3BCVA

Crystal structure of a putative glycosyltransferase from bacteroides fragilis
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
216
structure length
196
Chain Sequence
LIPKVSVIVPIYNVEKYLDQCVQALLAQTLSDIEIILIDDESPDNCPKICDDYAAQYPNIKVIHKKNAGLGMACNSGLDVATGEYVAFCDSDDYVDSDMYMTMYNVAQKYTCDAVFTFKLYKNKNEIHTLLKDLIASDPYAREERAIQVSAKVVLYRRNLIEKKHLRFVSERILPSEDLIFNVDVLANSNIVCVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative glycosyltransferase protein
publication title Crystal structure of a putative glycosyltransferase from Bacteroides fragilis.
rcsb
source organism Bacteroides fragilis
total genus 67
structure length 196
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3bcvA00
2RJ8A 1FOAA 5C4CA 3JUKA 2Y6PA 3U2XA 2P6WA 1HJJA 4KPZA 4HO9A 2PGYA 3Q7UA 4LW6A 1VZXA 3HL3A 2CU2A 2X60A 2V0JA 1WVCA 1G95A 4NALA 2WVLA 5C3BA 3U2WA 3OGZA 1ZI5A 4Y63A 5CMIA 4FREA 1LVWA 3I0FA 4KT7A 5C4DA 1S4OA 1ZCYA 1IIMA 4HO8A 4Y64A 4DECA 3PKQA 2VS4A 1ZI3A 1NKHB 4D11C 4IRQA 2WGZA 2VS5A 3E25A 4G87A 4G3SA 5CQMX 1V83A 1V84A 3Q4SA 1GWVA 3RMWA 1ZCVA 3T7NA 1LL3A 3U0YA 1G0RA 3CKQA 3SX7A 3V90A 3V0OA 1NF5B 3QVBA 1S4NA 3I0KA 4ZDQA 4HO0A 3V0LA 3T7MA 5IDTA 4BMAA 4CVHA 1TZFA 1PZTA 3GUEA 3OH1A 4BQHA 4EE3A 1R7XA 2Z86A 4Y6UA 1H5SC 2RIYA 2AE7A 4KXOA 3I0JA 1MP3A 1FO9A 3SXBA 3OH4A 3I0IX 2O1HA 5L6SA 5AJNA 1ZJPA 3FOQA 2PA4A 5JQQA 2ZU7A 1K4VA 3V8ZA 2I5KA 3V8YA 4HO5A 3CU0A 2FYBA 2FFUA 1VGWA 4EEAA 5C8RA 2V0KA 2V0IA 1MP5A 2RJ4A 2Y4MA 1FR8A 2FYCB 2YQSA 4Y62A 4EVWA 3USQA 1H3MA 4D0TA 4AC3A 2AH9A 2D7RA 4MYBA 5EJ1A 5BXCA 1R7YA 4NAIA 2FFVA 1E5KA 1H4CA 2V0LA 2APCA 4B2XA 2Z87A 2I7BA 4HO3A 3V0NA 5AJOA 1TW5A 5C4EA 4C2SA 2P73A 2YQCA 4FQWA 3BCVA 3ZGGA 4J18A 2V0HA 1G8OA 1H5SA 5C3AA 4AYLA 3IOIA 4FCEA 3D8VA 1O7QA 4M4KA 5FU8A 1JV3A 1G1LA 