 1ZJPA 3I0KA 4D11A 1H5RB 1MP5A 1ZJ2A 1E5KA 1FGGA 3ZGGA 1ZIZA 1VGUA 4K6RA 4D48A 3ZF8A 3OAMA 3CKJA 3CKNA 1GWVA 1G23A 1H7QA 1ZDFA 5CQMX 2JCOA 3V0MA 1XZ6A 4O6NA 3V0NA 1H7GA 4M2BA 4M28A 1H7LA 1K4VA 1V83A 4M2AA 3SXAA 3SXEA 4Q7CA 3NGWA 3V91A 3ZLLA 3SXDA 1O7QA 1S4PA 1ZCTA 4CJBA 4G3QA 1MP3A 3T7MA 5C38A 1VZTA 1H5RA 4KXOA 4NANA 2I5KA 3V0OA 1H4EA 4Y6UA 4Y7VA 4Y7GA 2FYBA 1LZ0A 5C36A 1JV3A 5AJNA 1WT3A 4Y64A 4FRMA 4HO2A 1PZYB 2QKXA 1VZUA 2BO6A 2AE7A 5AJPA 2VSHA 3CKOA 3N9WA 5EIYA 3CKQA 4HO0A 1OMZA 2W0WA 4M4KA 2GGOA 2YESA 1NQIB 3D8VA 4KPZA 4D11C 1G0RA 1G9RA 4FIXA 1FWYA 4KPXA 4AC3A 1FGXA 2WGZA 3T7NA 1G93A 3SX3A 2VS3A 1WT1A 5CMHA 1SS9A 4B2XA 4IRQA 1R7TA 3POLA 2ZU9A 4FQWA 1FOAA 3K8DA 2RIXA 4LW3A 1FR8A 2E3DA 4CVHA 1LZ7A 4NALA 1H3MA 4B4GA 3V8YA 1O7OA 5DDTA 1OQMB 2QGIA 1ZCVA 1G1LA 3U2TA 1FO8A 1ZJ0A 3DUVA 3R3IA 4MNDA 1NKHB 5C1HA 2A8UA 1ZJOA 4FRPA 2VS5A 3SX7A 5FYEA 3SXBA 2Z86A 2P6WA 4P02A 1G2VA 5CMIA 1ZI1A 1S4NA 2NXVA 2OI7A 1WT2A 2Y4MA 1YP4A 4DDZA 3EE5A 1JYKA 5C3BA 4CJ8A 1VH3A 1FG5N 1R82A 4R7PA 1JVGA 2PGYA 3U2WA 1ON6A 1H5SB 2Y7AA 1R80A 2AM5A 5C4BA 3BCVA 3TQDA 1JV1A 4EEAA 3E25A 3USQA 3OH3A 4FIYA 2RJ7A 4EE4A 4MIXA 5CMJA 2VFZA 4AAWA 1GQ9A 3JUJA 4B4BA 5CQNX 1NHEB 1W77A 3Q4SA 4FREA 3F1CA 5C4FA 4EEMA 1MP4A 2GGQA 2RIZA 3T7OA 1LL0A 4Y7TA 2WEEA 1ZJ1A 2X5SA 1ZI3A 3OH2A 4HO3A 2ZU7A 4BQHA 4YS8A 1WSZA 4EEGA 2AGDA 4HOCA 1GQCA 2RJ6A 2RJ9A 1GWWA 1G8OA 4Y9XA 1ZI5A 1QG8A 2J0BA 2V0HA 4NAKA 1HJJA 1EZIA 1G97A 5FTVA 4JD0A 2Y4JA 2X65A 4FROA 4HO8A 3U2XA 1H7HA 3CGXA 5FUHA 4P00A 1TVYA 3DK5A 1VH1A 4FRAA 2WAWA 3K8EA 3JTJA 3FWWA 4FRBA 3U0XA 3SX8A 3V90A 1R7YA 2AECA 3I0JA 5C48A 2OI6A 4HG6A 1HM0A 4E1KA 2Z87A 3KIAA 3Q7UA 1NMMB 1YP2A 1R81A 5IDSA 4JISA 1IIMA 1XHBA 5FU8A 4FCEA 4KC1A 2JCKA 5D91A 2PX7A 4IRPA 5FV9A 2V0KA 1H5SC 4Y63A 4AYJA 3IOJA 2XMEA 2VD4A 1LZIA 4FCUA 2BO7A 3OGZA 1MC3A 4CJCA 2XWNA 3BRKX 5C1LA 4ARWA 3ST8A 2YC5A 3V0PA 4EVWA 4KC2A 4KNXA 3SXCA 1VICA 4AYLA 1ZJ3A 1FO9A 5CMFX 1HV9A 3RSBA 2E8BA 4EE5A 1NWGB 4DECA 1TW5A 5FU0A 5IFYA 5C47A 1HM8A 1H7EA 1FXJA 1G95A 3R2WA 3QVBA 2O1FA 2RJ1A 2RITA 2YQSA 2Q4JA 4Y62A 1LVWA 2VK9A 1FXOA 1ZI4A 2DPWA 2V0IA 2WVLA 2RJ0A 3SPTA 4O6MA 5CQLX 1FZWA 2V0JA 2AM4A 2P73A 1LL3A 2QH5A 2FFVA 2JCJA 4ASJA 1W55A 1ZCYA 1QGSA 1R7XA 3TZTA 1KWSA 4Y7UA 3CKVA 1W57A 1H7TA 1PZTA 3IOIA 1ZCUA 5CQPA 3O3PA 4ECMA 3HL3A 5JQQA 4Y6NA 1HJLA 2YQHA 2YQJA 2J0AA 2JCLA 1H7FA 1INIA 3E26A 1H5SA 1ZDGA 1JVDA 4LW6A 3I0HA 4B2WA 