5C49A

Crystal structure of gtb + udp-c-gal + h-antigen
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
285
structure length
277
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGVSMRRMEMISFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histo-blood group ABO system transferase
publication title High Resolution Structures of the Human ABO(H) Blood Group Enzymes in Complex with Donor Analogs Reveal That the Enzymes Utilize Multiple Donor Conformations to Bind Substrates in a Stepwise Manner.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 277
sequence length 285
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2015-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5c49A00
4FRDA 3V0NA 2VS4A 4YS8A 1INIA 1FWYA 1VZUA 2VXMA 1H4EA 2YQHA 3I0FA 1ZCUA 2X60A 3SX8A 2P72A 4J18A 1H5SD 1VGWA 2BO6A 4CJ8A 1NQIB 2RITA 1IINA 2JCJA 5C3BA 3FOQA 1H5RB 1WSZA 5BXCA 4L41C 1ZDFA 1XZ6A 1G23A 4EEAA 5AJNA 1H4CA 1GWVA 4B2WA 1H4DA 2XMEA 2RIXA 1R7TA 2AECA 4KQLA 5DDVA 5IDSA 3RMWA 4M28A 2X65A 1MC3A 2D7RA 1VZTA 4B4BA 1H5TA 3HL3A 1G93A 1FRWA 1NF5B 1ON8A 1G9RA 1GA8A 2YCMA 2E3DA 1FZWA 1WVCA 3OAMA 2AM3A 5I1FA 5L6SA 1R80A 4KC1A 1GWWA 2QKXA 5CMGX 4KXOA 3U2XA 2Z86A 4FQWA 5CQMX 2JCKA 1ZJ2A 4D48A 4M2AA 4GBPA 4IRPA 4NANA 2FY7A 2WAWA 2V0JA 2W0VA 3OH1A 4B5BA 3OGZA 4NAKA 3V0OA 1H5RA 1VGZA 2V0KA 5C47A 1LL0A 1FO9A 1LZ7A 5C3AA 4G3PA 4HO2A 1VGUA 1VM8A 4FCEA 4KNRA 3CKVA 2WGZA 3T7MA 2WVLA 3E26A 4NALA 4AYLA 1V83A 3SXAA 5C3DA 1WT0A 5IFYA 3TZTA 1EZIA 1WT1A 4UEGA 3D98A 2FYCB 2RJ1A 5CQNX 3I0HA 5FU0A 2A8WA 3TQDA 5AJOA 1H7EA 4EE3A 4DDZA 1ZJ1A 4FROA 3OC9A 3JTJA 3V0QA 4D0TA 3V0MA 1G3LA 1O7OA 2W0WA 2YQCA 1MP5A 4FCUA 1H7FA 1KWSA 4IRQA 4Y6NA 2BO4A 2AH9A 3U2TA 1LZJA 4DECA 2QH5A 1R81A 1WT3A 1LZIA 1OMZA 4EEOA 1JYLA 5EJ1A 1LVWA 1FR9A 3V91A 2OI5A 4KNXA 5C36A 2YC5A 2VS3A 2VFZA 3R2WA 3POLA 2X5ZA 1VGTA 3SXCA 3U2VA 2YQSA 2V0HA 2Q4JA 3V8YA 1ZJ0A 1E5KA 2PGVA 3CKOA 3USQA 2RIZA 4LW6A 5AJPA 2ZU7A 1O7QA 4Y7GA 1HJLA 1GQCA 1H5SC 1FOAA 1JVGA 2PX7A 2YESA 2Y4KA 3BCVA 1ZCVA 3O3PA 1OMXA 1SS9A 2E8BA 5C48A 4KPXA 3QVBA 3ZLLA 2NXVA 2RIYA 3ZLKA 2YQJA 3DJ4A 4ASYA 1FXOA 3RSBA 1Z90A 4MYBA 1GX4A 3I0JA 2RJ4A 1W77A 1MP4A 2RJ7A 2OI7A 1PZYB 1O0RA 1ZDGA 5C49A 5IDTA 5FUHA 1ZIZA 2XMHA 4HO9A 5EJZA 3IOIA 4G87A 2V0LA 4CVHA 3I0GA 1G1LA 3JUKA 5C4DA 1H7HA 2VS5A 3SPTA 3BRKX 1GQ9A 3Q7UA 1ZHJA 2RJ5A 1FGGA 1VZXA 2ZU8A 1INJA 5C4BA 4FRMA 1YROB 2ZU9A 3SX7A 4M4KA 5C8RA 2BO8A 1VPAA 4EE5A 1ZI1A 1QWJA 3F1YA 3T7OA 1HM8A 4KT7A 4BMAA 2VXLA 2FFUA 3PKQA 4AYJA 3IOHA 4Y7UA 3CU0A 4MNDA 4CJCA 3U2UA 1ZCTA 5C38A 1HJJA 2AM4A 4FREA 1V84A 3OH3A 3KIAA 4XWIA 5C4CA 2Z87A 2WVMA 3ZF8A 2FYAA 1VH1A 4KPZA 1H7GA 5C4EA 3OH2A 5FYEA 3T7NA 2PGYA 1FGXA 2YC3A 2WVKA 1HM0A 4E1KA 1H7TA 4D11A 2QGIA 1WT2A 3I0EA 3R3IA 5DDTA 2D0JA 1ON6A 5L6VA 3PKPA 2VD4A 4B4GA 1FG5N 2RJ9A 5CMHA 1JYKA 4JD0A 3SXBA 3RMVA 4EE4A 2VSIA 3Q4SA 1JV3A 5FV9A 3F1CA 1G0RA 4HO5A 3CGXA 2CU2A 2Y6PA 5CQOA 2P6WA 1S4NA 3V0LA 3V0PA 3PNNA 3I0IX 2AE7A 3IOJA 4CJBA 1JV1A 1R7XA 1YP2A 1ZI4A 1ZJ3A 3I0CA 3I0LA 1VICA 4ASJA 2OEGA 1YP3A 4FRBA 4FRQA 2ICYA 2BO7A 3V8ZA 2Y4LA 4LW3A 1H5SA 1TVYA 4HO3A 3D8VA 2VSHA 3EE5A 2GGQA 2GGOA 4ECMA 5CMIA 5JQQA 4AAWA 3ST8A 4M2BA 3OKRA 1QG8A 3U2WA 4HO4A 2A8UA 4ZDQA 2WE9A 2WEEA 4FRHA 3Q80A 4NAIA 1IIMA 4AC3A 4Y62A 1H7QA 1G97A 1ZJOA 1QGQA 1FO8A 2Y4MA 2XWLA 3U0YA 3GUEA 4ARWA 3LW6A 4EVWA 1G2VA 4KC4A 5CQLX 1ZI5A 2I7BA 2Y4JA 5C1LA 1TW1A 2P73A 4HO6A 1TW5A 3U0XA 4FRAA 3CKNA 4Y63A 1K4VA 2OI6A 1NKHB 4P00A 4EEGA 1QGSA 1FR8A 5C1HA 4Y9XA 2AM5A 1LL2A 4Y7TA 2RJ0A 2OEFA 1H3MA 2UX8A 2MZBA 5CMFX 