5C49A

Crystal structure of gtb + udp-c-gal + h-antigen
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
285
structure length
277
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGVSMRRMEMISFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histo-blood group ABO system transferase
publication title High Resolution Structures of the Human ABO(H) Blood Group Enzymes in Complex with Donor Analogs Reveal That the Enzymes Utilize Multiple Donor Conformations to Bind Substrates in a Stepwise Manner.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 277
sequence length 285
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2015-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5c49A00
1HJLA 2QKXA 2WGZA 4Y62A 2XMEA 2O1HA 3OGZA 2D7IA 3U2UA 2UX8A 4EVWA 4M28A 2AM5A 1LZJA 2YQCA 2V0LA 1GX0A 4EEMA 4DE7A 4HOCA 2X60A 3F1CA 4ECMA 2Y7AA 4HO6A 1H4DA 1MP3A 2FFUA 5C4DA 2WVKA 2QH5A 3IOHA 1ZJ2A 3V8ZA 1ON8A 3T7MA 2FYDB 2YQHA 3Q80A 5FU8A 3F1YA 2FFVA 4EEGA 1OMZA 3RMWA 1MP5A 1VH1A 1G1LA 5C1HA 1GQCA 4M2AA 1FWYA 5FYEA 1G2VA 4LW3A 1LL2A 3E26A 5C4BA 3GUEA 4E1KA 2QGIA 1R7UA 3I0CA 1H5TB 3ZGFA 3I0IX 2W0WA 3DJ4A 4K6RA 1ZHJA 5DDTA 1ZI5A 1VZTA 5C4CA 2E8BA 3K8EA 2RITA 4NAKA 4FRQA 4J18A 1ZDFA 4KPXA 3D5NA 2VS4A 2X5ZA 4HO2A 1QGSA 5IDTA 3EE5A 5J49A 1IIMA 4HO8A 2OEFA 1FXJA 2AH9A 2V0HA 4Y7TA 3LW6A 3OAMA 2JCJA 3RMVA 4B3UA 1H3MA 1FGGA 2P73A 1ZCVA 1ZJ1A 1YROB 1IINA 2FYCB 4FROA 5FUHA 4B5BA 4D48A 3CKJA 5HS2A 5C38A 1H7LA 5L6SA 5C1LA 1OMXA 2FYAA 2I7BA 3CKOA 5BXCA 1ZDGA 2A8WA 4HO9A 4BMAA 3I0HA 1LL3A 4FRPA 3SX7A 1YP3A 1VGWA 5C3AA 4G87A 4HO0A 3SXDA 1YP2A 4EE4A 4BQHA 2FY7A 1JV3A 2ZU9A 2Y4KA 1V82A 4Y6UA 1H5TA 4AYJA 1INJA 4L41C 1EYRA 2D7RA 1LL0A 1FXOA 3V90A 4MYBA 1O7QA 1ZJOA 1TW1A 2FYBA 2RJ5A 5C1GA 2W0VA 2XWLA 3D98A 4Y7UA 1QGQA 5C8RA 1WT0A 2Y6PA 5CMFX 4XWIA 1VZUA 3V0OA 3JUKA 3SXCA 3PKPA 5FTSA 4B2WA 1ON6A 1FO9A 1S4PA 2ICYA 4MNDA 5CMGX 4HO3A 3U0YA 3I0GA 3FOQA 1R7YA 2AGDA 4G3SA 2XMHA 1G9RA 2YESA 1LVWA 1R81A 4HCQA 5C47A 1NF5B 2AE7A 1HJJA 2PGYA 1EZIA 3OH2A 1ZCTA 1ZCUA 4KC1A 4C2SA 3OKRA 1H7EA 4DECA 3V91A 1G3LA 4FRMA 2Q4JA 1FZWA 1KWSA 2OI6A 2RIYA 5CMIA 3I0LA 1ZCYA 1ZIZA 1GA8A 4HO4A 2V0JA 3USQA 3OH0A 5CQPA 1H4EA 1W77A 1NHEB 3DK5A 3JUJA 5EIYA 2JCOA 2GGQA 1PZTA 4B42A 4AYLA 4EEAA 1W57A 2RIXA 2O1FA 3CKNA 5CQOA 3Q7UA 1VPAA 1NKHB 2VD4A 4FQWA 4EE5A 3O3PA 1G0RA 1H5SB 2RJ1A 2E3DA 3V0QA 2Y4JA 4B4BA 1H7GA 1R7XA 1K4VA 4JISA 3SXGA 1OQMB 4KNRA 1TVYA 4G3QA 3R3IA 4B4GA 1VICA 1FO8A 2Z87A 1S4OA 4FREA 1JYLA 1ZJ0A 1LZ7A 3ZLKA 2PA4A 4FRLA 3QVBA 1XHBA 4D0TA 2XWMA 5C4EA 3POLA 1FGXA 4KQLA 1ZI1A 2ICXA 3R2WA 1Z90A 3I0DA 2CU2A 1HV9A 4ASYA 5CQMX 1ZJ3A 4FCEA 4NALA 4KC2A 5C3DA 1H5RB 2WAWA 1VH3A 3K8DA 4G3PA 2Z86A 1TW5A 2VXLA 5AJPA 3OH4A 3PNNA 3D8VA 3SXBA 2AM4A 4FRDA 4NAIA 2Y4MA 2MZBA 1WT1A 1H4CA 5FTVA 1H5SA 2RJ4A 1VZXA 1VGTA 3V8YA 2I5EA 1FR9A 2V0KA 4HG6A 1R7TA 1E5KA 3BCVA 2D0JA 2OEGA 2YCMA 4P00A 1G95A 1NQIB 1G23A 5I1FA 1GQ9A 4DDZA 1G97A 1R82A 3ZF8A 3HL3A 3V0PA 4Y6NA 4AC3A 3I0JA 1O23B 1R80A 3SX5A 4CVHA 1H7HA 1W55A 1FRWA 2X65A 1YP4A 4YS8A 4CJBA 4Y64A 2ZU8A 3PKQA 5FU0A 4ASJA 4D11A 1HM8A 3U2VA 4Y63A 3DUVA 4FCUA 2BO8A 4KPZA 5C36A 3U0XA 4KT7A 4GBPA 1H5RA 2BO7A 5IDSA 3SX3A 1ZJPA 2RJ8A 3IOIA 3I0KA 3ZGGA 4KRVA 5C48A 1JVGA 5AJNA 1NWGB 2WVMA 3OH1A 4UEGA 1TZFA 3CU0A 2WVLA 1H7FA 1INIA 2YQSA 2VS5A 4LW6A 3SX8A 4IRPA 1WT3A 1WT2A 1FG5N 4KNXA 4CJ8A 3USRA 1G93A 1G8OA 1QWJA 5DDVA 2ZU7A 1XZ6A 3IOJA 4AAWA 1JV1A 3CKVA 5FV9A 2A8UA 4FRBA 3KIAA 5C3BA 4B2XA 2VSHA 1I52A 4HO5A 4R7PA 2P6WA 1JYKA 1JVDA 4CJCA 2AESA 4Y7VA 2Y4LA 3CKQA 2AM3A 