3I0DA

Crystal structure of gtb c80s/c196s + udp
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
274
structure length
264
Chain Sequence
PQPKVLTPSRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVMRRMEMISDFSERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ABO glycosyltransferase
publication title Cysteine-to-serine mutants dramatically reorder the active site of human ABO(H) blood group B glycosyltransferase without affecting activity: structural insights into cooperative substrate binding
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 264
sequence length 274
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2009-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3i0dA00
3U0YA 4KC1A 3V0NA 2QKXA 4G87A 3IOIA 5C4EA 2NXVA 2AH9A 2Z87A 1I52A 1FO8A 4FRLA 1R7TA 5L6VA 1LZIA 4KXOA 1VZTA 1H7TA 3Q4SA 3CKQA 3CKJA 2QH5A 2OI6A 2RIZA 4Y7TA 1G23A 2VSIA 4NAKA 3ZGGA 4D0TA 3SX7A 1JVDA 3FOQA 4Y6NA 1VZXA 2OI5A 2MZBA 1WVCA 1TW5A 3V8YA 4DECA 4KT7A 4M2BA 2AM5A 2FFUA 2X60A 5FU8A 2RIYA 2RJ5A 5EJ1A 5AJOA 2YQSA 2RJ4A 2E3DA 2ZU8A 3USRA 2W0VA 3V0LA 1OQMB 5C48A 3RMWA 1PZTA 5EJZA 1W55A 2WE9A 4NANA 3U2TA 1LL2A 1GA8A 1H4CA 4R7PA 4G3QA 4CVHA 3DUVA 2V0LA 1FR9A 5J49A 3OH2A 3U0XA 1H7QA 2Y6PA 1JVGA 5CMHA 5FYEA 1G97A 2RJ7A 5IFYA 5CQMX 5IDTA 1QG8A 3I0CA 1VGWA 3V0OA 5FTSA 3OKRA 2FYAA 1TZFA 1HM8A 4M2AA 3N9WA 4B2XA 3ZLKA 1LL0A 3SXDA 2VXMA 3T7OA 1ON6A 2YC5A 3E25A 4B42A 5AJPA 4AC3A 3BCVA 3BRKX 4HO9A 1GQCA 1H5RB 2D7RA 5C1HA 1R7UA 1W77A 3K8DA 1FWYA 1YP2A 1VICA 1VZUA 1FOAA 1NMMB 1FO9A 4CJBA 2P72A 5CQNX 1FG5N 3F1YA 4ECMA 1HM9A 2A8UA 4HO8A 3ZF8A 4B3UA 2FY7A 4LW3A 5CMFX 1O0RA 1ZDFA 1XHBA 1Z90A 1GWVA 5C4DA 1ZI4A 5C4FA 3OH1A 5CQOA 2OEFA 5C1GA 1O23B 2VXLA 2VS3A 2VD4A 3CGXA 1MP5A 2OI7A 4KQLA 1H5SB 2WGZA 4CJCA 4M28A 1E5KA 3DK5A 1G95A 4NAIA 3SX8A 1R7YA 3D5NA 2XMEA 2UX8A 1R80A 1LZ7A 1YROB 3F1CA 3V0MA 4CJ8A 3RSBA 2Z86A 4EEAA 4FQWA 1FGGA 4JISA 3ZGFA 2A8WA 3I0IX 5C3BA 1V83A 1WSZA 4ZDQA 3V8ZA 3POLA 1HJJA 4DDZA 5L6SA 5DDVA 1HV9A 2Q4JA 4HO6A 5EIYA 2JCKA 3SXGA 1YP3A 5I1FA 2I5KA 3IOJA 4Y7UA 2V0HA 2WVMA 4IRPA 4B5BA 2V0IA 2PGVA 3PKPA 3R2WA 1VGUA 3IOHA 5C3DA 4B2WA 1JV3A 2RJ0A 4L41C 5CQLX 1H5SA 4D48A 4Y7FA 5CMJA 2WEEA 1H7HA 4EEGA 3D98A 1LZJA 4M4KA 1VM8A 1GX0A 3O3PA 2D7IA 4Y63A 3ZLLA 3ST8A 2Y7AA 1IIMA 4XWIA 4AYLA 2WVLA 4FRHA 4Y62A 2RIXA 1S4PA 1ZDGA 2X5SA 3I0FA 3RMVA 2AM3A 1LZ0A 1QGQA 3K8EA 2PGYA 1H5SC 4FRAA 2VS4A 4KNRA 2P73A 5DDTA 2ICXA 2PA4A 4JD0A 5CQPA 1G1LA 4C2SA 1H4EA 2XMHA 1ZJPA 2W0WA 1H7FA 3I0DA 4FCEA 3I0EA 1V82A 2YC3A 4BQHA 1NHEB 2JCJA 1ZCYA 1H5SD 1OMXA 4FRBA 4HO0A 5FTVA 3I0HA 4LW6A 4KNXA 4EE4A 1ZJOA 4UEGA 2JCLA 1FR8A 1FRWA 2FYCB 1SS9A 1O7OA 3OC9A 4HG6A 4FRQA 1ZCVA 4FCUA 1R7VA 4P00A 3TZTA 3CKOA 1ZI5A 4B4GA 5C38A 3U2XA 1K4VA 2GGOA 2V0JA 5CMIA 5AJNA 4B4BA 5BXCA 1GQ9A 1G9RA 1H4DA 2Y4MA 2Y4JA 4ASJA 1G3LA 1FZWA 3V90A 5IDSA 3CKNA 3NGWA 5C1LA 2BO8A 2P6WA 2ZU9A 3OH4A 5FUHA 2VFZA 1ZHJA 2WVKA 5HS2A 4Y6UA 2FYBA 2V0KA 3SXCA 4D11C 5C3AA 3U2VA 2GGQA 2VS5A 4HOCA 2AGDA 4B4MA 1W57A 3D8VA 3V0PA 4FREA 2YQCA 4Y64A 1GWWA 1R82A 4EVWA 1H5RA 1WT2A 4FROA 1G2VA 4EEMA 1QWJA 1G8OA 4NALA 4Y9XA 2ZU7A 3SXBA 2RJ1A 4G3SA 1INJA 5CMGX 3Q7UA 1HJLA 4KPZA 5C47A 3PNNA 3USQA 1NKHB 1FXJA 2RJ9A 4YS8A 2XWNA 2WAWA 2I5EA 3E26A 4MYBA 4HO3A 2RJ8A 1R81A 1NF5B 3SXAA 1ZCTA 3I0GA 1YP4A 4KRVA 3DJ4A 1MP3A 4Y7GA 2DPWA 1PZYB 1ZJ0A 1INIA 2FYDB 2APCA 1XZ6A 3I0JA 4KPXA 3PKQA 3JUJA 4G3PA 1MP4A 1ZIZA 1HM0A 1R7XA 2AM4A 1H5TB 2O1HA 3OH0A 1VGTA 3LW6A 1FXOA 1TW1A 1ZJ1A 2AESA 1S4OA 2O1FA 4EEOA 1LVWA 2YQJA 1TVYA 4HCQA 4HO4A 1KWSA 4IRQA 