1KWSA 3BRKX 3POLA 2XMEA 3SX5A 3OAMA 1GX4A 1V82A 4HO2A 5C4FA 1JV1A 3N9WA 5C48A 1R80A 3LW6A 3SXCA 5FTVA 1NQIB 1JYKA 1ZI4A 1ZJOA 5FTSA 2YCMA 3R3IA 4AYJA 4KC2A 4KNRA 1ZI1A 5HS2A 3JTJA 3RMVA 1FXOA 1G23A 2AECA 3I0CA 3I0LA 4DE7A 2D7IA 2Y7AA 2FYDB 2JCOA 2ICXA 1GQ9A 4B42A 3U2UA 1YP2A 4EEOA 2FYAA 2OI5A 1H5TB 4G3QA 3SXAA 4Y7FA 1SS9A 2YQJA 3U2TA 5C3DA 2VSIA 4ASYA 1H7GA 3D5NA 1LL0A 2O1GA 1YP3A 1VGUA 3E26A 4YS8A 2VS3A 1VH1A 1INIA 4CJBA 1JVDA 5CQLX 2WVMA 2JCJA 5CQOA 1LZIA 2RJ6A 3K8DA 3PKPA 2RITA 1HJLA 3CKOA 3V0QA 4KC4A 2JCLA 1FRWA 3IOHA 2PGVA 3V91A 2OI7A 1R7TA 3ZLKA 5CMHA 1MC3A 2VSHA 3Q80A 1FXJA 5CQNX 1LZ7A 4B4GA 5DDVA 1W57A 3ZGFA 1FWYA 4FROA 2X65A 3F1CA 5C38A 4L41C 4ECMA 1EZIA 3OH3A 1S4PA 1H5RA 1G2VA 2BO7A 1HM8A 2RIZA 4KQLA 5FYEA 4HO4A 4M2AA 1ZCUA 2Y4JA 3NGWA 3SX3A 4KNXA 4D11A 2ZU8A 3EE5A 4K6RA 1NHEB 1VZTA 4B2WA 1QWJA 4ARWA 1ZJ2A 2RJ5A 5I1FA 1FO8A 2XWLA 2E8BA 3RSBA 3OC9A 3ST8A 2VD4A 2RJ0A 2YC3A 3TZTA 3I0EA 2QGIA 3PNNA 1ON8A 2GGOA 1W55A 5C47A 1QG8A 3T7OA 4EEGA 1GQCA 4JISA 2YQHA 1LL2A 1TVYA 1R7UA 5C36A 1O7OA 2A8WA 1ZCTA 1XHBA 4HOCA 4AAWA 3ZLLA 2OEGA 2RJ9A 2OEFA 2QKXA 2VFZA 4Y9XA 1VM8A 1VICA 5FV9A 4UEGA 5AJPA 1WT1A 2W0VA 1R7VA 4KC1A 2AGDA 1R81A 2WVKA 2D0JA 3I0DA 3CGXA 3CKVA 1H7HA 1G93A 2XMHA 5FUHA 2Y4LA 4XWIA 1ZJ0A 1ZIZA 2E3DA 4HO6A 4R7PA 3SPTA 1H7FA 4IRPA 2AESA 2GGQA 2RJ1A 1WT2A 1H7QA 2XWMA 2VXMA 4B5BA 3DK5A 1VPAA 2BO8A 1I52A 1GWWA 1Z90A 1G3LA 1WSZA 1TW1A 2YESA 4DDZA 5C49A 1OMZA 1LZ0A 3OKRA 1OQMB 3V0MA 1WT3A 4M28A 1H5TA 2DPWA 5DDTA 1FG5N 1O0RA 2O1FA 1O23B 1ON6A 1VGTA 3SX8A 1YROB 2RJ7A 1H5SD 4FRLA 4Y7TA 3V0PA 4KRVA 4Y7GA 2W0WA 1WT0A 5IDSA 1FGGA 3OH2A 1FZWA 2AM5A 2ICYA 1G97A 4FRQA 2X5SA 3KIAA 2Q4JA 3IOJA 1MP4A 2QH5A 4FRHA 3CKJA 2XWNA 1LZJA 4FCUA 4P02A 5CQPA 2WE9A 3I0HA 2WEEA 1W77A 1H4DA 