1PZYB 2VFZA 3TZTA 3OH3A 3TQDA 1HM9A 4ARWA 4D0ZA 1VM8A 2XWNA 1FR8A 3V0LA 1V84A 4NANA 1WSZA 5JQQA 2DPWA 2V0IA 2GGOA 5CMHA 3U2TA 5C49A 4JD0A 2YC3A 5IFYA 4M2BA 1WVCA 3V0MA 5EJ1A 2NXVA 1GWVA 1H7TA 2BO4A 2P72A 4KXOA 2O1GA 3RSBA 1R7VA 3FWWA 4Y9XA 3ST8A 3I0EA 1O7OA 2OI7A 3SXAA 1H5SC 1H7QA 2YQJA 2RIZA 2RJ9A 3N9WA 4FRAA 1GWWA 1S4NA 1MC3A 1VGUA 2APCA 3E25A 1FOAA 2YC5A 3OC9A 3SPTA 5AJOA 3JTJA 2RJ6A 3SXEA 2PGVA 1GX4A 2RJ0A 5CQLX 1ZI4A 2BO6A 3CGXA 1NMMB 1O0RA 2VS3A 4M4KA 4FRHA 2I5KA 5EJZA 3T7OA 2WE9A 2X5SA 1QG8A 1ZI3A 2VSIA 4ZDQA 3U2XA 3NGWA 2WEEA 2JCKA 4IRQA 2VXMA 4EE3A 5CQNX 4D11C 2JCLA 3BRKX 3T7NA 3I0FA 5L6VA 1HM0A 2OI5A 4P02A 3ZLLA 4B4MA 5C4FA 3Q4SA 4KC4A 1LZIA 1SS9A 5CMJA 4Y7FA 1LZ0A 4Y7GA 3V0NA 4EEOA 1MP4A 2PX7A 2AECA 2RJ7A 1H5SD 3U2WA 1V83A 1VGZA
chains in the Genus database with same CATH superfamily
1HJLA 2QKXA 2WGZA 4Y62A 2XMEA 2O1HA 3OGZA 2D7IA 3U2UA 2UX8A 4EVWA 4M28A 2AM5A 1LZJA 2YQCA 2V0LA 1GX0A 4EEMA 4DE7A 4HOCA 2X60A 3F1CA 4ECMA 2Y7AA 4HO6A 1H4DA 1MP3A 2FFUA 5C4DA 2WVKA 2QH5A 3IOHA 1ZJ2A 3V8ZA 1ON8A 3T7MA 2FYDB 2YQHA 3Q80A 5FU8A 3F1YA 2FFVA 4EEGA 1OMZA 3RMWA 1MP5A 1VH1A 1G1LA 5C1HA 1GQCA 4M2AA 1FWYA 5FYEA 1G2VA 4LW3A 1LL2A 5D92A 3E26A 5C4BA 3GUEA 4E1KA 2QGIA 1R7UA 3I0CA 1H5TB 3ZGFA 3I0IX 2W0WA 3DJ4A 4K6RA 1ZHJA 5DDTA 4FIYA 1ZI5A 1VZTA 5C4CA 2E8BA 3K8EA 2RITA 4NAKA 4FRQA 4J18A 1ZDFA 4KPXA 3D5NA 2VS4A 2X5ZA 4HO2A 1QGSA 5IDTA 3EE5A 5J49A 1IIMA 4HO8A 2OEFA 1FXJA 2AH9A 2V0HA 4Y7TA 3LW6A 3OAMA 2JCJA 3RMVA 4B3UA 1H3MA 1FGGA 2P73A 1ZCVA 1ZJ1A 1YROB 1IINA 2FYCB 4FROA 5FUHA 4B5BA 4D48A 3CKJA 5HS2A 5C38A 1H7LA 5L6SA 5C1LA 1OMXA 2FYAA 2I7BA 3CKOA 5BXCA 1ZDGA 2A8WA 4HO9A 4BMAA 3I0HA 1LL3A 4FRPA 3SX7A 1YP3A 1VGWA 5C3AA 4G87A 4HO0A 3SXDA 1YP2A 4EE4A 4BQHA 2FY7A 1JV3A 2ZU9A 2Y4KA 1V82A 4Y6UA 1H5TA 4AYJA 1INJA 4L41C 1EYRA 2D7RA 1LL0A 1FXOA 3V90A 4MYBA 1O7QA 1ZJOA 1TW1A 2FYBA 2RJ5A 5C1GA 2W0VA 2XWLA 3D98A 4Y7UA 1QGQA 5C8RA 1WT0A 2Y6PA 5CMFX 4XWIA 1VZUA 3V0OA 3JUKA 3SXCA 3PKPA 5FTSA 4B2WA 1ON6A 1FO9A 1S4PA 2ICYA 4MNDA 5CMGX 4HO3A 3U0YA 3I0GA 3FOQA 1R7YA 2J0AA 2AGDA 4G3SA 2XMHA 1G9RA 2YESA 1LVWA 1R81A 4HCQA 5C47A 1NF5B 2AE7A 1HJJA 2PGYA 1EZIA 2VK9A 3OH2A 1ZCTA 1ZCUA 4KC1A 4C2SA 3OKRA 1H7EA 4DECA 3V91A 1G3LA 4FRMA 2Q4JA 1FZWA 1KWSA 2OI6A 2RIYA 5CMIA 3I0LA 1ZCYA 1ZIZA 1GA8A 4HO4A 2V0JA 3USQA 3OH0A 5CQPA 1H4EA 1W77A 1NHEB 3DK5A 3JUJA 5EIYA 2JCOA 2GGQA 1PZTA 4B42A 4AYLA 4EEAA 1W57A 2RIXA 2O1FA 3CKNA 5CQOA 3Q7UA 1VPAA 1NKHB 2VD4A 4FQWA 4EE5A 3O3PA 1G0RA 1H5SB 2RJ1A 2E3DA 3V0QA 2Y4JA 4B4BA 1H7GA 5D91A 1R7XA 1K4VA 4JISA 3SXGA 1OQMB 4FIXA 1TVYA 4KNRA 4G3QA 3R3IA 4B4GA 1VICA 1FO8A 2Z87A 1S4OA 4FREA 1JYLA 1ZJ0A 1LZ7A 3ZLKA 2PA4A 4FRLA 3QVBA 1XHBA 4D0TA 2XWMA 5C4EA 3POLA 1FGXA 4KQLA 1ZI1A 2ICXA 3R2WA 1Z90A 4Q7CA 3I0DA 2CU2A 1HV9A 4ASYA 5CQMX 1ZJ3A 4FCEA 4NALA 4KC2A 2C0NA 5C3DA 1H5RB 2WAWA 1VH3A 3K8DA 4G3PA 2Z86A 1TW5A 2VXLA 5AJPA 3OH4A 3PNNA 3D8VA 3SXBA 2AM4A 4FRDA 4NAIA 2Y4MA 2MZBA 1WT1A 1H4CA 5FTVA 1H5SA 2RJ4A 1VZXA 1VGTA 3V8YA 2I5EA 1FR9A 2V0KA 4HG6A 1R7TA 1E5KA 2J0BA 3BCVA 2D0JA 2OEGA 2YCMA 4P00A 1G95A 1NQIB 1G23A 5I1FA 1GQ9A 4DDZA 1G97A 1R82A 3ZF8A 3HL3A 3V0PA 4Y6NA 4AC3A 3I0JA 1O23B 1R80A 3SX5A 4CVHA 1H7HA 1W55A 1FRWA 2X65A 1YP4A 4YS8A 4CJBA 4Y64A 2ZU8A 3PKQA 5FU0A 4ASJA 4D11A 1HM8A 3U2VA 4Y63A 3DUVA 4FCUA 2BO8A 4KPZA 5C36A 3U0XA 4KT7A 4GBPA 1H5RA 2BO7A 5IDSA 3SX3A 1ZJPA 2RJ8A 3IOIA 3I0KA 3ZGGA 4KRVA 5C48A 1JVGA 5AJNA 1NWGB 2WVMA 3OH1A 4UEGA 1TZFA 3CU0A 2WVLA 1H7FA 1INIA 2YQSA 2VS5A 4LW6A 3SX8A 4IRPA 1WT3A 1WT2A 1FG5N 4KNXA 4CJ8A 3USRA 1G93A 1G8OA 1QWJA 5DDVA 