4P02A 4KC4A 1GX4A 4FRDA 3FWWA 1G93A 1ZI3A 1H7EA 2CU2A 1S4NA 3Q80A 3SX5A 3U2WA 2RJ6A 1EYRA 1JYKA 5FU0A 2YQHA 1H7GA 2JCOA 3R3IA 4GBPA 5C4CA 2YCMA 3HL3A 3JUKA 5JQQA 3OAMA 3KIAA 1O7QA 1VGZA 2QGIA 2AECA 1JV1A 1ZJ2A 4E1KA 1H3MA 5C4BA 2I7BA 2BO4A 1H7LA 3U2UA 1VH1A 1H5TA 4AAWA 3SXEA 1WT1A 3SPTA 2AE7A 1V84A 3V0QA 4EE3A 4FRPA 3SX3A 3OGZA 1EZIA 4J18A 4D11A 2FFVA 2BO6A 2O1GA 4EE5A 1VH3A 4MNDA 5C36A 2X65A 1G0RA 3CKVA 1OMZA 2PX7A 2BO7A 3OH3A 1QGSA 4DE7A 1NWGB 4HO2A 2ICYA 1ZI1A 2XWMA 3T7MA 3QVBA 1WT0A 2XWLA 3I0KA 3EE5A 2D0JA 2YESA 3CU0A 2Y4LA 4KC2A 2OEGA 1VPAA 1ZJ3A 5C8RA 4HO5A 1NQIB 4AYJA 5C49A 3JTJA 2VSHA 1MC3A 1ZCUA 4Y7VA 1ON8A 4FRMA 5FV9A 3V91A 1WT3A 3I0LA 3GUEA 4BMAA 4ASYA 1FGXA 2E8BA 4D0ZA 2RITA 4ARWA 2X5ZA 4K6RA 3TQDA 1JYLA 1IINA 3T7NA 1LL3A 2Y4KA
chains in the Genus database with same CATH superfamily
3U0YA 4KC1A 3V0NA 2QKXA 4G87A 3IOIA 5C4EA 2NXVA 2AH9A 2VK9A 2Z87A 2J0AA 1I52A 1FO8A 4FRLA 1R7TA 5L6VA 1LZIA 4KXOA 1VZTA 1H7TA 3Q4SA 3CKQA 3CKJA 2QH5A 2OI6A 2RIZA 4Y7TA 1G23A 2VSIA 4NAKA 3ZGGA 4D0TA 3SX7A 1JVDA 3FOQA 4Y6NA 1VZXA 2OI5A 2MZBA 1WVCA 1TW5A 3V8YA 4DECA 4KT7A 4M2BA 2AM5A 2FFUA 2X60A 5FU8A 2RIYA 2RJ5A 5EJ1A 5AJOA 2YQSA 4Q7CA 2RJ4A 2E3DA 2ZU8A 3USRA 2W0VA 3V0LA 1OQMB 5C48A 3RMWA 1PZTA 5EJZA 1W55A 2WE9A 4NANA 3U2TA 1LL2A 1GA8A 1H4CA 4R7PA 4G3QA 4CVHA 3DUVA 2V0LA 4O6NA 1FR9A 5J49A 3OH2A 3U0XA 1H7QA 2Y6PA 1JVGA 5CMHA 5FYEA 1G97A 2RJ7A 5IFYA 5CQMX 5IDTA 1QG8A 3I0CA 1VGWA 3V0OA 5FTSA 3OKRA 2FYAA 1TZFA 1HM8A 4M2AA 3N9WA 4B2XA 3ZLKA 1LL0A 3SXDA 2VXMA 3T7OA 1ON6A 2YC5A 5D92A 3E25A 4B42A 5AJPA 4AC3A 3BCVA 3BRKX 4HO9A 4MIXA 1GQCA 1H5RB 2D7RA 5C1HA 1R7UA 1W77A 3K8DA 1FWYA 1YP2A 1VICA 1VZUA 1FOAA 1NMMB 1FO9A 4CJBA 2P72A 5CQNX 1FG5N 3F1YA 4ECMA 1HM9A 2A8UA 4HO8A 3ZF8A 4B3UA 2FY7A 4LW3A 5CMFX 1O0RA 1ZDFA 1XHBA 1Z90A 1GWVA 5D91A 5C4DA 1ZI4A 5C4FA 3OH1A 5CQOA 2OEFA 5C1GA 1O23B 2VXLA 2VS3A 2VD4A 3CGXA 1MP5A 2OI7A 4KQLA 1H5SB 2WGZA 4CJCA 4M28A 1E5KA 3DK5A 1G95A 4NAIA 3SX8A 1R7YA 3D5NA 2XMEA 2UX8A 1R80A 1LZ7A 1YROB 3F1CA 3V0MA 4CJ8A 3RSBA 2Z86A 4EEAA 4FQWA 1FGGA 4JISA 3ZGFA 2A8WA 3I0IX 5C3BA 1V83A 1WSZA 4ZDQA 3V8ZA 3POLA 1HJJA 4DDZA 5L6SA 5DDVA 1HV9A 2Q4JA 4HO6A 5EIYA 2JCKA 3SXGA 1YP3A 5I1FA 2I5KA 3IOJA 4Y7UA 2V0HA 2WVMA 4IRPA 4B5BA 2V0IA 2PGVA 3PKPA 3R2WA 1VGUA 3IOHA 5C3DA 4B2WA 1JV3A 2RJ0A 4L41C 5CQLX 1H5SA 4D48A 4Y7FA 5CMJA 2WEEA 1H7HA 4EEGA 3D98A 1LZJA 4M4KA 1VM8A 1GX0A 3O3PA 2D7IA 4Y63A 3ZLLA 3ST8A 2Y7AA 1IIMA 4XWIA 4AYLA 2WVLA 4FRHA 4Y62A 2RIXA 1S4PA 1ZDGA 2X5SA 3I0FA 3RMVA 2AM3A 1LZ0A 1QGQA 3K8EA 2PGYA 4FIYA 1H5SC 4FRAA 2VS4A 4KNRA 2P73A 5DDTA 2ICXA 2PA4A 4JD0A 5CQPA 1G1LA 4C2SA 1H4EA 2XMHA 1ZJPA 2W0WA 1H7FA 3I0DA 4FCEA 3I0EA 1V82A 2YC3A 4BQHA 1NHEB 2JCJA 1ZCYA 1H5SD 1OMXA 4FRBA 4HO0A 5FTVA 3I0HA 4LW6A 4KNXA 4EE4A 1ZJOA 4UEGA 2JCLA 1FR8A 1FRWA 2FYCB 1SS9A 1O7OA 3OC9A 4HG6A 4FRQA 1ZCVA 4FCUA 1R7VA 4P00A 3TZTA 3CKOA 1ZI5A 4B4GA 5C38A 3U2XA 1K4VA 2GGOA 2V0JA 5CMIA 5AJNA 4B4BA 5BXCA 1GQ9A 1G9RA 1H4DA 2Y4MA 2Y4JA 4ASJA 1G3LA 1FZWA 3V90A 5IDSA 3CKNA 3NGWA 5C1LA 2BO8A 2P6WA 2ZU9A 3OH4A 5FUHA 2VFZA 1ZHJA 2WVKA 5HS2A 4Y6UA 2FYBA 2V0KA 3SXCA 4D11C 5C3AA 3U2VA 2GGQA 2VS5A 4HOCA 2AGDA 4B4MA 1W57A 3D8VA 3V0PA 4FREA 2YQCA 4Y64A 1GWWA 1R82A 4EVWA 1H5RA 1WT2A 4FROA 1G2VA 4EEMA 1QWJA 1G8OA 4NALA 4Y9XA 2ZU7A 3SXBA 2RJ1A 4FIXA 1INJA 4G3SA 5CMGX 3Q7UA 1HJLA 4KPZA 5C47A 3PNNA 3USQA 1NKHB 1FXJA 2RJ9A 4YS8A 2XWNA 2WAWA 2I5EA 3E26A 4MYBA 4HO3A 2RJ8A 1R81A 1NF5B 3SXAA 1ZCTA 3I0GA 1YP4A 4KRVA 3DJ4A 2J0BA 1MP3A 4Y7GA 2DPWA 1PZYB 1ZJ0A 1INIA 2FYDB 2APCA 1XZ6A 3I0JA 4KPXA 3PKQA 