1ON8A 4KC4A 4KT7A 2PA4A 2C0NA 4FRHA 2ICYA 2I5EA 2D7IA 3IOHA 1R7VA 4HCQA 4NAIA 2Y4LA 4KRVA 4D0ZA 4EE3A 2BO8A 2AESA 4FRDA 2D7RA 5C3DA 4B4MA 2RJ5A 1OMXA 1ZHJA 3DJ4A 1H5TB 4XWIA 1FR9A 5IDTA 2XWLA 2AH9A 3ZLKA 5EJZA 1G3LA 3U2VA 3F1YA 1TZFA 2FYDB 3OH1A 1HM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FRW A;  1H5S D;  3CU0 A;  5L6V A;  2A8W A;  1LL2 A;  5DDV A;  4UEG A;  3USR A;  4B42 A;  1VGW A;  5HS2 A;  1YP3 A;  2YC3 A;  4GBP A;  1JYL A;  3OKR A;  1LZJ A;  5AJO A;  3U2U A;  5L6S A;  1GA8 A;  1H5T A;  3RMV A;  3OH0 A;  1WVC A;  5EJ1 A;  2RJ4 A;  3I0E A;  4FRL A;  5FTS A;  2D0J A;  5C8R A;  1S4O A;  4EEO A;  1INJ A;  1O23 B;  3PNN A;  1V84 A;  5BXC A;  2WE9 A;  4HO4 A;  2VS4 A;  2ICX A;  3LW6 A;  4DE7 A;  3FOQ A;  1QGQ A;  1Z90 A;  5C4E A;  1VM8 A;  3V0Q A;  2FYC B;  1VZX A;  2WVK A;  3SXG A;  3V0L A;  3D5N A;  5I1F A;  4BMA A;  2YCM A;  1I52 A;  2OI5 A;  5C1G A;  3SX5 A;  4G3P A;  3I0G A;  4KQL A;  2V0L A;  2VXM A;  4HO6 A;  4MYB A;  5C4C A;  1QWJ A;  4KNR A;  3I0D A;  1GX4 A;  2OEG A;  2Y6P A;  3U0Y A;  3PKQ A;  1TW1 A;  2Y4K A;  2FFU A;  4HO9 A;  3OH4 A;  2BO4 A;  2ZU8 A;  2AM3 A;  3I0C A;  1EYR A;  3I0I X;  2RIY A;  3I0F A;  2VXL A;  4B3U A;  3V8Z A;  5C4D A;  2FY7 A;  2XMH A;  4G3S A;  3OC9 A;  5J49 A;  4B5B A;  1VGZ A;  2APC A;  2X60 A;  4C2S A;  5CQO A;  2FYA A;  4D0T A;  1H4C A;  3Q80 A;  4ASY A;  1WT0 A;  2OEF A;  1YRO B;  2PGV A;  4L41 C;  1R7U A;  2W0V A;  2VSI A;  2O1H A;  1VPA A;  2X5Z A;  4J18 A;  4FRQ A;  1GX0 A;  1IIN A;  3I0L A;  3JUK A;  2I7B A;  3PKP A;  3ZGF A;  5CMG X;  3D98 A;  2MZB A;  2O1G A;  4HO5 A;  2YQC A;  2P72 A;  2XWM A;  4G87 A;  3GUE A;  2RJ8 A;  1VGT A;  2UX8 A;  4ZDQ A;  5C49 A;  1H4D A;  1NF5 B;  2WVM A;  2CU2 A;  4Y7F A;  5C3A A;  1O0R A;  3RMW A;  1V82 A;  1ZJP A;  3I0K A;  4D11 A;  1H5R B;  1MP5 A;  1ZJ2 A;  1E5K A;  1FGG A;  3ZGG A;  1ZIZ A;  1VGU A;  4K6R A;  4D48 A;  3ZF8 A;  3OAM A;  3CKJ A;  3CKN A;  1GWV A;  1G23 A;  1H7Q A;  1ZDF A;  5CQM X;  2JCO A;  3V0M A;  1XZ6 A;  3V0N A;  1H7G A;  4M2B A;  4M28 A;  1H7L A;  1K4V A;  1V83 A;  4M2A A;  3SXA A;  3SXE A;  3NGW A;  3V91 A;  3ZLL A;  3SXD A;  1O7Q A;  1S4P A;  1ZCT A;  4CJB A;  4G3Q A;  1MP3 A;  3T7M A;  5C38 A;  1VZT A;  1H5R A;  4KXO A;  4NAN A;  2I5K A;  3V0O A;  1H4E A;  4Y6U A;  4Y7V A;  4Y7G A;  2FYB A;  1LZ0 A;  5C36 A;  1JV3 A;  5AJN A;  1WT3 A;  4Y64 A;  4FRM A;  