2ZU7A 1XZ6A 3IOJA 4AAWA 1JV1A 3CKVA 5FV9A 2A8UA 4FRBA 3KIAA 5C3BA 4B2XA 4O6MA 2VSHA 1I52A 4HO5A 4R7PA 2P6WA 1JYKA 1JVDA 4CJCA 2AESA 4Y7VA 2Y4LA 3CKQA 2AM3A 1PZYB 2VFZA 3TZTA 3OH3A 3TQDA 1HM9A 4ARWA 4D0ZA 1VM8A 2XWNA 1FR8A 3V0LA 1V84A 4NANA 1WSZA 5JQQA 2DPWA 2V0IA 2GGOA 5CMHA 3U2TA 5C49A 4JD0A 2YC3A 5IFYA 4M2BA 1WVCA 3V0MA 5EJ1A 2NXVA 1GWVA 1H7TA 2BO4A 2P72A 4KXOA 2O1GA 3RSBA 1R7VA 3FWWA 4Y9XA 3ST8A 3I0EA 1O7OA 2OI7A 3SXAA 1H5SC 1H7QA 2YQJA 2RIZA 2RJ9A 3N9WA 4FRAA 1GWWA 1S4NA 1MC3A 1VGUA 2APCA 3E25A 1FOAA 2YC5A 3OC9A 3SPTA 5AJOA 3JTJA 2RJ6A 3SXEA 2PGVA 1GX4A 2RJ0A 5CQLX 1ZI4A 2BO6A 3CGXA 1NMMB 1O0RA 2VS3A 4M4KA 4FRHA 2I5KA 5EJZA 3T7OA 2WE9A 2X5SA 1QG8A 1ZI3A 2VSIA 4ZDQA 3U2XA 3NGWA 2WEEA 2JCKA 4IRQA 2VXMA 4EE3A 5CQNX 4D11C 2JCLA 4O6NA 3BRKX 3T7NA 3I0FA 5L6VA 1HM0A 2OI5A 4P02A 3ZLLA 4B4MA 5C4FA 3Q4SA 4KC4A 1LZIA 1SS9A 5CMJA 4Y7FA 1LZ0A 4Y7GA 3V0NA 4EEOA 1MP4A 2PX7A 2AECA 2RJ7A 1H5SD 4MIXA 3U2WA 1V83A 1VGZA
chains in the Genus database with same CATH topology
1HJLA 2QKXA 2WGZA 4Y62A 2XMEA 2O1HA 3OGZA 2D7IA 3U2UA 2UX8A 4EVWA 4M28A 2AM5A 1LZJA 2YQCA 2V0LA 1GX0A 4EEMA 4DE7A 4HOCA 2X60A 3F1CA 4ECMA 2Y7AA 4HO6A 1H4DA 1MP3A 2FFUA 5C4DA 2WVKA 2QH5A 3IOHA 1ZJ2A 3V8ZA 1ON8A 3T7MA 2FYDB 2YQHA 3Q80A 5FU8A 3F1YA 2FFVA 4EEGA 1OMZA 3RMWA 1MP5A 1VH1A 1G1LA 5C1HA 1GQCA 4M2AA 1FWYA 5FYEA 1G2VA 4LW3A 1LL2A 5D92A 3E26A 5C4BA 3GUEA 4E1KA 2QGIA 1R7UA 3I0CA 1H5TB 3ZGFA 3I0IX 2W0WA 3DJ4A 4K6RA 1ZHJA 5DDTA 4FIYA 1ZI5A 1VZTA 5C4CA 2E8BA 3K8EA 2RITA 4NAKA 4FRQA 4J18A 1ZDFA 4KPXA 3D5NA 2VS4A 2X5ZA 4HO2A 1QGSA 5IDTA 3EE5A 5J49A 1IIMA 4HO8A 2OEFA 1FXJA 2AH9A 2V0HA 4Y7TA 3LW6A 3OAMA 2JCJA 3RMVA 4B3UA 1H3MA 1FGGA 2P73A 1ZCVA 1ZJ1A 1YROB 1IINA 2FYCB 4FROA 5FUHA 4B5BA 4D48A 3CKJA 5HS2A 5C38A 1H7LA 5L6SA 5C1LA 1OMXA 2FYAA 2I7BA 3CKOA 5BXCA 1ZDGA 2A8WA 4HO9A 4BMAA 3I0HA 1LL3A 4FRPA 3SX7A 1YP3A 1VGWA 5C3AA 4G87A 4HO0A 3SXDA 1YP2A 4EE4A 4BQHA 2FY7A 1JV3A 2ZU9A 2Y4KA 1V82A 4Y6UA 1H5TA 4AYJA 1INJA 4L41C 1EYRA 2D7RA 1LL0A 1FXOA 3V90A 4MYBA 1O7QA 1ZJOA 1TW1A 2FYBA 2RJ5A 5C1GA 2W0VA 2XWLA 3D98A 4Y7UA 1QGQA 5C8RA 1WT0A 2Y6PA 5CMFX 4XWIA 1VZUA 3V0OA 3JUKA 3SXCA 3PKPA 5FTSA 4B2WA 1ON6A 1FO9A 1S4PA 2ICYA 4MNDA 5CMGX 4HO3A 3U0YA 3I0GA 3FOQA 1R7YA 2J0AA 2AGDA 4G3SA 2XMHA 1G9RA 2YESA 1LVWA 1R81A 4HCQA 5C47A 1NF5B 2AE7A 1HJJA 2PGYA 1EZIA 2VK9A 3OH2A 1ZCTA 1ZCUA 4KC1A 4C2SA 3OKRA 1H7EA 4DECA 3V91A 1G3LA 4FRMA 2Q4JA 1FZWA 1KWSA 2OI6A 2RIYA 5CMIA 3I0LA 1ZCYA 1ZIZA 1GA8A 4HO4A 2V0JA 3USQA 3OH0A 5CQPA 1H4EA 1W77A 1NHEB 3DK5A 3JUJA 5EIYA 2JCOA 2GGQA 1PZTA 4B42A 4AYLA 4EEAA 1W57A 2RIXA 2O1FA 3CKNA 5CQOA 3Q7UA 1VPAA 1NKHB 2VD4A 4FQWA 4EE5A 3O3PA 1G0RA 1H5SB 2RJ1A 2E3DA 3V0QA 2Y4JA 4B4BA 1H7GA 5D91A 1R7XA 1K4VA 4JISA 3SXGA 1OQMB 4FIXA 1TVYA 4KNRA 4G3QA 3R3IA 4B4GA 1VICA 1FO8A 2Z87A 1S4OA 4FREA 1JYLA 1ZJ0A 1LZ7A 3ZLKA 2PA4A 4FRLA 3QVBA 1XHBA 4D0TA 2XWMA 5C4EA 3POLA 1FGXA 4KQLA 1ZI1A 2ICXA 3R2WA 1Z90A 4Q7CA 3I0DA 2CU2A 1HV9A 4ASYA 5CQMX 1ZJ3A 4FCEA 4NALA 4KC2A 2C0NA 5C3DA 1H5RB 2WAWA 1VH3A 3K8DA 4G3PA 2Z86A 1TW5A 2VXLA 5AJPA 3OH4A 3PNNA 3D8VA 3SXBA 2AM4A 4FRDA 4NAIA 2Y4MA 2MZBA 1WT1A 1H4CA 5FTVA 1H5SA 2RJ4A 1VZXA 1VGTA 3V8YA 2I5EA 1FR9A 2V0KA 4HG6A 1R7TA 1E5KA 2J0BA 3BCVA 2D0JA 2OEGA 2YCMA 4P00A 1G95A 1NQIB 1G23A 5I1FA 1GQ9A 4DDZA 1G97A 1R82A 3ZF8A 3HL3A 3V0PA 4Y6NA 4AC3A 3I0JA 1O23B 1R80A 3SX5A 4CVHA 1H7HA 1W55A 1FRWA 2X65A 1YP4A 4YS8A 4CJBA 4Y64A 2ZU8A 3PKQA 5FU0A 4ASJA 4D11A 1HM8A 3U2VA 4Y63A 3DUVA 4FCUA 2BO8A 4KPZA 5C36A 3U0XA 4KT7A 4GBPA 1H5RA 2BO7A 5IDSA 3SX3A 1ZJPA 2RJ8A 3IOIA 3I0KA 3ZGGA 