3JUJA 4G3PA 1MP4A 1ZIZA 1HM0A 1R7XA 2AM4A 1H5TB 2O1HA 3OH0A 1VGTA 3LW6A 1FXOA 1TW1A 1ZJ1A 2AESA 1S4OA 2O1FA 4EEOA 1LVWA 2YQJA 1TVYA 4HCQA 4HO4A 1KWSA 4IRQA 4P02A 4KC4A 1GX4A 4FRDA 3FWWA 1G93A 1ZI3A 1H7EA 2CU2A 1S4NA 3Q80A 3SX5A 3U2WA 2RJ6A 1EYRA 1JYKA 5FU0A 2YQHA 1H7GA 4O6MA 2JCOA 3R3IA 4GBPA 5C4CA 2YCMA 3HL3A 3JUKA 5JQQA 3OAMA 3KIAA 1O7QA 1VGZA 2QGIA 2AECA 1JV1A 1ZJ2A 4E1KA 1H3MA 5C4BA 2I7BA 2BO4A 1H7LA 3U2UA 1VH1A 1H5TA 4AAWA 3SXEA 1WT1A 3SPTA 2AE7A 1V84A 3V0QA 4EE3A 4FRPA 3SX3A 3OGZA 1EZIA 4J18A 4D11A 2FFVA 2BO6A 2O1GA 4EE5A 1VH3A 4MNDA 5C36A 2C0NA 2X65A 1G0RA 3CKVA 1OMZA 2PX7A 2BO7A 3OH3A 1QGSA 4DE7A 1NWGB 4HO2A 2ICYA 1ZI1A 2XWMA 3T7MA 3QVBA 1WT0A 2XWLA 3I0KA 3EE5A 2D0JA 2YESA 3CU0A 2Y4LA 4KC2A 2OEGA 1VPAA 1ZJ3A 5C8RA 4HO5A 1NQIB 4AYJA 5C49A 3JTJA 2VSHA 1MC3A 1ZCUA 4Y7VA 1ON8A 4FRMA 5FV9A 3V91A 1WT3A 3I0LA 3GUEA 4BMAA 4ASYA 1FGXA 2E8BA 4D0ZA 2RITA 4ARWA 2X5ZA 4K6RA 3TQDA 1JYLA 1IINA 3T7NA 1LL3A 2Y4KA
chains in the Genus database with same CATH topology
3U0YA 4KC1A 3V0NA 2QKXA 4G87A 3IOIA 5C4EA 2NXVA 2AH9A 2VK9A 2Z87A 2J0AA 1I52A 1FO8A 4FRLA 1R7TA 5L6VA 1LZIA 4KXOA 1VZTA 1H7TA 3Q4SA 3CKQA 3CKJA 2QH5A 2OI6A 2RIZA 4Y7TA 1G23A 2VSIA 4NAKA 3ZGGA 4D0TA 3SX7A 1JVDA 3FOQA 4Y6NA 1VZXA 2OI5A 2MZBA 1WVCA 1TW5A 3V8YA 4DECA 4KT7A 4M2BA 2AM5A 2FFUA 2X60A 5FU8A 2RIYA 2RJ5A 5EJ1A 5AJOA 2YQSA 4Q7CA 2RJ4A 2E3DA 2ZU8A 3USRA 2W0VA 3V0LA 1OQMB 5C48A 3RMWA 1PZTA 5EJZA 1W55A 2WE9A 4NANA 3U2TA 1LL2A 1GA8A 1H4CA 4R7PA 4G3QA 4CVHA 3DUVA 2V0LA 4O6NA 1FR9A 5J49A 3OH2A 3U0XA 1H7QA 2Y6PA 1JVGA 5CMHA 5FYEA 1G97A 2RJ7A 5IFYA 5CQMX 5IDTA 1QG8A 3I0CA 1VGWA 3V0OA 5FTSA 3OKRA 2FYAA 1TZFA 1HM8A 4M2AA 3N9WA 4B2XA 3ZLKA 1LL0A 3SXDA 2VXMA 3T7OA 1ON6A 2YC5A 5D92A 3E25A 4B42A 5AJPA 4AC3A 3BCVA 3BRKX 4HO9A 4MIXA 1GQCA 1H5RB 2D7RA 5C1HA 1R7UA 1W77A 3K8DA 1FWYA 1YP2A 1VICA 1VZUA 1FOAA 1NMMB 1FO9A 4CJBA 2P72A 5CQNX 1FG5N 3F1YA 4ECMA 1HM9A 2A8UA 4HO8A 3ZF8A 4B3UA 2FY7A 4LW3A 5CMFX 1O0RA 1ZDFA 1XHBA 1Z90A 1GWVA 5D91A 5C4DA 1ZI4A 5C4FA 3OH1A 5CQOA 2OEFA 5C1GA 1O23B 2VXLA 2VS3A 2VD4A 3CGXA 1MP5A 2OI7A 4KQLA 1H5SB 2WGZA 4CJCA 4M28A 1E5KA 3DK5A 1G95A 4NAIA 3SX8A 1R7YA 3D5NA 2XMEA 2UX8A 1R80A 1LZ7A 1YROB 3F1CA 3V0MA 4CJ8A 3RSBA 2Z86A 4EEAA 4FQWA 1FGGA 4JISA 3ZGFA 2A8WA 3I0IX 5C3BA 1V83A 1WSZA 4ZDQA 3V8ZA 3POLA 1HJJA 4DDZA 5L6SA 5DDVA 1HV9A 2Q4JA 4HO6A 5EIYA 2JCKA 3SXGA 1YP3A 5I1FA 2I5KA 3IOJA 4Y7UA 2V0HA 2WVMA 4IRPA 4B5BA 2V0IA 2PGVA 3PKPA 3R2WA 1VGUA 3IOHA 5C3DA 4B2WA 1JV3A 2RJ0A 4L41C 5CQLX 1H5SA 4D48A 4Y7FA 5CMJA 2WEEA 1H7HA 4EEGA 3D98A 1LZJA 4M4KA 1VM8A 1GX0A 3O3PA 2D7IA 4Y63A 3ZLLA 3ST8A 2Y7AA 1IIMA 4XWIA 4AYLA 2WVLA 4FRHA 4Y62A 2RIXA 1S4PA 1ZDGA 2X5SA 3I0FA 3RMVA 2AM3A 1LZ0A 1QGQA 3K8EA 2PGYA 4FIYA 1H5SC 4FRAA 2VS4A 4KNRA 2P73A 5DDTA 2ICXA 2PA4A 4JD0A 5CQPA 1G1LA 4C2SA 1H4EA 2XMHA 1ZJPA 2W0WA 1H7FA 3I0DA 4FCEA 3I0EA 1V82A 2YC3A 4BQHA 1NHEB 2JCJA 1ZCYA 1H5SD 1OMXA 4FRBA 4HO0A 5FTVA 3I0HA 4LW6A 4KNXA 4EE4A 1ZJOA 4UEGA 2JCLA 1FR8A 1FRWA 2FYCB 1SS9A 1O7OA 3OC9A 4HG6A 4FRQA 1ZCVA 4FCUA 1R7VA 4P00A 3TZTA 3CKOA 1ZI5A 4B4GA 5C38A 3U2XA 1K4VA 2GGOA 2V0JA 5CMIA 5AJNA 4B4BA 5BXCA 1GQ9A 1G9RA 1H4DA 2Y4MA 2Y4JA 4ASJA 1G3LA 1FZWA 3V90A 5IDSA 3CKNA 3NGWA 5C1LA 2BO8A 2P6WA 2ZU9A 3OH4A 5FUHA 2VFZA 1ZHJA 2WVKA 5HS2A 4Y6UA 2FYBA 2V0KA 3SXCA 4D11C 5C3AA 3U2VA 2GGQA 2VS5A 4HOCA 2AGDA 4B4MA 1W57A 3D8VA 3V0PA 4FREA 2YQCA 4Y64A 1GWWA 1R82A 4EVWA 1H5RA 1WT2A 4FROA 1G2VA 4EEMA 1QWJA 1G8OA 4NALA 4Y9XA 2ZU7A 3SXBA 2RJ1A 4FIXA 1INJA 4G3SA 5CMGX 3Q7UA 1HJLA 4KPZA 5C47A 3PNNA 3USQA 1NKHB 1FXJA 2RJ9A 4YS8A 