4HO2 A;  1PZY B;  2QKX A;  1VZU A;  2BO6 A;  2AE7 A;  5AJP A;  2VSH A;  3CKO A;  3N9W A;  5EIY A;  3CKQ A;  4HO0 A;  1OMZ A;  2W0W A;  4M4K A;  2GGO A;  2YES A;  1NQI B;  3D8V A;  4KPZ A;  4D11 C;  1G0R A;  1G9R A;  1FWY A;  4KPX A;  4AC3 A;  1FGX A;  2WGZ A;  3T7N A;  1G93 A;  3SX3 A;  2VS3 A;  1WT1 A;  5CMH A;  1SS9 A;  4B2X A;  4IRQ A;  1R7T A;  3POL A;  2ZU9 A;  4FQW A;  1FOA A;  3K8D A;  2RIX A;  4LW3 A;  1FR8 A;  2E3D A;  4CVH A;  1LZ7 A;  4NAL A;  1H3M A;  4B4G A;  3V8Y A;  1O7O A;  5DDT A;  1OQM B;  2QGI A;  1ZCV A;  1G1L A;  3U2T A;  1FO8 A;  1ZJ0 A;  3DUV A;  3R3I A;  4MND A;  1NKH B;  5C1H A;  2A8U A;  1ZJO A;  4FRP A;  2VS5 A;  3SX7 A;  5FYE A;  3SXB A;  2Z86 A;  2P6W A;  4P02 A;  1G2V A;  5CMI A;  1ZI1 A;  1S4N A;  2NXV A;  2OI7 A;  1WT2 A;  2Y4M A;  1YP4 A;  4DDZ A;  3EE5 A;  1JYK A;  5C3B A;  4CJ8 A;  1VH3 A;  1FG5 N;  1R82 A;  4R7P A;  1JVG A;  2PGY A;  3U2W A;  1ON6 A;  1H5S B;  2Y7A A;  1R80 A;  2AM5 A;  5C4B A;  3BCV A;  3TQD A;  1JV1 A;  4EEA A;  3E25 A;  3USQ A;  3OH3 A;  2RJ7 A;  4EE4 A;  5CMJ A;  2VFZ A;  4AAW A;  1GQ9 A;  3JUJ A;  4B4B A;  5CQN X;  1NHE B;  1W77 A;  3Q4S A;  4FRE A;  3F1C A;  5C4F A;  4EEM A;  1MP4 A;  2GGQ A;  2RIZ A;  3T7O A;  1LL0 A;  4Y7T A;  2WEE A;  1ZJ1 A;  2X5S A;  1ZI3 A;  3OH2 A;  4HO3 A;  2ZU7 A;  4BQH A;  4YS8 A;  1WSZ A;  4EEG A;  2AGD A;  4HOC A;  1GQC A;  2RJ6 A;  2RJ9 A;  1GWW A;  1G8O A;  4Y9X A;  1ZI5 A;  1QG8 A;  2V0H A;  4NAK A;  1HJJ A;  1EZI A;  1G97 A;  5FTV A;  4JD0 A;  2Y4J A;  2X65 A;  4FRO A;  4HO8 A;  3U2X A;  1H7H A;  3CGX A;  5FUH A;  4P00 A;  1TVY A;  3DK5 A;  1VH1 A;  4FRA A;  2WAW A;  3K8E A;  3JTJ A;  3FWW A;  4FRB A;  3U0X A;  3SX8 A;  3V90 A;  1R7Y A;  2AEC A;  3I0J A;  5C48 A;  2OI6 A;  4HG6 A;  1HM0 A;  4E1K A;  2Z87 A;  3KIA A;  3Q7U A;  1NMM B;  1YP2 A;  1R81 A;  5IDS A;  4JIS A;  1IIM A;  1XHB A;  5FU8 A;  4FCE A;  4KC1 A;  2JCK A;  2PX7 A;  4IRP A;  5FV9 A;  2V0K A;  1H5S C;  4Y63 A;  4AYJ A;  3IOJ A;  2XME A;  2VD4 A;  1LZI A;  4FCU A;  2BO7 A;  3OGZ A;  1MC3 A;  4CJC A;  2XWN A;  3BRK X;  5C1L A;  4ARW A;  3ST8 A;  2YC5 A;  3V0P A;  4EVW A;  4KC2 A;  4KNX A;  3SXC A;  1VIC A;  4AYL A;  1ZJ3 A;  1FO9 A;  5CMF X;  1HV9 A;  3RSB A;  2E8B A;  4EE5 A;  1NWG B;  4DEC A;  1TW5 A;  5FU0 A;  5IFY A;  5C47 A;  1HM8 A;  1H7E A;  1FXJ A;  1G95 A;  3R2W A;  3QVB A;  2O1F A;  2RJ1 A;  2RIT A;  2YQS