4KRVA 5C48A 1JVGA 5AJNA 1NWGB 2WVMA 3OH1A 4UEGA 1TZFA 3CU0A 2WVLA 1H7FA 1INIA 2YQSA 2VS5A 4LW6A 3SX8A 4IRPA 1WT3A 1WT2A 1FG5N 4KNXA 4CJ8A 3USRA 1G93A 1G8OA 1QWJA 5DDVA 2ZU7A 1XZ6A 3IOJA 4AAWA 1JV1A 3CKVA 5FV9A 2A8UA 4FRBA 3KIAA 5C3BA 4B2XA 4O6MA 2VSHA 1I52A 4HO5A 4R7PA 2P6WA 1JYKA 1JVDA 4CJCA 2AESA 4Y7VA 2Y4LA 3CKQA 2AM3A 1PZYB 2VFZA 3TZTA 3OH3A 3TQDA 1HM9A 4ARWA 4D0ZA 1VM8A 2XWNA 1FR8A 3V0LA 1V84A 4NANA 1WSZA 5JQQA 2DPWA 2V0IA 2GGOA 5CMHA 3U2TA 5C49A 4JD0A 2YC3A 5IFYA 4M2BA 1WVCA 3V0MA 5EJ1A 2NXVA 1GWVA 1H7TA 2BO4A 2P72A 4KXOA 2O1GA 3RSBA 1R7VA 3FWWA 4Y9XA 3ST8A 3I0EA 1O7OA 2OI7A 3SXAA 1H5SC 1H7QA 2YQJA 2RIZA 2RJ9A 3N9WA 4FRAA 1GWWA 1S4NA 1MC3A 1VGUA 2APCA 3E25A 1FOAA 2YC5A 3OC9A 3SPTA 5AJOA 3JTJA 2RJ6A 3SXEA 2PGVA 1GX4A 2RJ0A 5CQLX 1ZI4A 2BO6A 3CGXA 1NMMB 1O0RA 2VS3A 4M4KA 4FRHA 2I5KA 5EJZA 3T7OA 2WE9A 2X5SA 1QG8A 1ZI3A 2VSIA 4ZDQA 3U2XA 3NGWA 2WEEA 2JCKA 4IRQA 2VXMA 4EE3A 5CQNX 4D11C 2JCLA 4O6NA 3BRKX 3T7NA 3I0FA 5L6VA 1HM0A 2OI5A 4P02A 3ZLLA 4B4MA 5C4FA 3Q4SA 4KC4A 1LZIA 1SS9A 5CMJA 4Y7FA 1LZ0A 4Y7GA 3V0NA 4EEOA 1MP4A 2PX7A 2AECA 2RJ7A 1H5SD 4MIXA 3U2WA 1V83A 1VGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HJL A;  2QKX A;  2WGZ A;  4Y62 A;  2XME A;  2O1H A;  3OGZ A;  2D7I A;  3U2U A;  2UX8 A;  4EVW A;  4M28 A;  2AM5 A;  1LZJ A;  2YQC A;  2V0L A;  1GX0 A;  4EEM A;  4DE7 A;  4HOC A;  2X60 A;  3F1C A;  4ECM A;  2Y7A A;  4HO6 A;  1H4D A;  1MP3 A;  2FFU A;  5C4D A;  2WVK A;  2QH5 A;  3IOH A;  1ZJ2 A;  3V8Z A;  1ON8 A;  3T7M A;  2FYD B;  2YQH A;  3Q80 A;  5FU8 A;  3F1Y A;  2FFV A;  4EEG A;  1OMZ A;  3RMW A;  1MP5 A;  1VH1 A;  1G1L A;  5C1H A;  1GQC A;  4M2A A;  1FWY A;  5FYE A;  1G2V A;  4LW3 A;  1LL2 A;  3E26 A;  5C4B A;  3GUE A;  4E1K A;  2QGI A;  1R7U A;  3I0C A;  1H5T B;  3ZGF A;  3I0I X;  2W0W A;  3DJ4 A;  4K6R A;  1ZHJ A;  5DDT A;  1ZI5 A;  1VZT A;  5C4C A;  2E8B A;  3K8E A;  2RIT A;  4NAK A;  4FRQ A;  4J18 A;  1ZDF A;  4KPX A;  3D5N A;  2VS4 A;  2X5Z A;  4HO2 A;  1QGS A;  5IDT A;  3EE5 A;  5J49 A;  1IIM A;  4HO8 A;  2OEF A;  1FXJ A;  2AH9 A;  2V0H A;  4Y7T A;  3LW6 A;  3OAM A;  2JCJ A;  3RMV A;  4B3U A;  1H3M A;  1FGG A;  2P73 A;  1ZCV A;  1ZJ1 A;  1YRO B;  1IIN A;  2FYC B;  4FRO A;  5FUH A;  4B5B A;  4D48 A;  3CKJ A;  5HS2 A;  5C38 A;  1H7L A;  5L6S A;  5C1L A;  1OMX A;  2FYA A;  2I7B A;  3CKO A;  5BXC A;  1ZDG A;  2A8W A;  4HO9 A;  4BMA A;  3I0H A;  1LL3 A;  4FRP A;  3SX7 A;  1YP3 A;  1VGW A;  5C3A A;  4G87 A;  4HO0 A;  3SXD A;  1YP2 A;  4EE4 A;  4BQH A;  2FY7 A;  1JV3 A;  2ZU9 A;  2Y4K A;  1V82 A;  4Y6U A;  1H5T A;  4AYJ A;  1INJ A;  4L41 C;  1EYR A;  2D7R A;  1LL0 A;  1FXO A;  3V90 A;  4MYB A;  1O7Q A;  1ZJO A;  1TW1 A;  2FYB A;  2RJ5 A;  5C1G A;  2W0V A;  2XWL A;  3D98 A;  4Y7U A;  1QGQ A;  5C8R A;  1WT0 A;  2Y6P A;  5CMF X;  4XWI A;  1VZU A;  3V0O A;  3JUK A;  3SXC A;  3PKP A;  5FTS A;  4B2W A;  1ON6 A;  1FO9 A;  1S4P A;  2ICY A;  4MND A;  5CMG X;  4HO3 A;  3U0Y A;  3I0G A;  3FOQ A;  1R7Y A;  2AGD A;  4G3S A;  2XMH A;  1G9R A;  2YES A;  1LVW A;  1R81 A;  4HCQ A;  5C47 A;  1NF5 B;  2AE7 A;  1HJJ A;  2PGY A;  1EZI A;  3OH2 A;  1ZCT A;  1ZCU A;  4KC1 A;  4C2S A;  3OKR A;  1H7E A;  4DEC A;  3V91 A;  1G3L A;  4FRM A;  2Q4J A;  1FZW A;  1KWS A;  2OI6 A;  2RIY A;  5CMI A;  3I0L A;  1ZCY A;  1ZIZ A;  1GA8 A;  4HO4 A;  2V0J A;  3USQ A;  3OH0 A;  5CQP A;  1H4E A;  1W77 A;  1NHE B;  3DK5 A;  3JUJ A;  5EIY A;  2JCO A;  2GGQ A;  1PZT A;  4B42 A;  4AYL A;  4EEA A;  1W57 A;  2RIX A;  2O1F A;  3CKN A;  5CQO A;  3Q7U A;  1VPA A;  1NKH