1IINA 4NANA 5IFYA 2A8UA 4EE5A 1GX0A 1XZ6A 1HM0A 2VXLA 1ZDGA 3TQDA 4E1KA 2PX7A 2Y4KA 1VGZA 2RIXA 3R2WA 4Y7UA 3DJ4A 3U2VA 2WAWA 1EYRA 2I5EA 1HV9A 1H7LA 4JD0A 4ASJA 3I0GA 1G9RA 3O3PA 5C4BA 3OH0A 2P72A 3ZF8A 2UX8A 1H5RB 4MNDA 4G3PA 2AM3A 5J49A 2AM4A 5C1HA 2X5ZA 1QGSA 5CMFX 1PZYB 1INJA 2YC5A 4FRBA 1JVGA 4GBPA 1VZUA 4HCQA 4FRPA 4HG6A 1NWGB 1FR9A 3F1YA 4B3UA 1YP4A 4FRMA 3SXEA 4M2BA 4P00A 5EIYA 4FRDA 1HM9A 2NXVA 3SXGA 4Y7VA 4NAKA 1QGQA 2JCKA 3D98A 1FGXA 4FRAA 3FWWA 1NMMB 4EEMA 5EJZA 1ZDFA 2BO4A 5C1LA 5L6VA 2ZU9A 3U0XA 2OI6A 1H7TA 1VH3A 4LW3A 4B4BA 4CJ8A 3CKNA 1H5SB 1OMXA 1ZJ3A 2FY7A 3JUJA 5CMGX 1ZJ1A 5FU0A 4D48A 4D0ZA 4EE4A 2MZBA 1H7EA 1GA8A 3USRA 2BO6A 1R82A 5C1GA 4CJCA 3K8EA 4KPXA 5CMJA 4Y6NA 3SXDA 1ZHJA 4B4MA 1JYLA 3DUVA 1H4EA
chains in the Genus database with same CATH superfamily
2RJ8A 1FOAA 5C4CA 3JUKA 2Y6PA 3U2XA 2P6WA 1HJJA 4KPZA 4HO9A 2PGYA 3Q7UA 4LW6A 1VZXA 3HL3A 2CU2A 2X60A 2V0JA 1WVCA 1G95A 4NALA 2WVLA 5C3BA 3U2WA 3OGZA 1ZI5A 4Y63A 5CMIA 4FREA 1LVWA 3I0FA 4KT7A 5C4DA 1S4OA 1ZCYA 1IIMA 4HO8A 4Y64A 4DECA 3PKQA 2VS4A 1ZI3A 1NKHB 4D11C 4IRQA 2WGZA 2VS5A 3E25A 4G87A 4G3SA 5CQMX 2J0BA 1V83A 1V84A 3Q4SA 1GWVA 3RMWA 1ZCVA 3T7NA 1LL3A 3U0YA 1G0RA 3CKQA 3SX7A 3V90A 3V0OA 1NF5B 3QVBA 1S4NA 3I0KA 4ZDQA 4HO0A 3V0LA 3T7MA 5IDTA 4BMAA 4CVHA 1TZFA 1PZTA 3GUEA 3OH1A 4BQHA 4EE3A 1R7XA 2Z86A 4Y6UA 1H5SC 2RIYA 4FIXA 2AE7A 4KXOA 3I0JA 1MP3A 1FO9A 3SXBA 3OH4A 3I0IX 2O1HA 5L6SA 5AJNA 1ZJPA 3FOQA 2PA4A 5JQQA 2ZU7A 1K4VA 3V8ZA 2I5KA 3V8YA 4HO5A 3CU0A 2FYBA 2FFUA 1VGWA 4EEAA 5C8RA 2V0KA 2V0IA 1MP5A 2RJ4A 2Y4MA 1FR8A 2FYCB 2YQSA 4Y62A 4EVWA 3USQA 1H3MA 4D0TA 4AC3A 2AH9A 2D7RA 4MYBA 5EJ1A 5BXCA 1R7YA 4NAIA 2FFVA 1E5KA 1H4CA 2V0LA 2APCA 4B2XA 2Z87A 2I7BA 4HO3A 3V0NA 5AJOA 1TW5A 5C4EA 4C2SA 2P73A 