A;  2Q4J A;  4Y62 A;  1LVW A;  1FXO A;  1ZI4 A;  2DPW A;  2V0I A;  2WVL A;  2RJ0 A;  3SPT A;  5CQL X;  1FZW A;  2V0J A;  2AM4 A;  2P73 A;  1LL3 A;  2QH5 A;  2FFV A;  2JCJ A;  4ASJ A;  1W55 A;  1ZCY A;  1QGS A;  1R7X A;  3TZT A;  1KWS A;  4Y7U A;  3CKV A;  1W57 A;  1H7T A;  1PZT A;  3IOI A;  1ZCU A;  5CQP A;  3O3P A;  4ECM A;  3HL3 A;  5JQQ A;  4Y6N A;  1HJL A;  2YQH A;  2YQJ A;  2JCL A;  1H7F A;  1INI A;  3E26 A;  1H5S A;  1ZDG A;  1JVD A;  4LW6 A;  3I0H A;  4B2W A;  1ON8 A;  4KC4 A;  4KT7 A;  2PA4 A;  4FRH A;  2ICY A;  2I5E A;  2D7I A;  3IOH A;  1R7V A;  4HCQ A;  4NAI A;  2Y4L A;  4KRV A;  4D0Z A;  4EE3 A;  2BO8 A;  2AES A;  4FRD A;  2D7R A;  5C3D A;  4B4M A;  2RJ5 A;  1OMX A;  1ZHJ A;  3DJ4 A;  1H5T B;  4XWI A;  1FR9 A;  5IDT A;  2XWL A;  2AH9 A;  3ZLK A;  5EJZ A;  1G3L A;  3U2V A;  3F1Y A;  1TZF A;  2FYD B;  3OH1 A;  1HM9 A; 
#chains in the Genus database with same CATH topology
 1FRW A;  1H5S D;  3CU0 A;  5L6V A;  2A8W A;  1LL2 A;  5DDV A;  4UEG A;  3USR A;  4B42 A;  1VGW A;  5HS2 A;  1YP3 A;  2YC3 A;  4GBP A;  1JYL A;  3OKR A;  1LZJ A;  5AJO A;  3U2U A;  5L6S A;  1GA8 A;  1H5T A;  3RMV A;  3OH0 A;  1WVC A;  5EJ1 A;  2RJ4 A;  3I0E A;  4FRL A;  5FTS A;  2D0J A;  5C8R A;  1S4O A;  4EEO A;  1INJ A;  1O23 B;  3PNN A;  1V84 A;  5BXC A;  2WE9 A;  4HO4 A;  2VS4 A;  2ICX A;  3LW6 A;  4DE7 A;  3FOQ A;  1QGQ A;  1Z90 A;  5C4E A;  1VM8 A;  3V0Q A;  2FYC B;  1VZX A;  2WVK A;  3SXG A;  3V0L A;  3D5N A;  5I1F A;  4BMA A;  2YCM A;  1I52 A;  2OI5 A;  5C1G A;  3SX5 A;  4G3P A;  3I0G A;  4KQL A;  2V0L A;  2VXM A;  4HO6 A;  4MYB A;  5C4C A;  1QWJ A;  4KNR A;  3I0D A;  1GX4 A;  2OEG A;  2Y6P A;  3U0Y A;  3PKQ A;  1TW1 A;  2Y4K A;  2FFU A;  4HO9 A;  3OH4 A;  2BO4 A;  2ZU8 A;  2AM3 A;  3I0C A;  1EYR A;  3I0I X;  2RIY A;  3I0F A;  2VXL A;  4B3U A;  3V8Z A;  5C4D A;  2FY7 A;  2XMH A;  4G3S A;  3OC9 A;  5J49 A;  4B5B A;  1VGZ A;  2APC A;  2X60 A;  4C2S A;  5CQO A;  2FYA A;  4D0T A;  1H4C A;  3Q80 A;  4ASY A;  1WT0 A;  2OEF A;  1YRO B;  2PGV A;  4L41 C;  1R7U A;  2W0V A;  2VSI A;  2O1H A;  1VPA A;  2X5Z A;  4J18 A;  4FRQ A;  1GX0 A;  1IIN A;  3I0L A;  3JUK A;  2I7B A;  3PKP A;  3ZGF A;  5CMG X;  3D98 A;  2MZB A;  2O1G A;  4HO5 A;  2YQC A;  2P72 A;  2XWM A;  4G87 A;  3GUE A;  2RJ8 A;  1VGT A;  5D92 A;  2UX8 A;  4ZDQ A;  5C49 A;  1H4D A;  1NF5 B;  2WVM A;  2CU2 A;  4Y7F A;  5C3A A;  1O0R