5C4FA 3SXDA 4HCQA 1LL3A 2AESA 2JCOA 1R7UA 4B42A 1HV9A 3E25A 2O1HA 3K8DA 3D5NA 5EIYA 3DK5A 1TZFA 1H7LA 1I52A 5CMJA 2FYDB 1ZI3A 2D7IA 2RJ6A 3ZGFA 2O1FA 5FTSA 3I0KA 1LZ0A 4HOCA 4FRPA 1H5SB 1W57A 1R7YA 4G3QA 1W55A 3JUJA 1ZCYA 1JVDA 4B2XA 2JCLA 1XHBA 2AGDA 3OH4A 2APCA 4Y7VA 2FYBA 5FU8A 3USRA 2I5KA 4Y64A 1VH3A 4EEMA 3CKQA 1V82A 1R7VA 4DE7A 2X5SA 4BQHA 2PA4A 4P02A 1FXJA 2XWMA 3SX3A 3V90A 2V0IA 1EYRA 5J49A 4B4MA 1R82A 1S4OA 2Y7AA 1O23B 1NMMB 3CKJA 3K8EA 2ICXA 4D11C 3I0DA 3SXGA 3OH0A 1HM9A 3SXEA 2DPWA 4D0ZA 1PZTA 4FRLA 4KRVA 5CQPA 5C1GA 4B3UA 1G8OA 3N9WA 4HG6A 3ZGGA 4KC2A 3NGWA 2RJ8A 1NHEB 2FFVA 1NWGB 3FWWA 2O1GA 1G95A 5FTVA 3SX5A 1OQMB 1H5TB 4Y7FA 4HO8A 4Y6UA 4HO0A 1YP4A 4JISA 4G3SA 5HS2A 4R7PA 2I5EA 1S4PA 4K6RA 2XWNA 1MP3A 4C2SA 1GX0A 3DUVA 1ZJPA
chains in the Genus database with same CATH superfamily
4FRDA 3V0NA 2VS4A 4YS8A 1INIA 1FWYA 1VZUA 2VXMA 1H4EA 2YQHA 3I0FA 1ZCUA 2X60A 3SX8A 2P72A 4J18A 1H5SD 1VGWA 2BO6A 4CJ8A 1NQIB 2RITA 1IINA 2JCJA 5C3BA 3FOQA 1H5RB 1WSZA 5BXCA 4L41C 1ZDFA 1XZ6A 1G23A 4EEAA 5AJNA 1H4CA 1GWVA 4B2WA 1H4DA 2XMEA 2RIXA 1R7TA 2AECA 4KQLA 5DDVA 5IDSA 3RMWA 4M28A 2X65A 1MC3A 2D7RA 1VZTA 4B4BA 1H5TA 3HL3A 1G93A 1FRWA 5D92A 1NF5B 1ON8A 1G9RA 1GA8A 2YCMA 2E3DA 1FZWA 1WVCA 3OAMA 4Q7CA 2AM3A 5I1FA 5L6SA 1R80A 4KC1A 1GWWA 2QKXA 5CMGX 4KXOA 3U2XA 2Z86A 4FQWA 5CQMX 2JCKA 1ZJ2A 4D48A 4M2AA 4GBPA 4IRPA 4NANA 2FY7A 2WAWA 2V0JA 2W0VA 3OH1A 4B5BA 3OGZA 4NAKA 3V0OA 1H5RA 1VGZA 2V0KA 5C47A 1LL0A 1FO9A 1LZ7A 5C3AA 4G3PA 4HO2A 1VGUA 1VM8A 4FCEA 4KNRA 3CKVA 2WGZA 3T7MA 2WVLA 3E26A 4NALA 4AYLA 1V83A 3SXAA 5C3DA 1WT0A 5IFYA 3TZTA 1EZIA 1WT1A 4UEGA 3D98A 2FYCB 2RJ1A 5CQNX 3I0HA 5FU0A 2A8WA 3TQDA 5AJOA 1H7EA 4EE3A 4DDZA 1ZJ1A 4FROA 3OC9A 2J0AA 3JTJA 3V0QA 4D0TA 3V0MA 1G3LA 1O7OA 2W0WA 2YQCA 1MP5A 4FCUA 1H7FA 1KWSA 4IRQA 4Y6NA 2BO4A 2AH9A 3U2TA 1LZJA 4DECA 2QH5A 1R81A 1WT3A 1LZIA 1OMZA 4EEOA 1JYLA 5EJ1A 1LVWA 1FR9A 3V91A 2OI5A 4KNXA 5C36A 2YC5A 2VS3A 2VFZA 3R2WA 3POLA 2X5ZA 1VGTA 3SXCA 3U2VA 2YQSA 2V0HA 2Q4JA 3V8YA 1ZJ0A 1E5KA 2PGVA 3CKOA 3USQA 2RIZA 4LW6A 5AJPA 2ZU7A 1O7QA 4Y7GA 1HJLA 1GQCA 1H5SC 1FOAA 1JVGA 2PX7A 2J0BA 2YESA 2Y4KA 3BCVA 1ZCVA 3O3PA 1OMXA 1SS9A 2C0NA 2E8BA 4MIXA 5C48A 4KPXA 3QVBA 3ZLLA 2NXVA 2RIYA 3ZLKA 2YQJA 3DJ4A 4ASYA 1FXOA 3RSBA 1Z90A 4MYBA 1GX4A 3I0JA 2RJ4A 1W77A 1MP4A 2RJ7A 2OI7A 1PZYB 1O0RA 1ZDGA 5C49A 5IDTA 5FUHA 1ZIZA 2XMHA 4HO9A 5EJZA 3IOIA 4G87A 2V0LA 4CVHA 3I0GA 1G1LA 3JUKA 5C4DA 1H7HA 2VS5A 4FIXA 3SPTA 3BRKX 1GQ9A 3Q7UA 1ZHJA 2RJ5A 1FGGA 1VZXA 2ZU8A 1INJA 5C4BA 4FRMA 1YROB 2ZU9A 3SX7A 4M4KA 5C8RA 2BO8A 1VPAA 4EE5A 1ZI1A 1QWJA 4O6MA 3F1YA 3T7OA 1HM8A 4KT7A 4BMAA 2VXLA 2FFUA 3PKQA 4AYJA 3IOHA 4Y7UA 3CU0A 4MNDA 4CJCA 3U2UA 1ZCTA 5C38A 1HJJA 2AM4A 4FREA 1V84A 3OH3A 3KIAA 4XWIA 5C4CA 2Z87A 2WVMA 3ZF8A 2FYAA 1VH1A 4KPZA 1H7GA 5C4EA 3OH2A 5FYEA 3T7NA 2PGYA 1FGXA 2YC3A 2WVKA 1HM0A 4E1KA 1H7TA 4D11A 2QGIA 1WT2A 3I0EA 3R3IA 5DDTA 2D0JA 1ON6A 5L6VA 3PKPA 2VD4A 4B4GA 1FG5N 2RJ9A 5CMHA 1JYKA 4JD0A 3SXBA 3RMVA 4EE4A 2VSIA 3Q4SA 1JV3A 5FV9A 3F1CA 1G0RA 4HO5A 3CGXA 2CU2A 2Y6PA 5CQOA 2P6WA 1S4NA 3V0LA 3V0PA 3PNNA 3I0IX 2AE7A 3IOJA 4CJBA 1JV1A 1R7XA 1YP2A 1ZI4A 1ZJ3A 3I0CA 3I0LA 5D91A 1VICA 4ASJA 2OEGA 1YP3A 4FRBA 4FRQA 2ICYA 2BO7A 3V8ZA 2Y4LA 4LW3A 1H5SA 1TVYA 4HO3A 3D8VA 2VSHA 3EE5A 2GGQA 2GGOA 4ECMA 5CMIA 5JQQA 4AAWA 3ST8A 4M2BA 3OKRA 1QG8A 3U2WA 4HO4A 2A8UA 4ZDQA 2WE9A 2WEEA 4FRHA 3Q80A 4NAIA 1IIMA 4AC3A 4Y62A 1H7QA 1G97A 1ZJOA 1QGQA 1FO8A 2Y4MA 2XWLA 3U0YA 3GUEA 4ARWA 3LW6A 4EVWA 1G2VA 4KC4A 5CQLX 1ZI5A 2I7BA 2Y4JA 5C1LA 1TW1A 