2YQCA 4FQWA 3BCVA 3ZGGA 4J18A 2V0HA 1G8OA 1H5SA 5C3AA 4AYLA 3IOIA 4FCEA 3D8VA 1O7QA 4M4KA 5FU8A 1JV3A 1G1LA 1KWSA 3BRKX 3POLA 2XMEA 3SX5A 3OAMA 1GX4A 1V82A 4HO2A 5C4FA 1JV1A 3N9WA 5C48A 1R80A 3LW6A 3SXCA 5FTVA 1NQIB 1JYKA 1ZI4A 1ZJOA 5FTSA 2YCMA 3R3IA 4AYJA 4KC2A 4KNRA 1ZI1A 5HS2A 3JTJA 3RMVA 1FXOA 1G23A 2AECA 3I0CA 3I0LA 4DE7A 2D7IA 2Y7AA 2FYDB 2JCOA 2ICXA 1GQ9A 4B42A 3U2UA 1YP2A 4EEOA 2FYAA 2OI5A 1H5TB 4G3QA 3SXAA 4Y7FA 1SS9A 2YQJA 3U2TA 5C3DA 2VSIA 4ASYA 1H7GA 3D5NA 1LL0A 2O1GA 1YP3A 1VGUA 3E26A 4YS8A 2VS3A 1VH1A 1INIA 4CJBA 1JVDA 5CQLX 2WVMA 2JCJA 5CQOA 1LZIA 2RJ6A 3K8DA 3PKPA 2RITA 1HJLA 3CKOA 3V0QA 4KC4A 2JCLA 1FRWA 2VK9A 3IOHA 5D92A 2PGVA 3V91A 2OI7A 1R7TA 3ZLKA 5CMHA 1MC3A 5D91A 2VSHA 3Q80A 1FXJA 5CQNX 1LZ7A 4B4GA 4O6MA 5DDVA 1W57A 3ZGFA 1FWYA 4FROA 2X65A 3F1CA 5C38A 4L41C 4ECMA 1EZIA 3OH3A 1S4PA 1H5RA 1G2VA 2BO7A 1HM8A 2RIZA 4KQLA 5FYEA 4HO4A 4M2AA 1ZCUA 2Y4JA 3NGWA 3SX3A 4KNXA 4D11A 2ZU8A 3EE5A 4K6RA 1NHEB 1VZTA 4B2WA 1QWJA 4ARWA 1ZJ2A 2RJ5A 5I1FA 1FO8A 2XWLA 2E8BA 3RSBA 2C0NA 3OC9A 3ST8A 2VD4A 2RJ0A 2YC3A 3TZTA 3I0EA 4O6NA 2QGIA 3PNNA 1ON8A 4MIXA 2GGOA 1W55A 5C47A 1QG8A 3T7OA 4EEGA 1GQCA 4JISA 2YQHA 1LL2A 1TVYA 1R7UA 4FIYA 5C36A 1O7OA 2A8WA 1ZCTA 1XHBA 4HOCA 4AAWA 3ZLLA 2OEGA 2RJ9A 2OEFA 2QKXA 2VFZA 4Y9XA 1VM8A 1VICA 5FV9A 4UEGA 5AJPA 1WT1A 2W0VA 1R7VA 4KC1A 2AGDA 1R81A 2WVKA 2D0JA 3I0DA 3CGXA 3CKVA 1H7HA 1G93A 2XMHA 5FUHA 2Y4LA 4XWIA 1ZJ0A 1ZIZA 2E3DA 4HO6A 4R7PA 3SPTA 1H7FA 4IRPA 2AESA 2GGQA 2RJ1A 1WT2A 1H7QA 2XWMA 2VXMA 4B5BA 3DK5A 1VPAA 2BO8A 4Q7CA 1I52A 1GWWA 1Z90A 1G3LA 1WSZA 1TW1A 2YESA 4DDZA 5C49A 1OMZA 1LZ0A 3OKRA 1OQMB 3V0MA 1WT3A 4M28A 1H5TA 2DPWA 5DDTA 1FG5N 1O0RA 2O1FA 1O23B 1ON6A 1VGTA 3SX8A 1YROB 2RJ7A 1H5SD 4FRLA 4Y7TA 3V0PA 4KRVA 4Y7GA 2W0WA 1WT0A 