A;  3RMW A;  1V82 A;  1ZJP A;  3I0K A;  4D11 A;  1H5R B;  1MP5 A;  1ZJ2 A;  1E5K A;  1FGG A;  3ZGG A;  1ZIZ A;  1VGU A;  4K6R A;  4D48 A;  3ZF8 A;  3OAM A;  3CKJ A;  3CKN A;  1GWV A;  1G23 A;  1H7Q A;  1ZDF A;  5CQM X;  2JCO A;  3V0M A;  1XZ6 A;  4O6N A;  3V0N A;  1H7G A;  4M2B A;  4M28 A;  1H7L A;  1K4V A;  1V83 A;  4M2A A;  3SXA A;  3SXE A;  4Q7C A;  3NGW A;  3V91 A;  3ZLL A;  3SXD A;  1O7Q A;  1S4P A;  1ZCT A;  4CJB A;  4G3Q A;  1MP3 A;  3T7M A;  5C38 A;  1VZT A;  1H5R A;  4KXO A;  4NAN A;  2I5K A;  3V0O A;  1H4E A;  4Y6U A;  4Y7V A;  4Y7G A;  2FYB A;  1LZ0 A;  5C36 A;  1JV3 A;  5AJN A;  1WT3 A;  4Y64 A;  4FRM A;  4HO2 A;  1PZY B;  2QKX A;  1VZU A;  2BO6 A;  2AE7 A;  5AJP A;  2VSH A;  3CKO A;  3N9W A;  5EIY A;  3CKQ A;  4HO0 A;  1OMZ A;  2W0W A;  4M4K A;  2GGO A;  2YES A;  1NQI B;  3D8V A;  4KPZ A;  4D11 C;  1G0R A;  1G9R A;  4FIX A;  1FWY A;  4KPX A;  4AC3 A;  1FGX A;  2WGZ A;  3T7N A;  1G93 A;  3SX3 A;  2VS3 A;  1WT1 A;  5CMH A;  1SS9 A;  4B2X A;  4IRQ A;  1R7T A;  3POL A;  2ZU9 A;  4FQW A;  1FOA A;  3K8D A;  2RIX A;  4LW3 A;  1FR8 A;  2E3D A;  4CVH A;  1LZ7 A;  4NAL A;  1H3M A;  4B4G A;  3V8Y A;  1O7O A;  5DDT A;  1OQM B;  2QGI A;  1ZCV A;  1G1L A;  3U2T A;  1FO8 A;  1ZJ0 A;  3DUV A;  3R3I A;  4MND A;  1NKH B;  5C1H A;  2A8U A;  1ZJO A;  4FRP A;  2VS5 A;  3SX7 A;  5FYE A;  3SXB A;  2Z86 A;  2P6W A;  4P02 A;  1G2V A;  5CMI A;  1ZI1 A;  1S4N A;  2NXV A;  2OI7 A;  1WT2 A;  2Y4M A;  1YP4 A;  4DDZ A;  3EE5 A;  1JYK A;  5C3B A;  4CJ8 A;  1VH3 A;  1FG5 N;  1R82 A;  4R7P A;  1JVG A;  2PGY A;  3U2W A;  1ON6 A;  1H5S B;  2Y7A A;  1R80 A;  2AM5 A;  5C4B A;  3BCV A;  3TQD A;  1JV1 A;  4EEA A;  3E25 A;  3USQ A;  3OH3 A;  4FIY A;  2RJ7 A;  4EE4 A;  4MIX A;  5CMJ A;  2VFZ A;  4AAW A;  1GQ9 A;  3JUJ A;  4B4B A;  5CQN X;  1NHE B;  1W77 A;  3Q4S A;  4FRE A;  3F1C A;  5C4F A;  4EEM A;  1MP4 A;  2GGQ A;  2RIZ A;  3T7O A;  1LL0 A;  4Y7T A;  2WEE A;  1ZJ1 A;  2X5S A;  1ZI3 A;  3OH2 A;  4HO3 A;  2ZU7 A;  4BQH A;  4YS8 A;  1WSZ A;  4EEG A;  2AGD A;  4HOC A;  1GQC A;  2RJ6 A;  2RJ9 A;  1GWW A;  1G8O A;  4Y9X A;  1ZI5 A;  1QG8 A;  2J0B A;  2V0H A;  4NAK A;  1HJJ A;  1EZI A;  1G97 A;  5FTV A;  4JD0 A;  2Y4J A;  2X65 A;  4FRO A;  4HO8 A;  3U2X A;  1H7H A;  3CGX A;  5FUH A;  4P00 A;  1TVY A;  3DK5 A;  1VH1 A;  4FRA A;  2WAW A;  3K8E A;  3JTJ A;  3FWW A;  4FRB A;  3U0X A;  3SX8 A;  3V90 A;  