B;  2VD4 A;  4FQW A;  4EE5 A;  3O3P A;  1G0R A;  1H5S B;  2RJ1 A;  2E3D A;  3V0Q A;  2Y4J A;  4B4B A;  1H7G A;  1R7X A;  1K4V A;  4JIS A;  3SXG A;  1OQM B;  4KNR A;  1TVY A;  4G3Q A;  3R3I A;  4B4G A;  1VIC A;  1FO8 A;  2Z87 A;  1S4O A;  4FRE A;  1JYL A;  1ZJ0 A;  1LZ7 A;  3ZLK A;  2PA4 A;  4FRL A;  3QVB A;  1XHB A;  4D0T A;  2XWM A;  5C4E A;  3POL A;  1FGX A;  4KQL A;  1ZI1 A;  2ICX A;  3R2W A;  1Z90 A;  3I0D A;  2CU2 A;  1HV9 A;  4ASY A;  5CQM X;  1ZJ3 A;  4FCE A;  4NAL A;  4KC2 A;  5C3D A;  1H5R B;  2WAW A;  1VH3 A;  3K8D A;  4G3P A;  2Z86 A;  1TW5 A;  2VXL A;  5AJP A;  3OH4 A;  3PNN A;  3D8V A;  3SXB A;  2AM4 A;  4FRD A;  4NAI A;  2Y4M A;  2MZB A;  1WT1 A;  1H4C A;  5FTV A;  1H5S A;  2RJ4 A;  1VZX A;  1VGT A;  3V8Y A;  2I5E A;  1FR9 A;  2V0K A;  4HG6 A;  1R7T A;  1E5K A;  3BCV A;  2D0J A;  2OEG A;  2YCM A;  4P00 A;  1G95 A;  1NQI B;  1G23 A;  5I1F A;  1GQ9 A;  4DDZ A;  1G97 A;  1R82 A;  3ZF8 A;  3HL3 A;  3V0P A;  4Y6N A;  4AC3 A;  3I0J A;  1O23 B;  1R80 A;  3SX5 A;  4CVH A;  1H7H A;  1W55 A;  1FRW A;  2X65 A;  1YP4 A;  4YS8 A;  4CJB A;  4Y64 A;  2ZU8 A;  3PKQ A;  5FU0 A;  4ASJ A;  4D11 A;  1HM8 A;  3U2V A;  4Y63 A;  3DUV A;  4FCU A;  2BO8 A;  4KPZ A;  5C36 A;  3U0X A;  4KT7 A;  4GBP A;  1H5R A;  2BO7 A;  5IDS A;  3SX3 A;  1ZJP A;  2RJ8 A;  3IOI A;  3I0K A;  3ZGG A;  4KRV A;  5C48 A;  1JVG A;  5AJN A;  1NWG B;  2WVM A;  3OH1 A;  4UEG A;  1TZF A;  3CU0 A;  2WVL A;  1H7F A;  1INI A;  2YQS A;  2VS5 A;  4LW6 A;  3SX8 A;  4IRP A;  1WT3 A;  1WT2 A;  1FG5 N;  4KNX A;  4CJ8 A;  3USR A;  1G93 A;  1G8O A;  1QWJ A;  5DDV A;  2ZU7 A;  1XZ6 A;  3IOJ A;  4AAW A;  1JV1 A;  3CKV A;  5FV9 A;  2A8U A;  4FRB A;  3KIA A;  5C3B A;  4B2X A;  2VSH A;  1I52 A;  4HO5 A;  4R7P A;  2P6W A;  1JYK A;  1JVD A;  4CJC A;  2AES A;  4Y7V A;  2Y4L A;  3CKQ A;  2AM3 A;  1PZY B;  2VFZ A;  3TZT A;  3OH3 A;  3TQD A;  1HM9 A;  4ARW A;  4D0Z A;  1VM8 A;  2XWN A;  1FR8 A;  3V0L A;  1V84 A;  4NAN A;  1WSZ A;  5JQQ A;  2DPW A;  2V0I A;  2GGO A;  5CMH A;  3U2T A;  5C49 A;  4JD0 A;  2YC3 A;  5IFY A;  4M2B A;  1WVC A;  3V0M A;  5EJ1 A;  2NXV A;  1GWV A;  1H7T A;  2BO4 A;  2P72 A;  4KXO A;  2O1G A;  3RSB A;  1R7V A;  3FWW A;  4Y9X A;  3ST8 A;  3I0E A;  1O7O A;  2OI7 A;  3SXA A;  1H5S C;  1H7Q A;  2YQJ A;  2RIZ A;  2RJ9 A;  3N9W A;  4FRA A;  1GWW A;  1S4N A;  1MC3 A;  1VGU A;  2APC A;  3E25 A;  1FOA A;  2YC5 A;  3OC9 A;  3SPT A;  5AJO A;  3JTJ A;  2RJ6 A;  3SXE A;  2PGV A;  1GX4 A;  2RJ0 A;  5CQL X;  1ZI4 A;  2BO6 A;  3CGX A;  1NMM B;  1O0R A;  2VS3 A;  4M4K A;  4FRH A;  2I5K A;  5EJZ A;  3T7O A;  2WE9 A;  2X5S A;  1QG8 A;  1ZI3 A;  2VSI A;  4ZDQ A;  3U2X A;  3NGW A;  2WEE A;  2JCK A;  4IRQ A;  2VXM A;  4EE3 A;  5CQN X;  4D11 C;  2JCL A;  3BRK X;  3T7N A;  3I0F A;  5L6V A;  1HM0 A;  2OI5 A;  4P02 A;  3ZLL A;  4B4M A;  5C4F A;  3Q4S A;  4KC4 A;  1LZI A;  1SS9 A;  5CMJ A;  4Y7F A;  1LZ0 A;  4Y7G A;  3V0N A;  4EEO A;  1MP4 A;  2PX7 A;  2AEC A;  2RJ7 A;  1H5S D;  3U2W A;  1V83 A;  1VGZ A; 
#chains in the Genus database with same CATH topology