5IDSA 1FGGA 3OH2A 1FZWA 2AM5A 2ICYA 1G97A 4FRQA 2X5SA 3KIAA 2Q4JA 3IOJA 1MP4A 2QH5A 4FRHA 3CKJA 2XWNA 1LZJA 4FCUA 4P02A 5CQPA 2WE9A 3I0HA 2WEEA 1W77A 1H4DA 1IINA 4NANA 5IFYA 2A8UA 4EE5A 1GX0A 1XZ6A 1HM0A 2VXLA 1ZDGA 3TQDA 4E1KA 2PX7A 2Y4KA 1VGZA 2RIXA 3R2WA 4Y7UA 3DJ4A 3U2VA 2WAWA 1EYRA 2I5EA 1HV9A 1H7LA 4JD0A 4ASJA 3I0GA 1G9RA 3O3PA 5C4BA 3OH0A 2P72A 3ZF8A 2UX8A 1H5RB 4MNDA 4G3PA 2AM3A 5J49A 2AM4A 5C1HA 2X5ZA 1QGSA 5CMFX 1PZYB 1INJA 2YC5A 4FRBA 1JVGA 4GBPA 1VZUA 4HCQA 4FRPA 4HG6A 1NWGB 1FR9A 3F1YA 4B3UA 1YP4A 4FRMA 3SXEA 4M2BA 4P00A 5EIYA 4FRDA 1HM9A 2NXVA 3SXGA 4Y7VA 4NAKA 1QGQA 2JCKA 3D98A 1FGXA 4FRAA 3FWWA 1NMMB 4EEMA 5EJZA 1ZDFA 2BO4A 5C1LA 5L6VA 2ZU9A 3U0XA 2OI6A 1H7TA 1VH3A 4LW3A 4B4BA 4CJ8A 3CKNA 1H5SB 1OMXA 1ZJ3A 2FY7A 3JUJA 5CMGX 1ZJ1A 5FU0A 4D48A 4D0ZA 4EE4A 2MZBA 1H7EA 1GA8A 3USRA 2BO6A 2J0AA 1R82A 5C1GA 4CJCA 3K8EA 4KPXA 5CMJA 4Y6NA 3SXDA 1ZHJA 4B4MA 1JYLA 3DUVA 1H4EA
chains in the Genus database with same CATH topology
2RJ8A 1FOAA 5C4CA 3JUKA 2Y6PA 3U2XA 2P6WA 1HJJA 4KPZA 4HO9A 2PGYA 3Q7UA 4LW6A 1VZXA 3HL3A 2CU2A 2X60A 2V0JA 1WVCA 1G95A 4NALA 2WVLA 5C3BA 3U2WA 3OGZA 1ZI5A 4Y63A 5CMIA 4FREA 1LVWA 3I0FA 4KT7A 5C4DA 1S4OA 1ZCYA 1IIMA 4HO8A 4Y64A 4DECA 3PKQA 2VS4A 1ZI3A 1NKHB 4D11C 4IRQA 2WGZA 2VS5A 3E25A 4G87A 4G3SA 5CQMX 2J0BA 1V83A 1V84A 3Q4SA 1GWVA 3RMWA 1ZCVA 3T7NA 1LL3A 3U0YA 1G0RA 3CKQA 3SX7A 3V90A 3V0OA 1NF5B 3QVBA 1S4NA 3I0KA 4ZDQA 4HO0A 3V0LA 3T7MA 5IDTA 4BMAA 4CVHA 1TZFA 1PZTA 3GUEA 3OH1A 4BQHA 4EE3A 1R7XA 2Z86A 4Y6UA 1H5SC 2RIYA 4FIXA 2AE7A 4KXOA 3I0JA 1MP3A 1FO9A 3SXBA 3OH4A 3I0IX 2O1HA 5L6SA 5AJNA 1ZJPA 3FOQA 2PA4A 5JQQA 2ZU7A 1K4VA 3V8ZA 2I5KA 3V8YA 4HO5A 3CU0A 2FYBA 2FFUA 1VGWA 4EEAA 5C8RA 2V0KA 2V0IA 1MP5A 2RJ4A 2Y4MA 1FR8A 2FYCB 2YQSA 4Y62A 4EVWA 