1R7Y A;  2AEC A;  3I0J A;  5C48 A;  2OI6 A;  4HG6 A;  1HM0 A;  4E1K A;  2Z87 A;  3KIA A;  3Q7U A;  1NMM B;  1YP2 A;  1R81 A;  5IDS A;  4JIS A;  1IIM A;  1XHB A;  5FU8 A;  4FCE A;  4KC1 A;  2JCK A;  5D91 A;  2PX7 A;  4IRP A;  5FV9 A;  2V0K A;  1H5S C;  4Y63 A;  4AYJ A;  3IOJ A;  2XME A;  2VD4 A;  1LZI A;  4FCU A;  2BO7 A;  3OGZ A;  1MC3 A;  4CJC A;  2XWN A;  3BRK X;  5C1L A;  4ARW A;  3ST8 A;  2YC5 A;  3V0P A;  4EVW A;  4KC2 A;  4KNX A;  3SXC A;  1VIC A;  4AYL A;  1ZJ3 A;  1FO9 A;  5CMF X;  1HV9 A;  3RSB A;  2E8B A;  4EE5 A;  1NWG B;  4DEC A;  1TW5 A;  5FU0 A;  5IFY A;  5C47 A;  1HM8 A;  1H7E A;  1FXJ A;  1G95 A;  3R2W A;  3QVB A;  2O1F A;  2RJ1 A;  2RIT A;  2YQS A;  2Q4J A;  4Y62 A;  1LVW A;  2VK9 A;  1FXO A;  1ZI4 A;  2DPW A;  2V0I A;  2WVL A;  2RJ0 A;  3SPT A;  4O6M A;  5CQL X;  1FZW A;  2V0J A;  2AM4 A;  2P73 A;  1LL3 A;  2QH5 A;  2FFV A;  2JCJ A;  4ASJ A;  1W55 A;  1ZCY A;  1QGS A;  1R7X A;  3TZT A;  1KWS A;  4Y7U A;  3CKV A;  1W57 A;  1H7T A;  1PZT A;  3IOI A;  1ZCU A;  5CQP A;  3O3P A;  4ECM A;  3HL3 A;  5JQQ A;  4Y6N A;  1HJL A;  2YQH A;  2YQJ A;  2J0A A;  2JCL A;  1H7F A;  1INI A;  3E26 A;  1H5S A;  1ZDG A;  1JVD A;  4LW6 A;  3I0H A;  4B2W A;  1ON8 A;  4KC4 A;  4KT7 A;  2PA4 A;  2C0N A;  4FRH A;  2ICY A;  2I5E A;  2D7I A;  3IOH A;  1R7V A;  4HCQ A;  4NAI A;  2Y4L A;  4KRV A;  4D0Z A;  4EE3 A;  2BO8 A;  2AES A;  4FRD A;  2D7R A;  5C3D A;  4B4M A;  2RJ5 A;  1OMX A;  1ZHJ A;  3DJ4 A;  1H5T B;  4XWI A;  1FR9 A;  5IDT A;  2XWL A;  2AH9 A;  3ZLK A;  5EJZ A;  1G3L A;  3U2V A;  3F1Y A;  1TZF A;  2FYD B;  3OH1 A;  1HM9 A; 
#chains in the Genus database with same CATH homology
 1FRW A;  1H5S D;  3CU0 A;  5L6V A;  2A8W A;  1LL2 A;  5DDV A;  4UEG A;  3USR A;  4B42 A;  1VGW A;  5HS2 A;  1YP3 A;  2YC3 A;  4GBP A;  1JYL A;  3OKR A;  1LZJ A;  5AJO A;  3U2U A;  5L6S A;  1GA8 A;  1H5T A;  3RMV A;  3OH0 A;  1WVC A;  5EJ1 A;  2RJ4 A;  3I0E A;  4FRL A;  5FTS A;  2D0J A;  5C8R A;  1S4O A;  4EEO A;  1INJ A;  1O23 B;  3PNN A;  1V84 A;  5BXC A;  2WE9 A;  4HO4 A;  2VS4 A;  2ICX A;  3LW6 A;  4DE7 A;  3FOQ A;  1QGQ A;  1Z90 A;  5C4E A;  1VM8 A;  3V0Q A;  2FYC B;  1VZX A;  2WVK A;  3SXG A;  3V0L A;  3D5N A;  5I1F A;  4BMA A;  2YCM A;  1I52 A;  2OI5 A;  5C1G A;  3SX5 A;  4G3P A;  3I0G A;  4KQL A;  2V0L A;  2VXM A;  4HO6 A;  4MYB A;  5C4C A;  1QWJ A;  4KNR A;  3I0D A;  1GX4 A;  2OEG A;  