2XWNA 2WAWA 2I5EA 3E26A 4MYBA 4HO3A 2RJ8A 1R81A 1NF5B 3SXAA 1ZCTA 3I0GA 1YP4A 4KRVA 3DJ4A 2J0BA 1MP3A 4Y7GA 2DPWA 1PZYB 1ZJ0A 1INIA 2FYDB 2APCA 1XZ6A 3I0JA 4KPXA 3PKQA 3JUJA 4G3PA 1MP4A 1ZIZA 1HM0A 1R7XA 2AM4A 1H5TB 2O1HA 3OH0A 1VGTA 3LW6A 1FXOA 1TW1A 1ZJ1A 2AESA 1S4OA 2O1FA 4EEOA 1LVWA 2YQJA 1TVYA 4HCQA 4HO4A 1KWSA 4IRQA 4P02A 4KC4A 1GX4A 4FRDA 3FWWA 1G93A 1ZI3A 1H7EA 2CU2A 1S4NA 3Q80A 3SX5A 3U2WA 2RJ6A 1EYRA 1JYKA 5FU0A 2YQHA 1H7GA 4O6MA 2JCOA 3R3IA 4GBPA 5C4CA 2YCMA 3HL3A 3JUKA 5JQQA 3OAMA 3KIAA 1O7QA 1VGZA 2QGIA 2AECA 1JV1A 1ZJ2A 4E1KA 1H3MA 5C4BA 2I7BA 2BO4A 1H7LA 3U2UA 1VH1A 1H5TA 4AAWA 3SXEA 1WT1A 3SPTA 2AE7A 1V84A 3V0QA 4EE3A 4FRPA 3SX3A 3OGZA 1EZIA 4J18A 4D11A 2FFVA 2BO6A 2O1GA 4EE5A 1VH3A 4MNDA 5C36A 2C0NA 2X65A 1G0RA 3CKVA 1OMZA 2PX7A 2BO7A 3OH3A 1QGSA 4DE7A 1NWGB 4HO2A 2ICYA 1ZI1A 2XWMA 3T7MA 3QVBA 1WT0A 2XWLA 3I0KA 3EE5A 2D0JA 2YESA 3CU0A 2Y4LA 4KC2A 2OEGA 1VPAA 1ZJ3A 5C8RA 4HO5A 1NQIB 4AYJA 5C49A 3JTJA 2VSHA 1MC3A 1ZCUA 4Y7VA 1ON8A 4FRMA 5FV9A 3V91A 1WT3A 3I0LA 3GUEA 4BMAA 4ASYA 1FGXA 2E8BA 4D0ZA 2RITA 4ARWA 2X5ZA 4K6RA 3TQDA 1JYLA 1IINA 3T7NA 1LL3A 2Y4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U0Y A;  4KC1 A;  3V0N A;  2QKX A;  4G87 A;  3IOI A;  5C4E A;  2NXV A;  2AH9 A;  2Z87 A;  1I52 A;  1FO8 A;  4FRL A;  1R7T A;  5L6V A;  1LZI A;  4KXO A;  1VZT A;  1H7T A;  3Q4S A;  3CKQ A;  3CKJ A;  2QH5 A;  2OI6 A;  2RIZ A;  4Y7T A;  1G23 A;  2VSI A;  4NAK A;  3ZGG A;  4D0T A;  3SX7 A;  1JVD A;  3FOQ A;  4Y6N A;  1VZX A;  2OI5 A;  2MZB A;  1WVC A;  1TW5 A;  3V8Y A;  4DEC A;  4KT7 A;  4M2B A;  2AM5 A;  2FFU A;  2X60 A;  5FU8 A;  2RIY A;  2RJ5 A;  5EJ1 A;  5AJO A;  2YQS A;  2RJ4 A;  2E3D A;  2ZU8 A;  3USR A;  2W0V A;  3V0L A;  1OQM B;  5C48 A;  3RMW A;  1PZT A;  5EJZ A;  1W55 A;  2WE9 A;  4NAN A;  3U2T A;  1LL2 A;  1GA8 A;  1H4C A;  4R7P A;  4G3Q A;  4CVH A;  3DUV A;  2V0L A;  1FR9 A;  5J49 A;  3OH2 A;  3U0X A;  1H7Q A;  2Y6P A;  1JVG A;  5CMH A;  5FYE A;  1G97 A;  2RJ7 A;  5IFY A;  5CQM X;  5IDT A;  1QG8 A;  3I0C A;  1VGW A;  3V0O A;  5FTS A;  3OKR A;  2FYA A;  1TZF A;  1HM8 A;  4M2A A;  3N9W A;  4B2X A;  3ZLK A;  1LL0 A;  3SXD A;  2VXM A;  3T7O A;  1ON6 A;  2YC5 A;  3E25 A;  4B42 A;  5AJP A;  4AC3 A;  3BCV A;  3BRK X;  4HO9 A;  1GQC A;  1H5R B;  2D7R A;  5C1H A;  1R7U A;  1W77 A;  3K8D A;  1FWY A;  1YP2 A;  1VIC A;  1VZU A;  1FOA A;  1NMM B;  1FO9 A;  4CJB A;  2P72 A;  5CQN X;  1FG5 N;  3F1Y A;  4ECM A;  1HM9 A;  2A8U A;  4HO8 A;  3ZF8 A;  4B3U A;  2FY7 A;  4LW3 A;  5CMF X;  1O0R A;  1ZDF A;  1XHB A;  1Z90 A;  1GWV A;  5C4D A;  1ZI4 A;  5C4F A;  3OH1 A;  5CQO A;  2OEF A;  5C1G A;  1O23 B;  2VXL A;  2VS3 A;  2VD4 A;  3CGX A;  1MP5 A;  2OI7 A;  4KQL A;  1H5S B;  2WGZ A;  4CJC A;  4M28 A;  1E5K A;  3DK5 A;  1G95 A;  4NAI A;  3SX8 A;  1R7Y A;  3D5N A;  2XME A;  2UX8 A;  1R80 A;  1LZ7 A;  1YRO B;  3F1C A;  3V0M A;  4CJ8 A;  3RSB A;  2Z86 A;  4EEA A;  4FQW A;  1FGG A;  4JIS A;  3ZGF A;  2A8W A;  3I0I X;  5C3B A;  1V83 A;  1WSZ A;  4ZDQ A;  3V8Z A;  3POL A;  1HJJ A;  4DDZ A;  5L6S A;  5DDV A;  1HV9 A;  2Q4J A;  4HO6 A;  5EIY A;  2JCK A;  3SXG A;  1YP3 A;  5I1F A;  2I5K A;  3IOJ A;  4Y7U A;  2V0H A;  2WVM A;  4IRP A;  4B5B A;  2V0I A;  2PGV A;  3PKP A;  3R2W A;  1VGU A;  3IOH A;  5C3D A;  4B2W A;  1JV3 A;  2RJ0 A;  4L41 C;  5CQL X;  1H5S A;  4D48 A;  4Y7F A;  5CMJ A;  2WEE A;  1H7H A;  4EEG A;  3D98 A;  1LZJ A;  4M4K A;  1VM8 A;  1GX0 A;  3O3P A;  2D7I A;  4Y63 A;  3ZLL A;  3ST8 A;  2Y7A A;  1IIM A;  4XWI A;  4AYL A;  2WVL A;  