3USQA 1H3MA 4D0TA 4AC3A 2AH9A 2D7RA 4MYBA 5EJ1A 5BXCA 1R7YA 4NAIA 2FFVA 1E5KA 1H4CA 2V0LA 2APCA 4B2XA 2Z87A 2I7BA 4HO3A 3V0NA 5AJOA 1TW5A 5C4EA 4C2SA 2P73A 2YQCA 4FQWA 3BCVA 3ZGGA 4J18A 2V0HA 1G8OA 1H5SA 5C3AA 4AYLA 3IOIA 4FCEA 3D8VA 1O7QA 4M4KA 5FU8A 1JV3A 1G1LA 1KWSA 3BRKX 3POLA 2XMEA 3SX5A 3OAMA 1GX4A 1V82A 4HO2A 5C4FA 1JV1A 3N9WA 5C48A 1R80A 3LW6A 3SXCA 5FTVA 1NQIB 1JYKA 1ZI4A 1ZJOA 5FTSA 2YCMA 3R3IA 4AYJA 4KC2A 4KNRA 1ZI1A 5HS2A 3JTJA 3RMVA 1FXOA 1G23A 2AECA 3I0CA 3I0LA 4DE7A 2D7IA 2Y7AA 2FYDB 2JCOA 2ICXA 1GQ9A 4B42A 3U2UA 1YP2A 4EEOA 2FYAA 2OI5A 1H5TB 4G3QA 3SXAA 4Y7FA 1SS9A 2YQJA 3U2TA 5C3DA 2VSIA 4ASYA 1H7GA 3D5NA 1LL0A 2O1GA 1YP3A 1VGUA 3E26A 4YS8A 2VS3A 1VH1A 1INIA 4CJBA 1JVDA 5CQLX 2WVMA 2JCJA 5CQOA 1LZIA 2RJ6A 3K8DA 3PKPA 2RITA 1HJLA 3CKOA 3V0QA 4KC4A 2JCLA 1FRWA 2VK9A 3IOHA 5D92A 2PGVA 3V91A 2OI7A 1R7TA 3ZLKA 5CMHA 1MC3A 5D91A 2VSHA 3Q80A 1FXJA 5CQNX 1LZ7A 4B4GA 4O6MA 5DDVA 1W57A 3ZGFA 1FWYA 4FROA 2X65A 3F1CA 5C38A 4L41C 4ECMA 1EZIA 3OH3A 1S4PA 1H5RA 1G2VA 2BO7A 1HM8A 2RIZA 4KQLA 5FYEA 4HO4A 4M2AA 1ZCUA 2Y4JA 3NGWA 3SX3A 4KNXA 4D11A 2ZU8A 3EE5A 4K6RA 1NHEB 1VZTA 4B2WA 1QWJA 4ARWA 1ZJ2A 2RJ5A 5I1FA 1FO8A 2XWLA 2E8BA 3RSBA 2C0NA 3OC9A 3ST8A 2VD4A 2RJ0A 2YC3A 3TZTA 3I0EA 4O6NA 2QGIA 3PNNA 1ON8A 4MIXA 2GGOA 1W55A 5C47A 1QG8A 3T7OA 4EEGA 1GQCA 4JISA 2YQHA 1LL2A 1TVYA 1R7UA 4FIYA 5C36A 1O7OA 2A8WA 1ZCTA 1XHBA 4HOCA 4AAWA 3ZLLA 2OEGA 2RJ9A 2OEFA 2QKXA 2VFZA 4Y9XA 1VM8A 1VICA 5FV9A 4UEGA 5AJPA 1WT1A 2W0VA 1R7VA 4KC1A 2AGDA 1R81A 2WVKA 2D0JA 3I0DA 3CGXA 3CKVA 1H7HA 1G93A 2XMHA 5FUHA 2Y4LA 4XWIA 1ZJ0A 1ZIZA 2E3DA 4HO6A 4R7PA 3SPTA 1H7FA 4IRPA 2AESA 2GGQA 2RJ1A 1WT2A 1H7QA 2XWMA 2VXMA 4B5BA 3DK5A 1VPAA 2BO8A 4Q7CA 1I52A 1GWWA 1Z90A 1G3LA 1WSZA 1TW1A 2YESA 4DDZA 5C49A 