2P73A 4HO6A 1TW5A 3U0XA 4FRAA 3CKNA 2VK9A 4Y63A 1K4VA 2OI6A 1NKHB 4P00A 4EEGA 1QGSA 1FR8A 5C1HA 4Y9XA 2AM5A 1LL2A 4Y7TA 2RJ0A 2OEFA 1H3MA 2UX8A 2MZBA 5CMFX 5C4FA 3SXDA 4HCQA 1LL3A 2AESA 2JCOA 1R7UA 4B42A 1HV9A 3E25A 2O1HA 3K8DA 3D5NA 5EIYA 3DK5A 1TZFA 1H7LA 1I52A 5CMJA 2FYDB 1ZI3A 2D7IA 2RJ6A 3ZGFA 2O1FA 5FTSA 3I0KA 1LZ0A 4HOCA 4FRPA 1H5SB 1W57A 1R7YA 4G3QA 1W55A 3JUJA 1ZCYA 1JVDA 4B2XA 2JCLA 1XHBA 2AGDA 3OH4A 2APCA 4Y7VA 2FYBA 5FU8A 3USRA 2I5KA 4Y64A 1VH3A 4EEMA 3CKQA 1V82A 1R7VA 4DE7A 2X5SA 4BQHA 2PA4A 4P02A 1FXJA 2XWMA 3SX3A 3V90A 2V0IA 1EYRA 5J49A 4B4MA 1R82A 1S4OA 2Y7AA 1O23B 1NMMB 3CKJA 3K8EA 2ICXA 4D11C 3I0DA 3SXGA 3OH0A 1HM9A 3SXEA 2DPWA 4D0ZA 1PZTA 4FRLA 4KRVA 5CQPA 5C1GA 4FIYA 4B3UA 1G8OA 3N9WA 4HG6A 3ZGGA 4KC2A 3NGWA 2RJ8A 4O6NA 1NHEB 2FFVA 1NWGB 3FWWA 2O1GA 1G95A 5FTVA 3SX5A 1OQMB 1H5TB 4Y7FA 4HO8A 4Y6UA 4HO0A 1YP4A 4JISA 4G3SA 5HS2A 4R7PA 2I5EA 1S4PA 4K6RA 2XWNA 1MP3A 4C2SA 1GX0A 3DUVA 1ZJPA
chains in the Genus database with same CATH topology
4FRDA 3V0NA 2VS4A 4YS8A 1INIA 1FWYA 1VZUA 2VXMA 1H4EA 2YQHA 3I0FA 1ZCUA 2X60A 3SX8A 2P72A 4J18A 1H5SD 1VGWA 2BO6A 4CJ8A 1NQIB 2RITA 1IINA 2JCJA 5C3BA 3FOQA 1H5RB 1WSZA 5BXCA 4L41C 1ZDFA 1XZ6A 1G23A 4EEAA 5AJNA 1H4CA 1GWVA 4B2WA 1H4DA 2XMEA 2RIXA 1R7TA 2AECA 4KQLA 5DDVA 5IDSA 3RMWA 4M28A 2X65A 1MC3A 2D7RA 1VZTA 4B4BA 1H5TA 3HL3A 1G93A 1FRWA 5D92A 1NF5B 1ON8A 1G9RA 1GA8A 2YCMA 2E3DA 1FZWA 1WVCA 3OAMA 4Q7CA 2AM3A 5I1FA 5L6SA 1R80A 4KC1A 1GWWA 2QKXA 5CMGX 4KXOA 3U2XA 2Z86A 4FQWA 5CQMX 2JCKA 1ZJ2A 4D48A 4M2AA 4GBPA 4IRPA 4NANA 2FY7A 2WAWA 2V0JA 2W0VA 3OH1A 4B5BA 3OGZA 4NAKA 3V0OA 1H5RA 1VGZA 2V0KA 5C47A 1LL0A 1FO9A 1LZ7A 5C3AA 4G3PA 4HO2A 1VGUA 1VM8A 4FCEA 4KNRA 3CKVA 2WGZA 3T7MA 2WVLA 3E26A 4NALA 4AYLA 1V83A 3SXAA 5C3DA 1WT0A 5IFYA 3TZTA 1EZIA 1WT1A 4UEGA 3D98A 2FYCB 2RJ1A 5CQNX 3I0HA 5FU0A 2A8WA 3TQDA 5AJOA 1H7EA 4EE3A 4DDZA 1ZJ1A 4FROA 3OC9A 2J0AA 3JTJA 3V0QA 4D0TA 3V0MA 1G3LA 1O7OA 2W0WA 2YQCA 1MP5A 4FCUA 1H7FA 1KWSA 4IRQA 4Y6NA 2BO4A 2AH9A 3U2TA 1LZJA 4DECA 2QH5A 1R81A 1WT3A 1LZIA 1OMZA 4EEOA 1JYLA 5EJ1A 1LVWA 1FR9A 3V91A 2OI5A 4KNXA 5C36A 2YC5A 2VS3A 2VFZA 3R2WA 3POLA 2X5ZA 1VGTA 3SXCA 3U2VA 2YQSA 2V0HA 2Q4JA 3V8YA 1ZJ0A 1E5KA 2PGVA 3CKOA 3USQA 2RIZA 4LW6A 5AJPA 2ZU7A 1O7QA 4Y7GA 1HJLA 1GQCA 1H5SC 1FOAA 1JVGA 2PX7A 2J0BA 2YESA 2Y4KA 3BCVA 1ZCVA 3O3PA 1OMXA 1SS9A 2C0NA 2E8BA 4MIXA 5C48A 4KPXA 3QVBA 3ZLLA 2NXVA 2RIYA 3ZLKA 2YQJA 3DJ4A 4ASYA 1FXOA 3RSBA 1Z90A 4MYBA 1GX4A 3I0JA 2RJ4A 1W77A 1MP4A 2RJ7A 2OI7A 1PZYB 1O0RA 1ZDGA 5C49A 5IDTA 5FUHA 1ZIZA 2XMHA 4HO9A 5EJZA 3IOIA 4G87A 2V0LA 4CVHA 3I0GA 1G1LA 3JUKA 5C4DA 1H7HA 2VS5A 4FIXA 3SPTA 3BRKX 1GQ9A 3Q7UA 1ZHJA 2RJ5A 1FGGA 1VZXA 2ZU8A 1INJA 5C4BA 4FRMA 1YROB 2ZU9A 3SX7A 4M4KA 5C8RA 2BO8A 1VPAA 4EE5A 1ZI1A 1QWJA 4O6MA 3F1YA 3T7OA 1HM8A 4KT7A 4BMAA 2VXLA 2FFUA 3PKQA 4AYJA 3IOHA 4Y7UA 3CU0A 4MNDA 4CJCA 3U2UA 1ZCTA 5C38A 1HJJA 2AM4A 4FREA 1V84A 3OH3A 3KIAA 4XWIA 5C4CA 2Z87A 2WVMA 3ZF8A 2FYAA 1VH1A 4KPZA 1H7GA 5C4EA 3OH2A 5FYEA 3T7NA 2PGYA 1FGXA 2YC3A 2WVKA 1HM0A 4E1KA 1H7TA 4D11A 2QGIA 1WT2A 3I0EA 3R3IA 5DDTA 2D0JA 1ON6A 5L6VA 3PKPA 2VD4A 4B4GA 1FG5N 2RJ9A 5CMHA 1JYKA 4JD0A 3SXBA 3RMVA 4EE4A 2VSIA 3Q4SA 1JV3A 5FV9A 3F1CA 1G0RA 4HO5A 3CGXA 2CU2A 2Y6PA 5CQOA 2P6WA 1S4NA 3V0LA 3V0PA 3PNNA 3I0IX 2AE7A 3IOJA 4CJBA 1JV1A 1R7XA 1YP2A 1ZI4A 1ZJ3A 3I0CA 3I0LA 5D91A 1VICA 4ASJA 2OEGA 1YP3A 4FRBA 4FRQA 2ICYA 2BO7A 3V8ZA 2Y4LA 4LW3A 1H5SA 1TVYA 4HO3A 3D8VA 2VSHA 3EE5A 2GGQA 2GGOA 4ECMA 5CMIA 5JQQA 4AAWA 3ST8A 4M2BA 3OKRA 1QG8A 3U2WA 4HO4A 2A8UA 4ZDQA 