4FRH A;  4Y62 A;  2RIX A;  1S4P A;  1ZDG A;  2X5S A;  3I0F A;  3RMV A;  2AM3 A;  1LZ0 A;  1QGQ A;  3K8E A;  2PGY A;  1H5S C;  4FRA A;  2VS4 A;  4KNR A;  2P73 A;  5DDT A;  2ICX A;  2PA4 A;  4JD0 A;  5CQP A;  1G1L A;  4C2S A;  1H4E A;  2XMH A;  1ZJP A;  2W0W A;  1H7F A;  3I0D A;  4FCE A;  3I0E A;  1V82 A;  2YC3 A;  4BQH A;  1NHE B;  2JCJ A;  1ZCY A;  1H5S D;  1OMX A;  4FRB A;  4HO0 A;  5FTV A;  3I0H A;  4LW6 A;  4KNX A;  4EE4 A;  1ZJO A;  4UEG A;  2JCL A;  1FR8 A;  1FRW A;  2FYC B;  1SS9 A;  1O7O A;  3OC9 A;  4HG6 A;  4FRQ A;  1ZCV A;  4FCU A;  1R7V A;  4P00 A;  3TZT A;  3CKO A;  1ZI5 A;  4B4G A;  5C38 A;  3U2X A;  1K4V A;  2GGO A;  2V0J A;  5CMI A;  5AJN A;  4B4B A;  5BXC A;  1GQ9 A;  1G9R A;  1H4D A;  2Y4M A;  2Y4J A;  4ASJ A;  1G3L A;  1FZW A;  3V90 A;  5IDS A;  3CKN A;  3NGW A;  5C1L A;  2BO8 A;  2P6W A;  2ZU9 A;  3OH4 A;  5FUH A;  2VFZ A;  1ZHJ A;  2WVK A;  5HS2 A;  4Y6U A;  2FYB A;  2V0K A;  3SXC A;  4D11 C;  5C3A A;  3U2V A;  2GGQ A;  2VS5 A;  4HOC A;  2AGD A;  4B4M A;  1W57 A;  3D8V A;  3V0P A;  4FRE A;  2YQC A;  4Y64 A;  1GWW A;  1R82 A;  4EVW A;  1H5R A;  1WT2 A;  4FRO A;  1G2V A;  4EEM A;  1QWJ A;  1G8O A;  4NAL A;  4Y9X A;  2ZU7 A;  3SXB A;  2RJ1 A;  4G3S A;  1INJ A;  5CMG X;  3Q7U A;  1HJL A;  4KPZ A;  5C47 A;  3PNN A;  3USQ A;  1NKH B;  1FXJ A;  2RJ9 A;  4YS8 A;  2XWN A;  2WAW A;  2I5E A;  3E26 A;  4MYB A;  4HO3 A;  2RJ8 A;  1R81 A;  1NF5 B;  3SXA A;  1ZCT A;  3I0G A;  1YP4 A;  4KRV A;  3DJ4 A;  1MP3 A;  4Y7G A;  2DPW A;  1PZY B;  1ZJ0 A;  1INI A;  2FYD B;  2APC A;  1XZ6 A;  3I0J A;  4KPX A;  3PKQ A;  3JUJ A;  4G3P A;  1MP4 A;  1ZIZ A;  1HM0 A;  1R7X A;  2AM4 A;  1H5T B;  2O1H A;  3OH0 A;  1VGT A;  3LW6 A;  1FXO A;  1TW1 A;  1ZJ1 A;  2AES A;  1S4O A;  2O1F A;  4EEO A;  1LVW A;  2YQJ A;  1TVY A;  4HCQ A;  4HO4 A;  1KWS A;  4IRQ A;  4P02 A;  4KC4 A;  1GX4 A;  4FRD A;  3FWW A;  1G93 A;  1ZI3 A;  1H7E A;  2CU2 A;  1S4N A;  3Q80 A;  3SX5 A;  3U2W A;  2RJ6 A;  1EYR A;  1JYK A;  5FU0 A;  2YQH A;  1H7G A;  2JCO A;  3R3I A;  4GBP A;  5C4C A;  2YCM A;  3HL3 A;  3JUK A;  5JQQ A;  3OAM A;  3KIA A;  1O7Q A;  1VGZ A;  2QGI A;  2AEC A;  1JV1 A;  1ZJ2 A;  4E1K A;  1H3M A;  5C4B A;  2I7B A;  2BO4 A;  1H7L A;  3U2U A;  1VH1 A;  1H5T A;  4AAW A;  3SXE A;  1WT1 A;  3SPT A;  2AE7 A;  1V84 A;  3V0Q A;  4EE3 A;  4FRP A;  3SX3 A;  3OGZ A;  1EZI A;  4J18 A;  4D11 A;  2FFV A;  2BO6 A;  2O1G A;  4EE5 A;  1VH3 A;  4MND A;  5C36 A;  2X65 A;  1G0R A;  3CKV A;  1OMZ A;  2PX7 A;  2BO7 A;  3OH3 A;  1QGS A;  4DE7 A;  1NWG B;  4HO2 A;  2ICY A;  1ZI1 A;  2XWM A;  3T7M A;  3QVB A;  1WT0 A;  2XWL A;  3I0K A;  3EE5 A;  2D0J A;  2YES A;  3CU0 A;  2Y4L A;  4KC2 A;  2OEG A;  1VPA A;  1ZJ3 A;  5C8R A;  4HO5 A;  1NQI B;  4AYJ A;  5C49 A;  3JTJ A;  2VSH A;  1MC3 A;  1ZCU A;  4Y7V A;  1ON8 A;  4FRM A;  5FV9 A;  3V91 A;  1WT3 A;  3I0L A;  3GUE A;  4BMA A;  4ASY A;  1FGX A;  2E8B A;  4D0Z A;  2RIT A;  4ARW A;  2X5Z A;  4K6R A;  3TQD A;  1JYL A;  1IIN A;  3T7N A;  1LL3 A;  2Y4K A; 
#chains in the Genus database with same CATH topology