1OMZA 1LZ0A 3OKRA 1OQMB 3V0MA 1WT3A 4M28A 1H5TA 2DPWA 5DDTA 1FG5N 1O0RA 2O1FA 1O23B 1ON6A 1VGTA 3SX8A 1YROB 2RJ7A 1H5SD 4FRLA 4Y7TA 3V0PA 4KRVA 4Y7GA 2W0WA 1WT0A 5IDSA 1FGGA 3OH2A 1FZWA 2AM5A 2ICYA 1G97A 4FRQA 2X5SA 3KIAA 2Q4JA 3IOJA 1MP4A 2QH5A 4FRHA 3CKJA 2XWNA 1LZJA 4FCUA 4P02A 5CQPA 2WE9A 3I0HA 2WEEA 1W77A 1H4DA 1IINA 4NANA 5IFYA 2A8UA 4EE5A 1GX0A 1XZ6A 1HM0A 2VXLA 1ZDGA 3TQDA 4E1KA 2PX7A 2Y4KA 1VGZA 2RIXA 3R2WA 4Y7UA 3DJ4A 3U2VA 2WAWA 1EYRA 2I5EA 1HV9A 1H7LA 4JD0A 4ASJA 3I0GA 1G9RA 3O3PA 5C4BA 3OH0A 2P72A 3ZF8A 2UX8A 1H5RB 4MNDA 4G3PA 2AM3A 5J49A 2AM4A 5C1HA 2X5ZA 1QGSA 5CMFX 1PZYB 1INJA 2YC5A 4FRBA 1JVGA 4GBPA 1VZUA 4HCQA 4FRPA 4HG6A 1NWGB 1FR9A 3F1YA 4B3UA 1YP4A 4FRMA 3SXEA 4M2BA 4P00A 5EIYA 4FRDA 1HM9A 2NXVA 3SXGA 4Y7VA 4NAKA 1QGQA 2JCKA 3D98A 1FGXA 4FRAA 3FWWA 1NMMB 4EEMA 5EJZA 1ZDFA 2BO4A 5C1LA 5L6VA 2ZU9A 3U0XA 2OI6A 1H7TA 1VH3A 4LW3A 4B4BA 4CJ8A 3CKNA 1H5SB 1OMXA 1ZJ3A 2FY7A 3JUJA 5CMGX 1ZJ1A 5FU0A 4D48A 4D0ZA 4EE4A 2MZBA 1H7EA 1GA8A 3USRA 2BO6A 2J0AA 1R82A 5C1GA 4CJCA 3K8EA 4KPXA 5CMJA 4Y6NA 3SXDA 1ZHJA 4B4MA 1JYLA 3DUVA 1H4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RJ8 A;  1FOA A;  5C4C A;  3JUK A;  2Y6P A;  3U2X A;  2P6W A;  1HJJ A;  4KPZ A;  4HO9 A;  2PGY A;  3Q7U A;  4LW6 A;  1VZX A;  3HL3 A;  2CU2 A;  2X60 A;  2V0J A;  1WVC A;  1G95 A;  4NAL A;  2WVL A;  5C3B A;  3U2W A;  3OGZ A;  1ZI5 A;  4Y63 A;  5CMI A;  4FRE A;  1LVW A;  3I0F A;  4KT7 A;  5C4D A;  1S4O A;  1ZCY A;  1IIM A;  4HO8 A;  4Y64 A;  4DEC A;  3PKQ A;  2VS4 A;  1ZI3 A;  1NKH B;  4D11 C;  4IRQ A;  2WGZ A;  2VS5 A;  3E25 A;  4G87 A;  4G3S A;  5CQM X;  1V83 A;  1V84 A;  3Q4S A;  1GWV A;  3RMW A;  1ZCV A;  3T7N A;  1LL3 A;  3U0Y A;  1G0R A;  3CKQ A;  3SX7 A;  3V90 A;  3V0O A;  1NF5 B;  3QVB