2WE9A 2WEEA 4FRHA 3Q80A 4NAIA 1IIMA 4AC3A 4Y62A 1H7QA 1G97A 1ZJOA 1QGQA 1FO8A 2Y4MA 2XWLA 3U0YA 3GUEA 4ARWA 3LW6A 4EVWA 1G2VA 4KC4A 5CQLX 1ZI5A 2I7BA 2Y4JA 5C1LA 1TW1A 2P73A 4HO6A 1TW5A 3U0XA 4FRAA 3CKNA 2VK9A 4Y63A 1K4VA 2OI6A 1NKHB 4P00A 4EEGA 1QGSA 1FR8A 5C1HA 4Y9XA 2AM5A 1LL2A 4Y7TA 2RJ0A 2OEFA 1H3MA 2UX8A 2MZBA 5CMFX 5C4FA 3SXDA 4HCQA 1LL3A 2AESA 2JCOA 1R7UA 4B42A 1HV9A 3E25A 2O1HA 3K8DA 3D5NA 5EIYA 3DK5A 1TZFA 1H7LA 1I52A 5CMJA 2FYDB 1ZI3A 2D7IA 2RJ6A 3ZGFA 2O1FA 5FTSA 3I0KA 1LZ0A 4HOCA 4FRPA 1H5SB 1W57A 1R7YA 4G3QA 1W55A 3JUJA 1ZCYA 1JVDA 4B2XA 2JCLA 1XHBA 2AGDA 3OH4A 2APCA 4Y7VA 2FYBA 5FU8A 3USRA 2I5KA 4Y64A 1VH3A 4EEMA 3CKQA 1V82A 1R7VA 4DE7A 2X5SA 4BQHA 2PA4A 4P02A 1FXJA 2XWMA 3SX3A 3V90A 2V0IA 1EYRA 5J49A 4B4MA 1R82A 1S4OA 2Y7AA 1O23B 1NMMB 3CKJA 3K8EA 2ICXA 4D11C 3I0DA 3SXGA 3OH0A 1HM9A 3SXEA 2DPWA 4D0ZA 1PZTA 4FRLA 4KRVA 5CQPA 5C1GA 4FIYA 4B3UA 1G8OA 3N9WA 4HG6A 3ZGGA 4KC2A 3NGWA 2RJ8A 4O6NA 1NHEB 2FFVA 1NWGB 3FWWA 2O1GA 1G95A 5FTVA 3SX5A 1OQMB 1H5TB 4Y7FA 4HO8A 4Y6UA 4HO0A 1YP4A 4JISA 4G3SA 5HS2A 4R7PA 2I5EA 1S4PA 4K6RA 2XWNA 1MP3A 4C2SA 1GX0A 3DUVA 1ZJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FRD A;  3V0N A;  2VS4 A;  4YS8 A;  1INI A;  1FWY A;  1VZU A;  2VXM A;  1H4E A;  2YQH A;  3I0F A;  1ZCU A;  2X60 A;  3SX8 A;  2P72 A;  4J18 A;  1H5S D;  1VGW A;  2BO6 A;  4CJ8 A;  1NQI B;  2RIT A;  1IIN A;  2JCJ A;  5C3B A;  3FOQ A;  1H5R B;  1WSZ A;  5BXC A;  4L41 C;  1ZDF A;  1XZ6 A;  1G23 A;  4EEA A;  5AJN A;  1H4C A;  1GWV A;  4B2W A;  1H4D A;  2XME A;  2RIX A;  1R7T A;  2AEC A;  4KQL A;  5DDV A;  5IDS A;  3RMW A;  4M28 A;  2X65 A;  1MC3 A;  2D7R A;  1VZT A;  4B4B A;  1H5T A;  3HL3 A;  1G93 A;  1FRW A;  1NF5 B;  1ON8 A;  1G9R A;  1GA8 A;  2YCM A;  2E3D A;  1FZW A;  1WVC A;  3OAM A;  2AM3 A;  5I1F A;  5L6S A;  1R80 A;  4KC1 A;  1GWW A;  2QKX A;  5CMG X;  4KXO A;  3U2X A;  2Z86 A;  4FQW A;  5CQM X;  2JCK A;  1ZJ2 A;  4D48 A;  4M2A A;  4GBP A;  4IRP A;  4NAN A;  2FY7 A;  2WAW A;  2V0J A;  2W0V A;  3OH1 A;  4B5B A;  3OGZ A;  4NAK A;  3V0O A;  1H5R A;  1VGZ A;  2V0K A;  5C47 A;  1LL0 A;  1FO9 A;  1LZ7 A;  5C3A A;  4G3P A;  4HO2 A;  1VGU A;  1VM8 A;  4FCE A;  4KNR A;  3CKV A;  2WGZ A;  3T7M A;  2WVL A;  3E26 A;  4NAL A;  4AYL A;  1V83 A;  3SXA A;  5C3D A;  1WT0 A;  5IFY A;  3TZT A;  1EZI A;  1WT1 A;  4UEG A;  3D98 A;  2FYC B;  2RJ1 A;  5CQN X;  3I0H A;  5FU0 A;  2A8W A;  3TQD A;  5AJO A;  1H7E A;  4EE3 A;  4DDZ A;  1ZJ1 A;  4FRO A;  3OC9 A;  3JTJ A;  3V0Q A;  4D0T A;  3V0M A;  1G3L A;  1O7O A;  2W0W A;  2YQC A;  1MP5 A;  4FCU A;  1H7F A;  1KWS A;  4IRQ A;  4Y6N A;  2BO4 A;  2AH9 A;  3U2T A;  1LZJ A;  4DEC A;  2QH5 A;  1R81 A;  1WT3 A;  1LZI A;  1OMZ A;  4EEO A;  1JYL A;  5EJ1 A;  1LVW A;  1FR9 A;  3V91 A;  2OI5 A;  4KNX A;  5C36 A;  2YC5 A;  2VS3 A;  2VFZ A;  3R2W A;  3POL A;  2X5Z A;  1VGT A;  3SXC A;  3U2V A;  2YQS A;  2V0H A;  2Q4J A;  3V8Y A;  1ZJ0 A;  1E5K A;  2PGV A;  3CKO A;  3USQ A;  2RIZ A;  4LW6 A;  5AJP A;  2ZU7 A;  1O7Q A;  4Y7G A;  1HJL A;  1GQC A;  1H5S C;  1FOA A;  1JVG A;  2PX7 A;  2YES A;  2Y4K A;  3BCV A;  1ZCV A;  3O3P A;  1OMX A;  1SS9 A;  2E8B A;  5C48 A;  4KPX A;  3QVB A;  3ZLL A;  2NXV A;  2RIY A;  3ZLK A;  2YQJ A;  3DJ4 A;  4ASY A;  1FXO A;  3RSB A;  1Z90 A;  4MYB A;  1GX4 A;  3I0J A;  2RJ4 A;  1W77 A;  1MP4 A;  2RJ7 A;  2OI7 A;  1PZY B;  1O0R A;  1ZDG A;  5C49 A;  5IDT A;  5FUH A;  1ZIZ A;  2XMH A;  4HO9 A;  5EJZ A;  3IOI A;  4G87 A;  2V0L A;  4CVH A;  3I0G A;  1G1L A;  3JUK A;  5C4D A;  1H7H A;  2VS5 