 3U0Y A;  4KC1 A;  3V0N A;  2QKX A;  4G87 A;  3IOI A;  5C4E A;  2NXV A;  2AH9 A;  2VK9 A;  2Z87 A;  2J0A A;  1I52 A;  1FO8 A;  4FRL A;  1R7T A;  5L6V A;  1LZI A;  4KXO A;  1VZT A;  1H7T A;  3Q4S A;  3CKQ A;  3CKJ A;  2QH5 A;  2OI6 A;  2RIZ A;  4Y7T A;  1G23 A;  2VSI A;  4NAK A;  3ZGG A;  4D0T A;  3SX7 A;  1JVD A;  3FOQ A;  4Y6N A;  1VZX A;  2OI5 A;  2MZB A;  1WVC A;  1TW5 A;  3V8Y A;  4DEC A;  4KT7 A;  4M2B A;  2AM5 A;  2FFU A;  2X60 A;  5FU8 A;  2RIY A;  2RJ5 A;  5EJ1 A;  5AJO A;  2YQS A;  4Q7C A;  2RJ4 A;  2E3D A;  2ZU8 A;  3USR A;  2W0V A;  3V0L A;  1OQM B;  5C48 A;  3RMW A;  1PZT A;  5EJZ A;  1W55 A;  2WE9 A;  4NAN A;  3U2T A;  1LL2 A;  1GA8 A;  1H4C A;  4R7P A;  4G3Q A;  4CVH A;  3DUV A;  2V0L A;  4O6N A;  1FR9 A;  5J49 A;  3OH2 A;  3U0X A;  1H7Q A;  2Y6P A;  1JVG A;  5CMH A;  5FYE A;  1G97 A;  2RJ7 A;  5IFY A;  5CQM X;  5IDT A;  1QG8 A;  3I0C A;  1VGW A;  3V0O A;  5FTS A;  3OKR A;  2FYA A;  1TZF A;  1HM8 A;  4M2A A;  3N9W A;  4B2X A;  3ZLK A;  1LL0 A;  3SXD A;  2VXM A;  3T7O A;  1ON6 A;  2YC5 A;  5D92 A;  3E25 A;  4B42 A;  5AJP A;  4AC3 A;  3BCV A;  3BRK X;  4HO9 A;  4MIX A;  1GQC A;  1H5R B;  2D7R A;  5C1H A;  1R7U A;  1W77 A;  3K8D A;  1FWY A;  1YP2 A;  1VIC A;  1VZU A;  1FOA A;  1NMM B;  1FO9 A;  4CJB A;  2P72 A;  5CQN X;  1FG5 N;  3F1Y A;  4ECM A;  1HM9 A;  2A8U A;  4HO8 A;  3ZF8 A;  4B3U A;  2FY7 A;  4LW3 A;  5CMF X;  1O0R A;  1ZDF A;  1XHB A;  1Z90 A;  1GWV A;  5D91 A;  5C4D A;  1ZI4 A;  5C4F A;  3OH1 A;  5CQO A;  2OEF A;  5C1G A;  1O23 B;  2VXL A;  2VS3 A;  2VD4 A;  3CGX A;  1MP5 A;  2OI7 A;  4KQL A;  1H5S B;  2WGZ A;  4CJC A;  4M28 A;  1E5K A;  3DK5 A;  1G95 A;  4NAI A;  3SX8 A;  1R7Y A;  3D5N A;  2XME A;  2UX8 A;  1R80 A;  1LZ7 A;  1YRO B;  3F1C A;  3V0M A;  4CJ8 A;  3RSB A;  2Z86 A;  4EEA A;  4FQW A;  1FGG A;  4JIS A;  3ZGF A;  2A8W A;  3I0I X;  5C3B A;  1V83 A;  1WSZ A;  4ZDQ A;  3V8Z A;  3POL A;  1HJJ A;  4DDZ A;  5L6S A;  5DDV A;  1HV9 A;  2Q4J A;  4HO6 A;  5EIY A;  2JCK A;  3SXG A;  1YP3 A;  5I1F A;  2I5K A;  3IOJ A;  4Y7U A;  2V0H A;  2WVM A;  4IRP A;  4B5B A;  2V0I A;  2PGV A;  3PKP A;  3R2W A;  1VGU A;  3IOH A;  5C3D A;  4B2W A;  1JV3 A;  2RJ0 A;  4L41 C;  5CQL X;  1H5S A;  4D48 A;  4Y7F A;  5CMJ A;  2WEE A;  1H7H A;  4EEG A;  3D98 A;  1LZJ A;  4M4K A;  1VM8 A;  1GX0 A;  3O3P A;  2D7I A;  4Y63 A;  3ZLL A;  3ST8 A;  2Y7A A;  1IIM A;  4XWI A;  4AYL A;  2WVL A;  4FRH A;  4Y62 A;  2RIX A;  1S4P A;  1ZDG A;  2X5S A;  3I0F A;  3RMV A;  2AM3 A;  1LZ0 A;  1QGQ A;  3K8E A;  2PGY A;  4FIY A;  1H5S C;  4FRA A;  2VS4 A;  4KNR A;  2P73 A;  5DDT A;  2ICX A;  2PA4 A;  4JD0 A;  5CQP A;  1G1L A;  4C2S A;  1H4E A;  2XMH A;  1ZJP A;  2W0W A;  1H7F A;  3I0D A;  4FCE A;  3I0E A;  1V82 A;  2YC3 A;  4BQH A;  1NHE B;  2JCJ A;  1ZCY A;  1H5S D;  1OMX A;  4FRB A;  4HO0 A;  5FTV A;  3I0H A;  4LW6 A;  4KNX A;  4EE4 A;  1ZJO A;  4UEG A;  2JCL A;  1FR8 A;  1FRW A;  2FYC B;  1SS9 A;  1O7O A;  3OC9 A;  4HG6 A;  4FRQ A;  1ZCV A;  4FCU A;  1R7V A;  4P00 A;  3TZT A;  3CKO A;  1ZI5 A;  4B4G A;  5C38 A;  3U2X A;  1K4V A;  2GGO A;  2V0J A;  5CMI A;  5AJN A;  4B4B A;  5BXC A;  1GQ9 A;  1G9R A;  1H4D A;  2Y4M A;  2Y4J A;  4ASJ A;  1G3L A;  1FZW A;  3V90 A;  5IDS A;  3CKN A;  3NGW A;  5C1L A;  2BO8 A;  2P6W A;  2ZU9 A;  3OH4 A;  5FUH A;  2VFZ A;  1ZHJ A;  2WVK A;  5HS2 A;  4Y6U A;  2FYB A;  2V0K A;  3SXC A;  4D11 C;  5C3A A;  3U2V A;  2GGQ A;  2VS5 A;  4HOC A;  2AGD A;  4B4M A;  1W57 A;  3D8V A;  3V0P A;  4FRE A;  2YQC A;  4Y64 A;  1GWW A;  1R82 A;  4EVW A;  1H5R A;  1WT2 A;  4FRO A;  1G2V A;  4EEM A;  1QWJ A;  1G8O A;  4NAL A;  4Y9X A;  2ZU7 A;  3SXB A;  2RJ1 A;  4FIX A;  1INJ A;  4G3S A;  5CMG X;  3Q7U A;  1HJL A;  4KPZ A;  5C47 A;  3PNN A;  3USQ A;  1NKH B;  1FXJ A;  2RJ9 A;  4YS8 A;  2XWN A;  2WAW A;  2I5E A;  3E26 A;  4MYB A;  4HO3 A;  2RJ8 A;  1R81 A;  1NF5 B;  3SXA A;  1ZCT A;  3I0G A;  1YP4 A;  4KRV A;  3DJ4 A;  2J0B A;  1MP3 A;  4Y7G A;  2DPW A;  1PZY B;  1ZJ0 A;  1INI A;  2FYD B;  