2Y6P A;  3U0Y A;  3PKQ A;  1TW1 A;  2Y4K A;  2FFU A;  4HO9 A;  3OH4 A;  2BO4 A;  2ZU8 A;  2AM3 A;  3I0C A;  1EYR A;  3I0I X;  2RIY A;  3I0F A;  2VXL A;  4B3U A;  3V8Z A;  5C4D A;  2FY7 A;  2XMH A;  4G3S A;  3OC9 A;  5J49 A;  4B5B A;  1VGZ A;  2APC A;  2X60 A;  4C2S A;  5CQO A;  2FYA A;  4D0T A;  1H4C A;  3Q80 A;  4ASY A;  1WT0 A;  2OEF A;  1YRO B;  2PGV A;  4L41 C;  1R7U A;  2W0V A;  2VSI A;  2O1H A;  1VPA A;  2X5Z A;  4J18 A;  4FRQ A;  1GX0 A;  1IIN A;  3I0L A;  3JUK A;  2I7B A;  3PKP A;  3ZGF A;  5CMG X;  3D98 A;  2MZB A;  2O1G A;  4HO5 A;  2YQC A;  2P72 A;  2XWM A;  4G87 A;  3GUE A;  2RJ8 A;  1VGT A;  5D92 A;  2UX8 A;  4ZDQ A;  5C49 A;  1H4D A;  1NF5 B;  2WVM A;  2CU2 A;  4Y7F A;  5C3A A;  1O0R A;  3RMW A;  1V82 A;  1ZJP A;  3I0K A;  4D11 A;  1H5R B;  1MP5 A;  1ZJ2 A;  1E5K A;  1FGG A;  3ZGG A;  1ZIZ A;  1VGU A;  4K6R A;  4D48 A;  3ZF8 A;  3OAM A;  3CKJ A;  3CKN A;  1GWV A;  1G23 A;  1H7Q A;  1ZDF A;  5CQM X;  2JCO A;  3V0M A;  1XZ6 A;  4O6N A;  3V0N A;  1H7G A;  4M2B A;  4M28 A;  1H7L A;  1K4V A;  1V83 A;  4M2A A;  3SXA A;  3SXE A;  4Q7C A;  3NGW A;  3V91 A;  3ZLL A;  3SXD A;  1O7Q A;  1S4P A;  1ZCT A;  4CJB A;  4G3Q A;  1MP3 A;  3T7M A;  5C38 A;  1VZT A;  1H5R A;  4KXO A;  4NAN A;  2I5K A;  3V0O A;  1H4E A;  4Y6U A;  4Y7V A;  4Y7G A;  2FYB A;  1LZ0 A;  5C36 A;  1JV3 A;  5AJN A;  1WT3 A;  4Y64 A;  4FRM A;  4HO2 A;  1PZY B;  2QKX A;  1VZU A;  2BO6 A;  2AE7 A;  5AJP A;  2VSH A;  3CKO A;  3N9W A;  5EIY A;  3CKQ A;  4HO0 A;  1OMZ A;  2W0W A;  4M4K A;  2GGO A;  2YES A;  1NQI B;  3D8V A;  4KPZ A;  4D11 C;  1G0R A;  1G9R A;  4FIX A;  1FWY A;  4KPX A;  4AC3 A;  1FGX A;  2WGZ A;  3T7N A;  1G93 A;  3SX3 A;  2VS3 A;  1WT1 A;  5CMH A;  1SS9 A;  4B2X A;  4IRQ A;  1R7T A;  3POL A;  2ZU9 A;  4FQW A;  1FOA A;  3K8D A;  2RIX A;  4LW3 A;  1FR8 A;  2E3D A;  4CVH A;  1LZ7 A;  4NAL A;  1H3M A;  4B4G A;  3V8Y A;  1O7O A;  5DDT A;  1OQM B;  2QGI A;  1ZCV A;  1G1L A;  3U2T A;  1FO8 A;  1ZJ0 A;  3DUV A;  3R3I A;  4MND A;  1NKH B;  5C1H A;  2A8U A;  1ZJO A;  4FRP A;  2VS5 A;  3SX7 A;  5FYE A;  3SXB A;  2Z86 A;  2P6W A;  4P02 A;  1G2V A;  5CMI A;  1ZI1 A;  1S4N A;  2NXV A;  2OI7 A;  1WT2 A;  2Y4M A;  1YP4 A;  4DDZ A;  3EE5 A;  1JYK A;  5C3B A;  4CJ8 A;  1VH3 A;  1FG5 N;  1R82 A;  4R7P A;  1JVG A;  2PGY A;  3U2W A;  1ON6 A;  1H5S B;  2Y7A A;  1R80 A;  2AM5 A;  5C4B A;  3BCV A;  3TQD A;  