 1HJL A;  2QKX A;  2WGZ A;  4Y62 A;  2XME A;  2O1H A;  3OGZ A;  2D7I A;  3U2U A;  2UX8 A;  4EVW A;  4M28 A;  2AM5 A;  1LZJ A;  2YQC A;  2V0L A;  1GX0 A;  4EEM A;  4DE7 A;  4HOC A;  2X60 A;  3F1C A;  4ECM A;  2Y7A A;  4HO6 A;  1H4D A;  1MP3 A;  2FFU A;  5C4D A;  2WVK A;  2QH5 A;  3IOH A;  1ZJ2 A;  3V8Z A;  1ON8 A;  3T7M A;  2FYD B;  2YQH A;  3Q80 A;  5FU8 A;  3F1Y A;  2FFV A;  4EEG A;  1OMZ A;  3RMW A;  1MP5 A;  1VH1 A;  1G1L A;  5C1H A;  1GQC A;  4M2A A;  1FWY A;  5FYE A;  1G2V A;  4LW3 A;  1LL2 A;  5D92 A;  3E26 A;  5C4B A;  3GUE A;  4E1K A;  2QGI A;  1R7U A;  3I0C A;  1H5T B;  3ZGF A;  3I0I X;  2W0W A;  3DJ4 A;  4K6R A;  1ZHJ A;  5DDT A;  4FIY A;  1ZI5 A;  1VZT A;  5C4C A;  2E8B A;  3K8E A;  2RIT A;  4NAK A;  4FRQ A;  4J18 A;  1ZDF A;  4KPX A;  3D5N A;  2VS4 A;  2X5Z A;  4HO2 A;  1QGS A;  5IDT A;  3EE5 A;  5J49 A;  1IIM A;  4HO8 A;  2OEF A;  1FXJ A;  2AH9 A;  2V0H A;  4Y7T A;  3LW6 A;  3OAM A;  2JCJ A;  3RMV A;  4B3U A;  1H3M A;  1FGG A;  2P73 A;  1ZCV A;  1ZJ1 A;  1YRO B;  1IIN A;  2FYC B;  4FRO A;  5FUH A;  4B5B A;  4D48 A;  3CKJ A;  5HS2 A;  5C38 A;  1H7L A;  5L6S A;  5C1L A;  1OMX A;  2FYA A;  2I7B A;  3CKO A;  5BXC A;  1ZDG A;  2A8W A;  4HO9 A;  4BMA A;  3I0H A;  1LL3 A;  4FRP A;  3SX7 A;  1YP3 A;  1VGW A;  5C3A A;  4G87 A;  4HO0 A;  3SXD A;  1YP2 A;  4EE4 A;  4BQH A;  2FY7 A;  1JV3 A;  2ZU9 A;  2Y4K A;  1V82 A;  4Y6U A;  1H5T A;  4AYJ A;  1INJ A;  4L41 C;  1EYR A;  2D7R A;  1LL0 A;  1FXO A;  3V90 A;  4MYB A;  1O7Q A;  1ZJO A;  1TW1 A;  2FYB A;  2RJ5 A;  5C1G A;  2W0V A;  2XWL A;  3D98 A;  4Y7U A;  1QGQ A;  5C8R A;  1WT0 A;  2Y6P A;  5CMF X;  4XWI A;  1VZU A;  3V0O A;  3JUK A;  3SXC A;  3PKP A;  5FTS A;  4B2W A;  1ON6 A;  1FO9 A;  1S4P A;  2ICY A;  4MND A;  5CMG X;  4HO3 A;  3U0Y A;  3I0G A;  3FOQ A;  1R7Y A;  2J0A A;  2AGD A;  4G3S A;  2XMH A;  1G9R A;  2YES A;  1LVW A;  1R81 A;  4HCQ A;  5C47 A;  1NF5 B;  2AE7 A;  1HJJ A;  2PGY A;  1EZI A;  2VK9 A;  3OH2 A;  1ZCT A;  1ZCU A;  4KC1 A;  4C2S A;  3OKR A;  1H7E A;  4DEC A;  3V91 A;  1G3L A;  4FRM A;  2Q4J A;  1FZW A;  1KWS A;  2OI6 A;  2RIY A;  5CMI A;  3I0L A;  1ZCY A;  1ZIZ A;  1GA8 A;  4HO4 A;  2V0J A;  3USQ A;  3OH0 A;  5CQP A;  1H4E A;  1W77 A;  1NHE B;  3DK5 A;  3JUJ A;  5EIY A;  2JCO A;  2GGQ A;  1PZT A;  4B42 A;  4AYL A;  4EEA A;  1W57 A;  2RIX A;  2O1F A;  3CKN A;  5CQO A;  3Q7U A;  1VPA A;  1NKH B;  2VD4 A;  4FQW A;  4EE5 A;  3O3P A;  1G0R A;  1H5S B;  2RJ1 A;  2E3D A;  3V0Q A;  2Y4J A;  4B4B A;  1H7G A;  5D91 A;  1R7X A;  1K4V A;  4JIS A;  3SXG A;  1OQM B;  4FIX A;  1TVY A;  4KNR A;  4G3Q A;  3R3I A;  4B4G A;  1VIC A;  1FO8 A;  2Z87 A;  1S4O A;  4FRE A;  1JYL A;  1ZJ0 A;  1LZ7 A;  3ZLK A;  2PA4 A;  4FRL A;  3QVB A;  1XHB A;  4D0T A;  2XWM A;  5C4E A;  3POL A;  1FGX A;  4KQL A;  1ZI1 A;  2ICX A;  3R2W A;  1Z90 A;  4Q7C A;  3I0D A;  2CU2 A;  1HV9 A;  4ASY A;  5CQM X;  1ZJ3 A;  4FCE A;  4NAL A;  4KC2 A;  2C0N A;  5C3D A;  1H5R B;  2WAW A;  1VH3 A;  3K8D A;  4G3P A;  2Z86 A;  1TW5 A;  2VXL A;  5AJP A;  3OH4 A;  3PNN A;  3D8V A;  3SXB A;  2AM4 A;  4FRD A;  4NAI A;  2Y4M A;  2MZB A;  1WT1 A;  1H4C A;  5FTV A;  1H5S A;  2RJ4 A;  1VZX A;  1VGT A;  3V8Y A;  2I5E A;  1FR9 A;  2V0K A;  4HG6 A;  1R7T A;  1E5K A;  2J0B A;  3BCV A;  2D0J A;  2OEG A;  2YCM A;  4P00 A;  1G95 A;  1NQI B;  1G23 A;  5I1F A;  1GQ9 A;  4DDZ A;  1G97 A;  1R82 A;  3ZF8 A;  3HL3 A;  3V0P A;  4Y6N A;  4AC3 A;  3I0J A;  1O23 B;  1R80 A;  3SX5 A;  4CVH A;  1H7H A;  1W55 A;  1FRW A;  2X65 A;  1YP4 A;  4YS8 A;  4CJB A;  4Y64 A;  2ZU8 A;  3PKQ A;  5FU0 A;  4ASJ A;  4D11 A;  1HM8 A;  3U2V A;  4Y63 A;  3DUV A;  4FCU A;  2BO8 A;  4KPZ A;  5C36 A;  3U0X A;  4KT7 A;  4GBP A;  1H5R A;  2BO7 A;  5IDS A;  3SX3 A;  1ZJP A;  2RJ8 A;  3IOI A;  3I0K A;  3ZGG A;  4KRV A;  5C48 A;  1JVG A;  5AJN A;  1NWG B;  2WVM A;  3OH1 A;  4UEG A;  1TZF A;  3CU0 A;  2WVL A;  1H7F A;  1INI A;  2YQS A;  2VS5 A;  4LW6 A;  3SX8 A;  4IRP A;  1WT3 A;  1WT2 A;  1FG5 N;  4KNX A;  4CJ8 A;  