2APC A;  1XZ6 A;  3I0J A;  4KPX A;  3PKQ A;  3JUJ A;  4G3P A;  1MP4 A;  1ZIZ A;  1HM0 A;  1R7X A;  2AM4 A;  1H5T B;  2O1H A;  3OH0 A;  1VGT A;  3LW6 A;  1FXO A;  1TW1 A;  1ZJ1 A;  2AES A;  1S4O A;  2O1F A;  4EEO A;  1LVW A;  2YQJ A;  1TVY A;  4HCQ A;  4HO4 A;  1KWS A;  4IRQ A;  4P02 A;  4KC4 A;  1GX4 A;  4FRD A;  3FWW A;  1G93 A;  1ZI3 A;  1H7E A;  2CU2 A;  1S4N A;  3Q80 A;  3SX5 A;  3U2W A;  2RJ6 A;  1EYR A;  1JYK A;  5FU0 A;  2YQH A;  1H7G A;  4O6M A;  2JCO A;  3R3I A;  4GBP A;  5C4C A;  2YCM A;  3HL3 A;  3JUK A;  5JQQ A;  3OAM A;  3KIA A;  1O7Q A;  1VGZ A;  2QGI A;  2AEC A;  1JV1 A;  1ZJ2 A;  4E1K A;  1H3M A;  5C4B A;  2I7B A;  2BO4 A;  1H7L A;  3U2U A;  1VH1 A;  1H5T A;  4AAW A;  3SXE A;  1WT1 A;  3SPT A;  2AE7 A;  1V84 A;  3V0Q A;  4EE3 A;  4FRP A;  3SX3 A;  3OGZ A;  1EZI A;  4J18 A;  4D11 A;  2FFV A;  2BO6 A;  2O1G A;  4EE5 A;  1VH3 A;  4MND A;  5C36 A;  2C0N A;  2X65 A;  1G0R A;  3CKV A;  1OMZ A;  2PX7 A;  2BO7 A;  3OH3 A;  1QGS A;  4DE7 A;  1NWG B;  4HO2 A;  2ICY A;  1ZI1 A;  2XWM A;  3T7M A;  3QVB A;  1WT0 A;  2XWL A;  3I0K A;  3EE5 A;  2D0J A;  2YES A;  3CU0 A;  2Y4L A;  4KC2 A;  2OEG A;  1VPA A;  1ZJ3 A;  5C8R A;  4HO5 A;  1NQI B;  4AYJ A;  5C49 A;  3JTJ A;  2VSH A;  1MC3 A;  1ZCU A;  4Y7V A;  1ON8 A;  4FRM A;  5FV9 A;  3V91 A;  1WT3 A;  3I0L A;  3GUE A;  4BMA A;  4ASY A;  1FGX A;  2E8B A;  4D0Z A;  2RIT A;  4ARW A;  2X5Z A;  4K6R A;  3TQD A;  1JYL A;  1IIN A;  3T7N A;  1LL3 A;  2Y4K A; 
#chains in the Genus database with same CATH homology
 3U0Y A;  4KC1 A;  3V0N A;  2QKX A;  4G87 A;  3IOI A;  5C4E A;  2NXV A;  2AH9 A;  2VK9 A;  2Z87 A;  2J0A A;  1I52 A;  1FO8 A;  4FRL A;  1R7T A;  5L6V A;  1LZI A;  4KXO A;  1VZT A;  1H7T A;  3Q4S A;  3CKQ A;  3CKJ A;  2QH5 A;  2OI6 A;  2RIZ A;  4Y7T A;  1G23 A;  2VSI A;  4NAK A;  3ZGG A;  4D0T A;  3SX7 A;  1JVD A;  3FOQ A;  4Y6N A;  1VZX A;  2OI5 A;  2MZB A;  1WVC A;  1TW5 A;  3V8Y A;  4DEC A;  4KT7 A;  4M2B A;  2AM5 A;  2FFU A;  2X60 A;  5FU8 A;  2RIY A;  2RJ5 A;  5EJ1 A;  5AJO A;  2YQS A;  4Q7C A;  2RJ4 A;  2E3D A;  2ZU8 A;  3USR A;  2W0V A;  3V0L A;  1OQM B;  5C48 A;  3RMW A;  1PZT A;  5EJZ A;  1W55 A;  2WE9 A;  4NAN A;  3U2T A;  1LL2 A;  1GA8 A;  1H4C A;  4R7P A;  4G3Q A;  4CVH A;  3DUV A;  2V0L A;  4O6N A;  1FR9 A;  5J49 A;  3OH2 A;  3U0X A;  1H7Q A;  2Y6P A;  1JVG A;  5CMH A;  5FYE A;  1G97 A;  2RJ7 A;  5IFY A;  5CQM X;  5IDT A;  1QG8 A;  3I0C A;  1VGW A;  3V0O A;  5FTS A;  3OKR A;  2FYA A;  1TZF A;  1HM8 A;  4M2A A;  3N9W A;  4B2X A;  3ZLK A;  1LL0 A;  3SXD A;  2VXM A;  3T7O A;  1ON6 A;  2YC5 A;  5D92 A;  3E25 A;  4B42 A;  5AJP A;  4AC3 A;  3BCV A;  3BRK X;  4HO9 A;  4MIX A;  1GQC A;  1H5R B;  2D7R A;  5C1H A;  1R7U A;  1W77 A;  3K8D A;  1FWY A;  1YP2 A;  1VIC A;  1VZU A;  1FOA A;  1NMM B;  1FO9 A;  4CJB A;  2P72 A;  5CQN X;  1FG5 N;  3F1Y A;  4ECM A;  1HM9 A;  2A8U A;  4HO8 A;  3ZF8 A;  4B3U A;  2FY7 A;  4LW3 A;  5CMF X;  1O0R A;  1ZDF A;  1XHB A;  1Z90 A;  1GWV A;  5D91 A;  5C4D A;  1ZI4 A;  5C4F A;  3OH1 A;  5CQO A;  2OEF A;  5C1G A;  1O23 B;  2VXL A;  2VS3 A;  2VD4 A;  3CGX A;  1MP5 A;  2OI7 A;  4KQL A;  1H5S B;  2WGZ A;  4CJC A;  4M28 A;  1E5K A;  3DK5 A;  1G95 A;  4NAI A;  3SX8 A;  1R7Y A;  3D5N A;  2XME A;  2UX8 A;  1R80 A;  1LZ7 A;  1YRO B;  3F1C A;  3V0M A;  4CJ8 A;  3RSB A;  2Z86 A;  4EEA A;  4FQW A;  1FGG A;  4JIS A;  3ZGF A;  2A8W A;  3I0I X;  5C3B A;  1V83 A;  1WSZ A;  4ZDQ A;  3V8Z A;  3POL A;  1HJJ A;  4DDZ A;  5L6S A;  5DDV A;  1HV9 A;  2Q4J A;  4HO6 A;  5EIY A;  