A;  3SPT A;  3BRK X;  1GQ9 A;  3Q7U A;  1ZHJ A;  2RJ5 A;  1FGG A;  1VZX A;  2ZU8 A;  1INJ A;  5C4B A;  4FRM A;  1YRO B;  2ZU9 A;  3SX7 A;  4M4K A;  5C8R A;  2BO8 A;  1VPA A;  4EE5 A;  1ZI1 A;  1QWJ A;  3F1Y A;  3T7O A;  1HM8 A;  4KT7 A;  4BMA A;  2VXL A;  2FFU A;  3PKQ A;  4AYJ A;  3IOH A;  4Y7U A;  3CU0 A;  4MND A;  4CJC A;  3U2U A;  1ZCT A;  5C38 A;  1HJJ A;  2AM4 A;  4FRE A;  1V84 A;  3OH3 A;  3KIA A;  4XWI A;  5C4C A;  2Z87 A;  2WVM A;  3ZF8 A;  2FYA A;  1VH1 A;  4KPZ A;  1H7G A;  5C4E A;  3OH2 A;  5FYE A;  3T7N A;  2PGY A;  1FGX A;  2YC3 A;  2WVK A;  1HM0 A;  4E1K A;  1H7T A;  4D11 A;  2QGI A;  1WT2 A;  3I0E A;  3R3I A;  5DDT A;  2D0J A;  1ON6 A;  5L6V A;  3PKP A;  2VD4 A;  4B4G A;  1FG5 N;  2RJ9 A;  5CMH A;  1JYK A;  4JD0 A;  3SXB A;  3RMV A;  4EE4 A;  2VSI A;  3Q4S A;  1JV3 A;  5FV9 A;  3F1C A;  1G0R A;  4HO5 A;  3CGX A;  2CU2 A;  2Y6P A;  5CQO A;  2P6W A;  1S4N A;  3V0L A;  3V0P A;  3PNN A;  3I0I X;  2AE7 A;  3IOJ A;  4CJB A;  1JV1 A;  1R7X A;  1YP2 A;  1ZI4 A;  1ZJ3 A;  3I0C A;  3I0L A;  1VIC A;  4ASJ A;  2OEG A;  1YP3 A;  4FRB A;  4FRQ A;  2ICY A;  2BO7 A;  3V8Z A;  2Y4L A;  4LW3 A;  1H5S A;  1TVY A;  4HO3 A;  3D8V A;  2VSH A;  3EE5 A;  2GGQ A;  2GGO A;  4ECM A;  5CMI A;  5JQQ A;  4AAW A;  3ST8 A;  4M2B A;  3OKR A;  1QG8 A;  3U2W A;  4HO4 A;  2A8U A;  4ZDQ A;  2WE9 A;  2WEE A;  4FRH A;  3Q80 A;  4NAI A;  1IIM A;  4AC3 A;  4Y62 A;  1H7Q A;  1G97 A;  1ZJO A;  1QGQ A;  1FO8 A;  2Y4M A;  2XWL A;  3U0Y A;  3GUE A;  4ARW A;  3LW6 A;  4EVW A;  1G2V A;  4KC4 A;  5CQL X;  1ZI5 A;  2I7B A;  2Y4J A;  5C1L A;  1TW1 A;  2P73 A;  4HO6 A;  1TW5 A;  3U0X A;  4FRA A;  3CKN A;  4Y63 A;  1K4V A;  2OI6 A;  1NKH B;  4P00 A;  4EEG A;  1QGS A;  1FR8 A;  5C1H A;  4Y9X A;  2AM5 A;  1LL2 A;  4Y7T A;  2RJ0 A;  2OEF A;  1H3M A;  2UX8 A;  2MZB A;  5CMF X;  5C4F A;  3SXD A;  4HCQ A;  1LL3 A;  2AES A;  2JCO A;  1R7U A;  4B42 A;  1HV9 A;  3E25 A;  2O1H A;  3K8D A;  3D5N A;  5EIY A;  3DK5 A;  1TZF A;  1H7L A;  1I52 A;  5CMJ A;  2FYD B;  1ZI3 A;  2D7I A;  2RJ6 A;  3ZGF A;  2O1F A;  5FTS A;  3I0K A;  1LZ0 A;  4HOC A;  4FRP A;  1H5S B;  1W57 A;  1R7Y A;  4G3Q A;  1W55 A;  3JUJ A;  1ZCY A;  1JVD A;  4B2X A;  2JCL A;  1XHB A;  2AGD A;  3OH4 A;  2APC A;  4Y7V A;  2FYB A;  5FU8 A;  3USR A;  2I5K A;  4Y64 A;  1VH3 A;  4EEM A;  3CKQ A;  1V82 A;  1R7V A;  4DE7 A;  2X5S A;  4BQH A;  2PA4 A;  4P02 A;  1FXJ A;  2XWM A;  3SX3 A;  3V90 A;  2V0I A;  1EYR A;  5J49 A;  4B4M A;  1R82 A;  1S4O A;  2Y7A A;  1O23 B;  1NMM B;  3CKJ A;  3K8E A;  2ICX A;  4D11 C;  3I0D A;  3SXG A;  3OH0 A;  1HM9 A;  3SXE A;  2DPW A;  4D0Z A;  1PZT A;  4FRL A;  4KRV A;  5CQP A;  5C1G A;  4B3U A;  1G8O A;  3N9W A;  4HG6 A;  3ZGG A;  4KC2 A;  3NGW A;  2RJ8 A;  1NHE B;  2FFV A;  1NWG B;  3FWW A;  2O1G A;  1G95 A;  5FTV A;  3SX5 A;  1OQM B;  1H5T B;  4Y7F A;  4HO8 A;  4Y6U A;  4HO0 A;  1YP4 A;  4JIS A;  4G3S A;  5HS2 A;  4R7P A;  2I5E A;  1S4P A;  4K6R A;  2XWN A;  1MP3 A;  4C2S A;  1GX0 A;  3DUV A;  1ZJP A; 
#chains in the Genus database with same CATH topology