3USR A;  1G93 A;  1G8O A;  1QWJ A;  5DDV A;  2ZU7 A;  1XZ6 A;  3IOJ A;  4AAW A;  1JV1 A;  3CKV A;  5FV9 A;  2A8U A;  4FRB A;  3KIA A;  5C3B A;  4B2X A;  4O6M A;  2VSH A;  1I52 A;  4HO5 A;  4R7P A;  2P6W A;  1JYK A;  1JVD A;  4CJC A;  2AES A;  4Y7V A;  2Y4L A;  3CKQ A;  2AM3 A;  1PZY B;  2VFZ A;  3TZT A;  3OH3 A;  3TQD A;  1HM9 A;  4ARW A;  4D0Z A;  1VM8 A;  2XWN A;  1FR8 A;  3V0L A;  1V84 A;  4NAN A;  1WSZ A;  5JQQ A;  2DPW A;  2V0I A;  2GGO A;  5CMH A;  3U2T A;  5C49 A;  4JD0 A;  2YC3 A;  5IFY A;  4M2B A;  1WVC A;  3V0M A;  5EJ1 A;  2NXV A;  1GWV A;  1H7T A;  2BO4 A;  2P72 A;  4KXO A;  2O1G A;  3RSB A;  1R7V A;  3FWW A;  4Y9X A;  3ST8 A;  3I0E A;  1O7O A;  2OI7 A;  3SXA A;  1H5S C;  1H7Q A;  2YQJ A;  2RIZ A;  2RJ9 A;  3N9W A;  4FRA A;  1GWW A;  1S4N A;  1MC3 A;  1VGU A;  2APC A;  3E25 A;  1FOA A;  2YC5 A;  3OC9 A;  3SPT A;  5AJO A;  3JTJ A;  2RJ6 A;  3SXE A;  2PGV A;  1GX4 A;  2RJ0 A;  5CQL X;  1ZI4 A;  2BO6 A;  3CGX A;  1NMM B;  1O0R A;  2VS3 A;  4M4K A;  4FRH A;  2I5K A;  5EJZ A;  3T7O A;  2WE9 A;  2X5S A;  1QG8 A;  1ZI3 A;  2VSI A;  4ZDQ A;  3U2X A;  3NGW A;  2WEE A;  2JCK A;  4IRQ A;  2VXM A;  4EE3 A;  5CQN X;  4D11 C;  2JCL A;  4O6N A;  3BRK X;  3T7N A;  3I0F A;  5L6V A;  1HM0 A;  2OI5 A;  4P02 A;  3ZLL A;  4B4M A;  5C4F A;  3Q4S A;  4KC4 A;  1LZI A;  1SS9 A;  5CMJ A;  4Y7F A;  1LZ0 A;  4Y7G A;  3V0N A;  4EEO A;  1MP4 A;  2PX7 A;  2AEC A;  2RJ7 A;  1H5S D;  4MIX A;  3U2W A;  1V83 A;  1VGZ A; 
#chains in the Genus database with same CATH homology
 1HJL A;  2QKX A;  2WGZ A;  4Y62 A;  2XME A;  2O1H A;  3OGZ A;  2D7I A;  3U2U A;  2UX8 A;  4EVW A;  4M28 A;  2AM5 A;  1LZJ A;  2YQC A;  2V0L A;  1GX0 A;  4EEM A;  4DE7 A;  4HOC A;  2X60 A;  3F1C A;  4ECM A;  2Y7A A;  4HO6 A;  1H4D A;  1MP3 A;  2FFU A;  5C4D A;  2WVK A;  2QH5 A;  3IOH A;  1ZJ2 A;  3V8Z A;  1ON8 A;  3T7M A;  2FYD B;  2YQH A;  3Q80 A;  5FU8 A;  3F1Y A;  2FFV A;  4EEG A;  1OMZ A;  3RMW A;  1MP5 A;  1VH1 A;  1G1L A;  5C1H A;  1GQC A;  4M2A A;  1FWY A;  5FYE A;  1G2V A;  4LW3 A;  1LL2 A;  5D92 A;  3E26 A;  5C4B A;  3GUE A;  4E1K A;  2QGI A;  1R7U A;  3I0C A;  1H5T B;  3ZGF A;  3I0I X;  2W0W A;  3DJ4 A;  4K6R A;  1ZHJ A;  5DDT A;  4FIY A;  1ZI5 A;  1VZT A;  5C4C A;  2E8B A;  3K8E A;  2RIT A;  4NAK A;  4FRQ A;  4J18 A;  1ZDF A;  4KPX A;  3D5N A;  2VS4 A;  2X5Z A;  4HO2 A;  1QGS A;  5IDT A;  3EE5 A;  5J49 A;  1IIM A;  4HO8 A;  2OEF A;  1FXJ A;  2AH9 A;  2V0H A;  4Y7T A;  3LW6 A;  3OAM A;  2JCJ A;  3RMV A;  4B3U A;  1H3M A;  1FGG A;  2P73 A;  1ZCV A;  1ZJ1 A;  1YRO B;  1IIN A;  2FYC B;  4FRO A;  5FUH A;  4B5B A;  4D48 A;  3CKJ A;  5HS2 A;  5C38 A;  1H7L A;  5L6S A;  5C1L A;  1OMX A;  2FYA A;  2I7B A;  3CKO A;  5BXC A;  1ZDG A;  2A8W A;  4HO9 A;  4BMA A;  3I0H A;  1LL3 A;  4FRP A;  3SX7 A;  1YP3 A;  1VGW A;  5C3A A;  4G87 A;  4HO0 A;  3SXD A;  1YP2 A;  4EE4 A;  4BQH A;  2FY7 A;  1JV3 A;  2ZU9 A;  2Y4K A;  1V82 A;  4Y6U A;  1H5T A;  4AYJ A;  1INJ A;  4L41 C;  1EYR A;  2D7R A;  1LL0 A;  1FXO A;  3V90 A;  4MYB A;  1O7Q A;  1ZJO A;  1TW1 A;  2FYB A;  2RJ5 A;  5C1G A;  2W0V A;  2XWL A;  3D98 A;  4Y7U A;  1QGQ A;  5C8R A;  1WT0 A;  2Y6P A;  5CMF X;  4XWI A;  1VZU A;  3V0O A;  3JUK A;  3SXC A;  3PKP A;  5FTS A;  4B2W A;  1ON6 A;  1FO9 A;  1S4P A;  2ICY A;  4MND A;  5CMG X;  4HO3 A;  3U0Y A;  3I0G A;  3FOQ A;  1R7Y A;  2J0A A;  2AGD A;  4G3S A;  2XMH A;  1G9R A;  2YES A;  1LVW A;  1R81 A;  4HCQ A;  5C47 A;  1NF5 B;  2AE7 A;  1HJJ A;  2PGY A;  1EZI A;  2VK9 A;  3OH2 A;  1ZCT A;  1ZCU A;  