2JCK A;  3SXG A;  1YP3 A;  5I1F A;  2I5K A;  3IOJ A;  4Y7U A;  2V0H A;  2WVM A;  4IRP A;  4B5B A;  2V0I A;  2PGV A;  3PKP A;  3R2W A;  1VGU A;  3IOH A;  5C3D A;  4B2W A;  1JV3 A;  2RJ0 A;  4L41 C;  5CQL X;  1H5S A;  4D48 A;  4Y7F A;  5CMJ A;  2WEE A;  1H7H A;  4EEG A;  3D98 A;  1LZJ A;  4M4K A;  1VM8 A;  1GX0 A;  3O3P A;  2D7I A;  4Y63 A;  3ZLL A;  3ST8 A;  2Y7A A;  1IIM A;  4XWI A;  4AYL A;  2WVL A;  4FRH A;  4Y62 A;  2RIX A;  1S4P A;  1ZDG A;  2X5S A;  3I0F A;  3RMV A;  2AM3 A;  1LZ0 A;  1QGQ A;  3K8E A;  2PGY A;  4FIY A;  1H5S C;  4FRA A;  2VS4 A;  4KNR A;  2P73 A;  5DDT A;  2ICX A;  2PA4 A;  4JD0 A;  5CQP A;  1G1L A;  4C2S A;  1H4E A;  2XMH A;  1ZJP A;  2W0W A;  1H7F A;  3I0D A;  4FCE A;  3I0E A;  1V82 A;  2YC3 A;  4BQH A;  1NHE B;  2JCJ A;  1ZCY A;  1H5S D;  1OMX A;  4FRB A;  4HO0 A;  5FTV A;  3I0H A;  4LW6 A;  4KNX A;  4EE4 A;  1ZJO A;  4UEG A;  2JCL A;  1FR8 A;  1FRW A;  2FYC B;  1SS9 A;  1O7O A;  3OC9 A;  4HG6 A;  4FRQ A;  1ZCV A;  4FCU A;  1R7V A;  4P00 A;  3TZT A;  3CKO A;  1ZI5 A;  4B4G A;  5C38 A;  3U2X A;  1K4V A;  2GGO A;  2V0J A;  5CMI A;  5AJN A;  4B4B A;  5BXC A;  1GQ9 A;  1G9R A;  1H4D A;  2Y4M A;  2Y4J A;  4ASJ A;  1G3L A;  1FZW A;  3V90 A;  5IDS A;  3CKN A;  3NGW A;  5C1L A;  2BO8 A;  2P6W A;  2ZU9 A;  3OH4 A;  5FUH A;  2VFZ A;  1ZHJ A;  2WVK A;  5HS2 A;  4Y6U A;  2FYB A;  2V0K A;  3SXC A;  4D11 C;  5C3A A;  3U2V A;  2GGQ A;  2VS5 A;  4HOC A;  2AGD A;  4B4M A;  1W57 A;  3D8V A;  3V0P A;  4FRE A;  2YQC A;  4Y64 A;  1GWW A;  1R82 A;  4EVW A;  1H5R A;  1WT2 A;  4FRO A;  1G2V A;  4EEM A;  1QWJ A;  1G8O A;  4NAL A;  4Y9X A;  2ZU7 A;  3SXB A;  2RJ1 A;  4FIX A;  1INJ A;  4G3S A;  5CMG X;  3Q7U A;  1HJL A;  4KPZ A;  5C47 A;  3PNN A;  3USQ A;  1NKH B;  1FXJ A;  2RJ9 A;  4YS8 A;  2XWN A;  2WAW A;  2I5E A;  3E26 A;  4MYB A;  4HO3 A;  2RJ8 A;  1R81 A;  1NF5 B;  3SXA A;  1ZCT A;  3I0G A;  1YP4 A;  4KRV A;  3DJ4 A;  2J0B A;  1MP3 A;  4Y7G A;  2DPW A;  1PZY B;  1ZJ0 A;  1INI A;  2FYD B;  2APC A;  1XZ6 A;  3I0J A;  4KPX A;  3PKQ A;  3JUJ A;  4G3P A;  1MP4 A;  1ZIZ A;  1HM0 A;  1R7X A;  2AM4 A;  1H5T B;  2O1H A;  3OH0 A;  1VGT A;  3LW6 A;  1FXO A;  1TW1 A;  1ZJ1 A;  2AES A;  1S4O A;  2O1F A;  4EEO A;  1LVW A;  2YQJ A;  1TVY A;  4HCQ A;  4HO4 A;  1KWS A;  4IRQ A;  4P02 A;  4KC4 A;  1GX4 A;  4FRD A;  3FWW A;  1G93 A;  1ZI3 A;  1H7E A;  2CU2 A;  1S4N A;  3Q80 A;  3SX5 A;  3U2W A;  2RJ6 A;  1EYR A;  1JYK A;  5FU0 A;  2YQH A;  1H7G A;  4O6M A;  2JCO A;  3R3I A;  4GBP A;  5C4C A;  2YCM A;  3HL3 A;  3JUK A;  5JQQ A;  3OAM A;  3KIA A;  1O7Q A;  1VGZ A;  2QGI A;  2AEC A;  1JV1 A;  1ZJ2 A;  4E1K A;  1H3M A;  5C4B A;  2I7B A;  2BO4 A;  1H7L A;  3U2U A;  1VH1 A;  1H5T A;  4AAW A;  3SXE A;  1WT1 A;  3SPT A;  2AE7 A;  1V84 A;  3V0Q A;  4EE3 A;  4FRP A;  3SX3 A;  3OGZ A;  1EZI A;  4J18 A;  4D11 A;  2FFV A;  2BO6 A;  2O1G A;  4EE5 A;  1VH3 A;  4MND A;  5C36 A;  2C0N A;  2X65 A;  1G0R A;  3CKV A;  1OMZ A;  2PX7 A;  2BO7 A;  3OH3 A;  1QGS A;  4DE7 A;  1NWG B;  4HO2 A;  2ICY A;  1ZI1 A;  2XWM A;  3T7M A;  3QVB A;  1WT0 A;  2XWL A;  3I0K A;  3EE5 A;  2D0J A;  2YES A;  3CU0 A;  2Y4L A;  4KC2 A;  2OEG A;  1VPA A;  1ZJ3 A;  5C8R A;  4HO5 A;  1NQI B;  4AYJ A;  5C49 A;  3JTJ A;  2VSH A;  1MC3 A;  1ZCU A;  4Y7V A;  1ON8 A;  4FRM A;  5FV9 A;  3V91 A;  1WT3 A;  3I0L A;  3GUE A;  4BMA A;  4ASY A;  1FGX A;  2E8B A;  4D0Z A;  2RIT A;  4ARW A;  2X5Z A;  4K6R A;  3TQD A;  1JYL A;  1IIN A;  3T7N A;  1LL3 A;  2Y4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...