 4FRD A;  3V0N A;  2VS4 A;  4YS8 A;  1INI A;  1FWY A;  1VZU A;  2VXM A;  1H4E A;  2YQH A;  3I0F A;  1ZCU A;  2X60 A;  3SX8 A;  2P72 A;  4J18 A;  1H5S D;  1VGW A;  2BO6 A;  4CJ8 A;  1NQI B;  2RIT A;  1IIN A;  2JCJ A;  5C3B A;  3FOQ A;  1H5R B;  1WSZ A;  5BXC A;  4L41 C;  1ZDF A;  1XZ6 A;  1G23 A;  4EEA A;  5AJN A;  1H4C A;  1GWV A;  4B2W A;  1H4D A;  2XME A;  2RIX A;  1R7T A;  2AEC A;  4KQL A;  5DDV A;  5IDS A;  3RMW A;  4M28 A;  2X65 A;  1MC3 A;  2D7R A;  1VZT A;  4B4B A;  1H5T A;  3HL3 A;  1G93 A;  1FRW A;  5D92 A;  1NF5 B;  1ON8 A;  1G9R A;  1GA8 A;  2YCM A;  2E3D A;  1FZW A;  1WVC A;  3OAM A;  4Q7C A;  2AM3 A;  5I1F A;  5L6S A;  1R80 A;  4KC1 A;  1GWW A;  2QKX A;  5CMG X;  4KXO A;  3U2X A;  2Z86 A;  4FQW A;  5CQM X;  2JCK A;  1ZJ2 A;  4D48 A;  4M2A A;  4GBP A;  4IRP A;  4NAN A;  2FY7 A;  2WAW A;  2V0J A;  2W0V A;  3OH1 A;  4B5B A;  3OGZ A;  4NAK A;  3V0O A;  1H5R A;  1VGZ A;  2V0K A;  5C47 A;  1LL0 A;  1FO9 A;  1LZ7 A;  5C3A A;  4G3P A;  4HO2 A;  1VGU A;  1VM8 A;  4FCE A;  4KNR A;  3CKV A;  2WGZ A;  3T7M A;  2WVL A;  3E26 A;  4NAL A;  4AYL A;  1V83 A;  3SXA A;  5C3D A;  1WT0 A;  5IFY A;  3TZT A;  1EZI A;  1WT1 A;  4UEG A;  3D98 A;  2FYC B;  2RJ1 A;  5CQN X;  3I0H A;  5FU0 A;  2A8W A;  3TQD A;  5AJO A;  1H7E A;  4EE3 A;  4DDZ A;  1ZJ1 A;  4FRO A;  3OC9 A;  2J0A A;  3JTJ A;  3V0Q A;  4D0T A;  3V0M A;  1G3L A;  1O7O A;  2W0W A;  2YQC A;  1MP5 A;  4FCU A;  1H7F A;  1KWS A;  4IRQ A;  4Y6N A;  2BO4 A;  2AH9 A;  3U2T A;  1LZJ A;  4DEC A;  2QH5 A;  1R81 A;  1WT3 A;  1LZI A;  1OMZ A;  4EEO A;  1JYL A;  5EJ1 A;  1LVW A;  1FR9 A;  3V91 A;  2OI5 A;  4KNX A;  5C36 A;  2YC5 A;  2VS3 A;  2VFZ A;  3R2W A;  3POL A;  2X5Z A;  1VGT A;  3SXC A;  3U2V A;  2YQS A;  2V0H A;  2Q4J A;  3V8Y A;  1ZJ0 A;  1E5K A;  2PGV A;  3CKO A;  3USQ A;  2RIZ A;  4LW6 A;  5AJP A;  2ZU7 A;  1O7Q A;  4Y7G A;  1HJL A;  1GQC A;  1H5S C;  1FOA A;  1JVG A;  2PX7 A;  2J0B A;  2YES A;  2Y4K A;  3BCV A;  1ZCV A;  3O3P A;  1OMX A;  1SS9 A;  2C0N A;  2E8B A;  4MIX A;  5C48 A;  4KPX A;  3QVB A;  3ZLL A;  2NXV A;  2RIY A;  3ZLK A;  2YQJ A;  3DJ4 A;  4ASY A;  1FXO A;  3RSB A;  1Z90 A;  4MYB A;  1GX4 A;  3I0J A;  2RJ4 A;  1W77 A;  1MP4 A;  2RJ7 A;  2OI7 A;  1PZY B;  1O0R A;  1ZDG A;  5C49 A;  5IDT A;  5FUH A;  1ZIZ A;  2XMH A;  4HO9 A;  5EJZ A;  3IOI A;  4G87 A;  2V0L A;  4CVH A;  3I0G A;  1G1L A;  3JUK A;  5C4D A;  1H7H A;  2VS5 A;  4FIX A;  3SPT A;  3BRK X;  1GQ9 A;  3Q7U A;  1ZHJ A;  2RJ5 A;  1FGG A;  1VZX A;  2ZU8 A;  1INJ A;  5C4B A;  4FRM A;  1YRO B;  2ZU9 A;  3SX7 A;  4M4K A;  5C8R A;  2BO8 A;  1VPA A;  4EE5 A;  1ZI1 A;  1QWJ A;  4O6M A;  3F1Y A;  3T7O A;  1HM8 A;  4KT7 A;  4BMA A;  2VXL A;  2FFU A;  3PKQ A;  4AYJ A;  3IOH A;  4Y7U A;  3CU0 A;  4MND A;  4CJC A;  3U2U A;  1ZCT A;  5C38 A;  1HJJ A;  2AM4 A;  4FRE A;  1V84 A;  3OH3 A;  3KIA A;  4XWI A;  5C4C A;  2Z87 A;  2WVM A;  3ZF8 A;  2FYA A;  1VH1 A;  4KPZ A;  1H7G A;  5C4E A;  3OH2 A;  5FYE A;  3T7N A;  2PGY A;  1FGX A;  2YC3 A;  2WVK A;  1HM0 A;  4E1K A;  1H7T A;  4D11 A;  2QGI A;  1WT2 A;  3I0E A;  3R3I A;  5DDT A;  2D0J A;  1ON6 A;  5L6V A;  3PKP A;  2VD4 A;  4B4G A;  1FG5 N;  2RJ9 A;  5CMH A;  1JYK A;  4JD0 A;  3SXB A;  3RMV A;  4EE4 A;  2VSI A;  3Q4S A;  1JV3 A;  5FV9 A;  3F1C A;  1G0R A;  4HO5 A;  3CGX A;  2CU2 A;  2Y6P A;  5CQO A;  2P6W A;  1S4N A;  3V0L A;  3V0P A;  3PNN A;  3I0I X;  2AE7 A;  3IOJ A;  4CJB A;  1JV1 A;  1R7X A;  1YP2 A;  1ZI4 A;  1ZJ3 A;  3I0C A;  3I0L A;  5D91 A;  1VIC A;  4ASJ A;  2OEG A;  1YP3 A;  4FRB A;  4FRQ A;  2ICY A;  2BO7 A;  3V8Z A;  2Y4L A;  4LW3 A;  1H5S A;  1TVY A;  4HO3 A;  3D8V A;  2VSH A;  3EE5 A;  2GGQ A;  2GGO A;  4ECM A;  5CMI A;  5JQQ A;  4AAW A;  3ST8 A;  4M2B A;  3OKR A;  1QG8 A;  3U2W A;  4HO4 A;  2A8U A;  4ZDQ A;  2WE9 A;  2WEE A;  4FRH A;  3Q80 A;  4NAI A;  1IIM A;  4AC3 A;  4Y62 A;  1H7Q A;  1G97 A;  1ZJO A;  1QGQ A;  1FO8 A;  2Y4M A;  2XWL A;  3U0Y A;  3GUE A;  4ARW A;  3LW6 A;  4EVW A;  1G2V A;  4KC4 A;  5CQL X;  