4KC1 A;  4C2S A;  3OKR A;  1H7E A;  4DEC A;  3V91 A;  1G3L A;  4FRM A;  2Q4J A;  1FZW A;  1KWS A;  2OI6 A;  2RIY A;  5CMI A;  3I0L A;  1ZCY A;  1ZIZ A;  1GA8 A;  4HO4 A;  2V0J A;  3USQ A;  3OH0 A;  5CQP A;  1H4E A;  1W77 A;  1NHE B;  3DK5 A;  3JUJ A;  5EIY A;  2JCO A;  2GGQ A;  1PZT A;  4B42 A;  4AYL A;  4EEA A;  1W57 A;  2RIX A;  2O1F A;  3CKN A;  5CQO A;  3Q7U A;  1VPA A;  1NKH B;  2VD4 A;  4FQW A;  4EE5 A;  3O3P A;  1G0R A;  1H5S B;  2RJ1 A;  2E3D A;  3V0Q A;  2Y4J A;  4B4B A;  1H7G A;  5D91 A;  1R7X A;  1K4V A;  4JIS A;  3SXG A;  1OQM B;  4FIX A;  1TVY A;  4KNR A;  4G3Q A;  3R3I A;  4B4G A;  1VIC A;  1FO8 A;  2Z87 A;  1S4O A;  4FRE A;  1JYL A;  1ZJ0 A;  1LZ7 A;  3ZLK A;  2PA4 A;  4FRL A;  3QVB A;  1XHB A;  4D0T A;  2XWM A;  5C4E A;  3POL A;  1FGX A;  4KQL A;  1ZI1 A;  2ICX A;  3R2W A;  1Z90 A;  4Q7C A;  3I0D A;  2CU2 A;  1HV9 A;  4ASY A;  5CQM X;  1ZJ3 A;  4FCE A;  4NAL A;  4KC2 A;  2C0N A;  5C3D A;  1H5R B;  2WAW A;  1VH3 A;  3K8D A;  4G3P A;  2Z86 A;  1TW5 A;  2VXL A;  5AJP A;  3OH4 A;  3PNN A;  3D8V A;  3SXB A;  2AM4 A;  4FRD A;  4NAI A;  2Y4M A;  2MZB A;  1WT1 A;  1H4C A;  5FTV A;  1H5S A;  2RJ4 A;  1VZX A;  1VGT A;  3V8Y A;  2I5E A;  1FR9 A;  2V0K A;  4HG6 A;  1R7T A;  1E5K A;  2J0B A;  3BCV A;  2D0J A;  2OEG A;  2YCM A;  4P00 A;  1G95 A;  1NQI B;  1G23 A;  5I1F A;  1GQ9 A;  4DDZ A;  1G97 A;  1R82 A;  3ZF8 A;  3HL3 A;  3V0P A;  4Y6N A;  4AC3 A;  3I0J A;  1O23 B;  1R80 A;  3SX5 A;  4CVH A;  1H7H A;  1W55 A;  1FRW A;  2X65 A;  1YP4 A;  4YS8 A;  4CJB A;  4Y64 A;  2ZU8 A;  3PKQ A;  5FU0 A;  4ASJ A;  4D11 A;  1HM8 A;  3U2V A;  4Y63 A;  3DUV A;  4FCU A;  2BO8 A;  4KPZ A;  5C36 A;  3U0X A;  4KT7 A;  4GBP A;  1H5R A;  2BO7 A;  5IDS A;  3SX3 A;  1ZJP A;  2RJ8 A;  3IOI A;  3I0K A;  3ZGG A;  4KRV A;  5C48 A;  1JVG A;  5AJN A;  1NWG B;  2WVM A;  3OH1 A;  4UEG A;  1TZF A;  3CU0 A;  2WVL A;  1H7F A;  1INI A;  2YQS A;  2VS5 A;  4LW6 A;  3SX8 A;  4IRP A;  1WT3 A;  1WT2 A;  1FG5 N;  4KNX A;  4CJ8 A;  3USR A;  1G93 A;  1G8O A;  1QWJ A;  5DDV A;  2ZU7 A;  1XZ6 A;  3IOJ A;  4AAW A;  1JV1 A;  3CKV A;  5FV9 A;  2A8U A;  4FRB A;  3KIA A;  5C3B A;  4B2X A;  4O6M A;  2VSH A;  1I52 A;  4HO5 A;  4R7P A;  2P6W A;  1JYK A;  1JVD A;  4CJC A;  2AES A;  4Y7V A;  2Y4L A;  3CKQ A;  2AM3 A;  1PZY B;  2VFZ A;  3TZT A;  3OH3 A;  3TQD A;  1HM9 A;  4ARW A;  4D0Z A;  1VM8 A;  2XWN A;  1FR8 A;  3V0L A;  1V84 A;  4NAN A;  1WSZ A;  5JQQ A;  2DPW A;  2V0I A;  2GGO A;  5CMH A;  3U2T A;  5C49 A;  4JD0 A;  2YC3 A;  5IFY A;  4M2B A;  1WVC A;  3V0M A;  5EJ1 A;  2NXV A;  1GWV A;  1H7T A;  2BO4 A;  2P72 A;  4KXO A;  2O1G A;  3RSB A;  1R7V A;  3FWW A;  4Y9X A;  3ST8 A;  3I0E A;  1O7O A;  2OI7 A;  3SXA A;  1H5S C;  1H7Q A;  2YQJ A;  2RIZ A;  2RJ9 A;  3N9W A;  4FRA A;  1GWW A;  1S4N A;  1MC3 A;  1VGU A;  2APC A;  3E25 A;  1FOA A;  2YC5 A;  3OC9 A;  3SPT A;  5AJO A;  3JTJ A;  2RJ6 A;  3SXE A;  2PGV A;  1GX4 A;  2RJ0 A;  5CQL X;  1ZI4 A;  2BO6 A;  3CGX A;  1NMM B;  1O0R A;  2VS3 A;  4M4K A;  4FRH A;  2I5K A;  5EJZ A;  3T7O A;  2WE9 A;  2X5S A;  1QG8 A;  1ZI3 A;  2VSI A;  4ZDQ A;  3U2X A;  3NGW A;  2WEE A;  2JCK A;  4IRQ A;  2VXM A;  4EE3 A;  5CQN X;  4D11 C;  2JCL A;  4O6N A;  3BRK X;  3T7N A;  3I0F A;  5L6V A;  1HM0 A;  2OI5 A;  4P02 A;  3ZLL A;  4B4M A;  5C4F A;  3Q4S A;  4KC4 A;  1LZI A;  1SS9 A;  5CMJ A;  4Y7F A;  1LZ0 A;  4Y7G A;  3V0N A;  4EEO A;  1MP4 A;  2PX7 A;  2AEC A;  2RJ7 A;  1H5S D;  4MIX A;  3U2W A;  1V83 A;  1VGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...