1JV1 A;  4EEA A;  3E25 A;  3USQ A;  3OH3 A;  4FIY A;  2RJ7 A;  4EE4 A;  4MIX A;  5CMJ A;  2VFZ A;  4AAW A;  1GQ9 A;  3JUJ A;  4B4B A;  5CQN X;  1NHE B;  1W77 A;  3Q4S A;  4FRE A;  3F1C A;  5C4F A;  4EEM A;  1MP4 A;  2GGQ A;  2RIZ A;  3T7O A;  1LL0 A;  4Y7T A;  2WEE A;  1ZJ1 A;  2X5S A;  1ZI3 A;  3OH2 A;  4HO3 A;  2ZU7 A;  4BQH A;  4YS8 A;  1WSZ A;  4EEG A;  2AGD A;  4HOC A;  1GQC A;  2RJ6 A;  2RJ9 A;  1GWW A;  1G8O A;  4Y9X A;  1ZI5 A;  1QG8 A;  2J0B A;  2V0H A;  4NAK A;  1HJJ A;  1EZI A;  1G97 A;  5FTV A;  4JD0 A;  2Y4J A;  2X65 A;  4FRO A;  4HO8 A;  3U2X A;  1H7H A;  3CGX A;  5FUH A;  4P00 A;  1TVY A;  3DK5 A;  1VH1 A;  4FRA A;  2WAW A;  3K8E A;  3JTJ A;  3FWW A;  4FRB A;  3U0X A;  3SX8 A;  3V90 A;  1R7Y A;  2AEC A;  3I0J A;  5C48 A;  2OI6 A;  4HG6 A;  1HM0 A;  4E1K A;  2Z87 A;  3KIA A;  3Q7U A;  1NMM B;  1YP2 A;  1R81 A;  5IDS A;  4JIS A;  1IIM A;  1XHB A;  5FU8 A;  4FCE A;  4KC1 A;  2JCK A;  5D91 A;  2PX7 A;  4IRP A;  5FV9 A;  2V0K A;  1H5S C;  4Y63 A;  4AYJ A;  3IOJ A;  2XME A;  2VD4 A;  1LZI A;  4FCU A;  2BO7 A;  3OGZ A;  1MC3 A;  4CJC A;  2XWN A;  3BRK X;  5C1L A;  4ARW A;  3ST8 A;  2YC5 A;  3V0P A;  4EVW A;  4KC2 A;  4KNX A;  3SXC A;  1VIC A;  4AYL A;  1ZJ3 A;  1FO9 A;  5CMF X;  1HV9 A;  3RSB A;  2E8B A;  4EE5 A;  1NWG B;  4DEC A;  1TW5 A;  5FU0 A;  5IFY A;  5C47 A;  1HM8 A;  1H7E A;  1FXJ A;  1G95 A;  3R2W A;  3QVB A;  2O1F A;  2RJ1 A;  2RIT A;  2YQS A;  2Q4J A;  4Y62 A;  1LVW A;  2VK9 A;  1FXO A;  1ZI4 A;  2DPW A;  2V0I A;  2WVL A;  2RJ0 A;  3SPT A;  4O6M A;  5CQL X;  1FZW A;  2V0J A;  2AM4 A;  2P73 A;  1LL3 A;  2QH5 A;  2FFV A;  2JCJ A;  4ASJ A;  1W55 A;  1ZCY A;  1QGS A;  1R7X A;  3TZT A;  1KWS A;  4Y7U A;  3CKV A;  1W57 A;  1H7T A;  1PZT A;  3IOI A;  1ZCU A;  5CQP A;  3O3P A;  4ECM A;  3HL3 A;  5JQQ A;  4Y6N A;  1HJL A;  2YQH A;  2YQJ A;  2J0A A;  2JCL A;  1H7F A;  1INI A;  3E26 A;  1H5S A;  1ZDG A;  1JVD A;  4LW6 A;  3I0H A;  4B2W A;  1ON8 A;  4KC4 A;  4KT7 A;  2PA4 A;  2C0N A;  4FRH A;  2ICY A;  2I5E A;  2D7I A;  3IOH A;  1R7V A;  4HCQ A;  4NAI A;  2Y4L A;  4KRV A;  4D0Z A;  4EE3 A;  2BO8 A;  2AES A;  4FRD A;  2D7R A;  5C3D A;  4B4M A;  2RJ5 A;  1OMX A;  1ZHJ A;  3DJ4 A;  1H5T B;  4XWI A;  1FR9 A;  5IDT A;  2XWL A;  2AH9 A;  3ZLK A;  5EJZ A;  1G3L A;  3U2V A;  3F1Y A;  1TZF A;  2FYD B;  3OH1 A;  1HM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...