1ZI5 A;  2I7B A;  2Y4J A;  5C1L A;  1TW1 A;  2P73 A;  4HO6 A;  1TW5 A;  3U0X A;  4FRA A;  3CKN A;  2VK9 A;  4Y63 A;  1K4V A;  2OI6 A;  1NKH B;  4P00 A;  4EEG A;  1QGS A;  1FR8 A;  5C1H A;  4Y9X A;  2AM5 A;  1LL2 A;  4Y7T A;  2RJ0 A;  2OEF A;  1H3M A;  2UX8 A;  2MZB A;  5CMF X;  5C4F A;  3SXD A;  4HCQ A;  1LL3 A;  2AES A;  2JCO A;  1R7U A;  4B42 A;  1HV9 A;  3E25 A;  2O1H A;  3K8D A;  3D5N A;  5EIY A;  3DK5 A;  1TZF A;  1H7L A;  1I52 A;  5CMJ A;  2FYD B;  1ZI3 A;  2D7I A;  2RJ6 A;  3ZGF A;  2O1F A;  5FTS A;  3I0K A;  1LZ0 A;  4HOC A;  4FRP A;  1H5S B;  1W57 A;  1R7Y A;  4G3Q A;  1W55 A;  3JUJ A;  1ZCY A;  1JVD A;  4B2X A;  2JCL A;  1XHB A;  2AGD A;  3OH4 A;  2APC A;  4Y7V A;  2FYB A;  5FU8 A;  3USR A;  2I5K A;  4Y64 A;  1VH3 A;  4EEM A;  3CKQ A;  1V82 A;  1R7V A;  4DE7 A;  2X5S A;  4BQH A;  2PA4 A;  4P02 A;  1FXJ A;  2XWM A;  3SX3 A;  3V90 A;  2V0I A;  1EYR A;  5J49 A;  4B4M A;  1R82 A;  1S4O A;  2Y7A A;  1O23 B;  1NMM B;  3CKJ A;  3K8E A;  2ICX A;  4D11 C;  3I0D A;  3SXG A;  3OH0 A;  1HM9 A;  3SXE A;  2DPW A;  4D0Z A;  1PZT A;  4FRL A;  4KRV A;  5CQP A;  5C1G A;  4FIY A;  4B3U A;  1G8O A;  3N9W A;  4HG6 A;  3ZGG A;  4KC2 A;  3NGW A;  2RJ8 A;  4O6N A;  1NHE B;  2FFV A;  1NWG B;  3FWW A;  2O1G A;  1G95 A;  5FTV A;  3SX5 A;  1OQM B;  1H5T B;  4Y7F A;  4HO8 A;  4Y6U A;  4HO0 A;  1YP4 A;  4JIS A;  4G3S A;  5HS2 A;  4R7P A;  2I5E A;  1S4P A;  4K6R A;  2XWN A;  1MP3 A;  4C2S A;  1GX0 A;  3DUV A;  1ZJP A; 
#chains in the Genus database with same CATH homology
 4FRD A;  3V0N A;  2VS4 A;  4YS8 A;  1INI A;  1FWY A;  1VZU A;  2VXM A;  1H4E A;  2YQH A;  3I0F A;  1ZCU A;  2X60 A;  3SX8 A;  2P72 A;  4J18 A;  1H5S D;  1VGW A;  2BO6 A;  4CJ8 A;  1NQI B;  2RIT A;  1IIN A;  2JCJ A;  5C3B A;  3FOQ A;  1H5R B;  1WSZ A;  5BXC A;  4L41 C;  1ZDF A;  1XZ6 A;  1G23 A;  4EEA A;  5AJN A;  1H4C A;  1GWV A;  4B2W A;  1H4D A;  2XME A;  2RIX A;  1R7T A;  2AEC A;  4KQL A;  5DDV A;  5IDS A;  3RMW A;  4M28 A;  2X65 A;  1MC3 A;  2D7R A;  1VZT A;  4B4B A;  1H5T A;  3HL3 A;  1G93 A;  1FRW A;  5D92 A;  1NF5 B;  1ON8 A;  1G9R A;  1GA8 A;  2YCM A;  2E3D A;  1FZW A;  1WVC A;  3OAM A;  4Q7C A;  2AM3 A;  5I1F A;  5L6S A;  1R80 A;  4KC1 A;  1GWW A;  2QKX A;  5CMG X;  4KXO A;  3U2X A;  2Z86 A;  4FQW A;  5CQM X;  2JCK A;  1ZJ2 A;  4D48 A;  4M2A A;  4GBP A;  4IRP A;  4NAN A;  2FY7 A;  2WAW A;  2V0J A;  2W0V A;  3OH1 A;  4B5B A;  3OGZ A;  4NAK A;  3V0O A;  1H5R A;  1VGZ A;  2V0K A;  5C47 A;  1LL0 A;  1FO9 A;  1LZ7 A;  5C3A A;  4G3P A;  4HO2 A;  1VGU A;  1VM8 A;  4FCE A;  4KNR A;  3CKV A;  2WGZ A;  3T7M A;  2WVL A;  3E26 A;  4NAL A;  4AYL A;  1V83 A;  3SXA A;  5C3D A;  1WT0 A;  5IFY A;  3TZT A;  1EZI A;  1WT1 A;  4UEG A;  3D98 A;  2FYC B;  2RJ1 A;  5CQN X;  3I0H A;  5FU0 A;  2A8W A;  3TQD A;  5AJO A;  1H7E A;  4EE3 A;  4DDZ A;  1ZJ1 A;  4FRO A;  3OC9 A;  2J0A A;  3JTJ A;  3V0Q A;  4D0T A;  3V0M A;  1G3L A;  1O7O A;  2W0W A;  2YQC A;  1MP5 A;  4FCU A;  1H7F A;  1KWS A;  4IRQ A;  4Y6N A;  2BO4 A;  2AH9 A;  3U2T A;  1LZJ A;  4DEC A;  2QH5 A;  1R81 A;  1WT3 A;  1LZI A;  1OMZ A;  4EEO A;  1JYL A;  5EJ1 A;  1LVW A;  1FR9 A;  3V91 A;  2OI5 A;  4KNX A;  5C36 A;  2YC5 A;  2VS3 A;  2VFZ A;  3R2W A;  3POL A;  2X5Z A;  1VGT A;  3SXC A;  3U2V A;  2YQS A;  2V0H A;  2Q4J A;  3V8Y A;  1ZJ0 A;  1E5K A;  2PGV A;  3CKO A;  3USQ A;  2RIZ A;  4LW6 A;  5AJP A;  2ZU7 A;  1O7Q A;  4Y7G A;  1HJL A;  1GQC A;  1H5S C;  1FOA A;  1JVG A;  2PX7 A;  2J0B A;  2YES A;  2Y4K A;  3BCV A;  1ZCV A;  3O3P A;  1OMX A;  1SS9 A;  2C0N A;  2E8B A;  4MIX A;  5C48 A;  4KPX A;  3QVB A;  3ZLL A;  2NXV A;  2RIY A;  3ZLK A;  2YQJ A;  3DJ4 A;  4ASY A;  1FXO A;  3RSB A;  1Z90 A;  4MYB A;  1GX4 A;  3I0J A;  2RJ4 A;  1W77 A;  1MP4 A;  2RJ7 A;  2OI7 A;  1PZY B;  1O0R A;  1ZDG A;  5C49 A;  5IDT A;  5FUH A;  1ZIZ A;  2XMH A;  4HO9 A;  5EJZ A;  3IOI A;  4G87 A;  2V0L A;  4CVH A;  3I0G A;  1G1L A;  3JUK A;  5C4D A;  1H7H A;  2VS5 A;  4FIX A;  3SPT A;  3BRK X;  1GQ9 A;  3Q7U A;  1ZHJ A;  2RJ5 A;  1FGG A;  1VZX A;  2ZU8 A;  1INJ A;  5C4B A;  4FRM A;  1YRO B;  2ZU9 A;  3SX7 A;  4M4K A;  5C8R A;  2BO8 A;  1VPA A;  4EE5 A;  1ZI1 A;  1QWJ A;  4O6M A;  3F1Y A;  3T7O A;  1HM8 A;  4KT7 A;  4BMA A;  2VXL A;  2FFU A;  3PKQ A;  4AYJ A;  3IOH A;  4Y7U A;  3CU0 A;  4MND A;  4CJC A;  3U2U A;  1ZCT A;  5C38 A;  1HJJ A;  2AM4 A;  4FRE A;  1V84 A;  3OH3 A;  3KIA A;  4XWI A;  5C4C A;  2Z87 A;  2WVM A;  3ZF8 A;  2FYA A;  1VH1 A;  4KPZ A;  1H7G A;  5C4E A;  3OH2 A;  5FYE A;  3T7N A;  2PGY A;  1FGX A;  2YC3 A;  2WVK A;  1HM0 A;  4E1K A;  1H7T A;  4D11 A;  2QGI A;  1WT2 A;  3I0E A;  3R3I A;  5DDT A;  2D0J A;  1ON6 A;  5L6V A;  3PKP A;  2VD4 A;  4B4G A;  1FG5 N;  2RJ9 A;  5CMH A;  1JYK A;  4JD0 A;  3SXB A;  3RMV A;  4EE4 A;  2VSI A;  3Q4S A;  1JV3 A;  5FV9 A;  3F1C A;  1G0R A;  4HO5 A;  3CGX A;  2CU2 A;  2Y6P A;  5CQO A;  2P6W A;  1S4N A;  3V0L A;  3V0P A;  3PNN A;  3I0I X;  2AE7 A;  3IOJ A;  4CJB A;  1JV1 A;  1R7X A;  1YP2 A;  1ZI4 A;  1ZJ3 A;  3I0C A;  3I0L A;  5D91 A;  1VIC A;  4ASJ A;  2OEG A;  1YP3 A;  4FRB A;  4FRQ A;  2ICY A;  2BO7 A;  3V8Z A;  2Y4L A;  4LW3 A;  1H5S A;  1TVY A;  4HO3 A;  3D8V A;  2VSH A;  3EE5 A;  2GGQ A;  2GGO A;  4ECM A;  5CMI A;  5JQQ A;  4AAW A;  3ST8 A;  4M2B A;  3OKR A;  1QG8 A;  3U2W A;  4HO4 A;  2A8U A;  4ZDQ A;  2WE9 A;  2WEE A;  4FRH A;  3Q80 A;  4NAI A;  1IIM A;  4AC3 A;  4Y62 A;  1H7Q A;  1G97 A;  1ZJO A;  1QGQ A;  1FO8 A;  2Y4M A;  2XWL A;  3U0Y A;  3GUE A;  4ARW A;  3LW6 A;  4EVW A;  1G2V A;  4KC4 A;  5CQL X;  1ZI5 A;  2I7B A;  2Y4J A;  5C1L A;  1TW1 A;  2P73 A;  4HO6 A;  1TW5 A;  3U0X A;  4FRA A;  3CKN A;  2VK9 A;  4Y63 A;  1K4V A;  2OI6 A;  1NKH B;  4P00 A;  4EEG A;  1QGS A;  1FR8 A;  5C1H A;  4Y9X A;  2AM5 A;  1LL2 A;  4Y7T A;  2RJ0 A;  2OEF A;  1H3M A;  2UX8 A;  2MZB A;  5CMF X;  5C4F A;  3SXD A;  4HCQ A;  1LL3 A;  2AES A;  2JCO A;  1R7U A;  4B42 A;  1HV9 A;  3E25 A;  2O1H A;  3K8D A;  3D5N A;  5EIY A;  3DK5 A;  1TZF A;  1H7L A;  1I52 A;  5CMJ A;  2FYD B;  1ZI3 A;  2D7I A;  2RJ6 A;  3ZGF A;  2O1F A;  5FTS A;  3I0K A;  1LZ0 A;  4HOC A;  4FRP A;  1H5S B;  1W57 A;  1R7Y A;  4G3Q A;  1W55 A;  3JUJ A;  1ZCY A;  1JVD A;  4B2X A;  2JCL A;  1XHB A;  2AGD A;  3OH4 A;  2APC A;  4Y7V A;  2FYB A;  5FU8 A;  3USR A;  2I5K A;  4Y64 A;  1VH3 A;  4EEM A;  3CKQ A;  1V82 A;  1R7V A;  4DE7 A;  2X5S A;  4BQH A;  2PA4 A;  4P02 A;  1FXJ A;  2XWM A;  3SX3 A;  3V90 A;  2V0I A;  1EYR A;  5J49 A;  4B4M A;  1R82 A;  1S4O A;  2Y7A A;  1O23 B;  1NMM B;  3CKJ A;  3K8E A;  2ICX A;  4D11 C;  3I0D A;  3SXG A;  3OH0 A;  1HM9 A;  3SXE A;  2DPW A;  4D0Z A;  1PZT A;  4FRL A;  4KRV A;  5CQP A;  5C1G A;  4FIY A;  4B3U A;  1G8O A;  3N9W A;  4HG6 A;  3ZGG A;  4KC2 A;  3NGW A;  2RJ8 A;  4O6N A;  1NHE B;  2FFV A;  1NWG B;  3FWW A;  2O1G A;  1G95 A;  5FTV A;  3SX5 A;  1OQM B;  1H5T B;  4Y7F A;  4HO8 A;  4Y6U A;  4HO0 A;  1YP4 A;  4JIS A;  4G3S A;  5HS2 A;  4R7P A;  2I5E A;  1S4P A;  4K6R A;  2XWN A;  1MP3 A;  4C2S A;  1GX0 A;  3DUV A;  1ZJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...