A;  1S4N A;  3I0K A;  4ZDQ A;  4HO0 A;  3V0L A;  3T7M A;  5IDT A;  4BMA A;  4CVH A;  1TZF A;  1PZT A;  3GUE A;  3OH1 A;  4BQH A;  4EE3 A;  1R7X A;  2Z86 A;  4Y6U A;  1H5S C;  2RIY A;  2AE7 A;  4KXO A;  3I0J A;  1MP3 A;  1FO9 A;  3SXB A;  3OH4 A;  3I0I X;  2O1H A;  5L6S A;  5AJN A;  1ZJP A;  3FOQ A;  2PA4 A;  5JQQ A;  2ZU7 A;  1K4V A;  3V8Z A;  2I5K A;  3V8Y A;  4HO5 A;  3CU0 A;  2FYB A;  2FFU A;  1VGW A;  4EEA A;  5C8R A;  2V0K A;  2V0I A;  1MP5 A;  2RJ4 A;  2Y4M A;  1FR8 A;  2FYC B;  2YQS A;  4Y62 A;  4EVW A;  3USQ A;  1H3M A;  4D0T A;  4AC3 A;  2AH9 A;  2D7R A;  4MYB A;  5EJ1 A;  5BXC A;  1R7Y A;  4NAI A;  2FFV A;  1E5K A;  1H4C A;  2V0L A;  2APC A;  4B2X A;  2Z87 A;  2I7B A;  4HO3 A;  3V0N A;  5AJO A;  1TW5 A;  5C4E A;  4C2S A;  2P73 A;  2YQC A;  4FQW A;  3BCV A;  3ZGG A;  4J18 A;  2V0H A;  1G8O A;  1H5S A;  5C3A A;  4AYL A;  3IOI A;  4FCE A;  3D8V A;  1O7Q A;  4M4K A;  5FU8 A;  1JV3 A;  1G1L A;  1KWS A;  3BRK X;  3POL A;  2XME A;  3SX5 A;  3OAM A;  1GX4 A;  1V82 A;  4HO2 A;  5C4F A;  1JV1 A;  3N9W A;  5C48 A;  1R80 A;  3LW6 A;  3SXC A;  5FTV A;  1NQI B;  1JYK A;  1ZI4 A;  1ZJO A;  5FTS A;  2YCM A;  3R3I A;  4AYJ A;  4KC2 A;  4KNR A;  1ZI1 A;  5HS2 A;  3JTJ A;  3RMV A;  1FXO A;  1G23 A;  2AEC A;  3I0C A;  3I0L A;  4DE7 A;  2D7I A;  2Y7A A;  2FYD B;  2JCO A;  2ICX A;  1GQ9 A;  4B42 A;  3U2U A;  1YP2 A;  4EEO A;  2FYA A;  2OI5 A;  1H5T B;  4G3Q A;  3SXA A;  4Y7F A;  1SS9 A;  2YQJ A;  3U2T A;  5C3D A;  2VSI A;  4ASY A;  1H7G A;  3D5N A;  1LL0 A;  2O1G A;  1YP3 A;  1VGU A;  3E26 A;  4YS8 A;  2VS3 A;  1VH1 A;  1INI A;  4CJB A;  1JVD A;  5CQL X;  2WVM A;  2JCJ A;  5CQO A;  1LZI A;  2RJ6 A;  3K8D A;  3PKP A;  2RIT A;  1HJL A;  3CKO A;  3V0Q A;  4KC4 A;  2JCL A;  1FRW A;  3IOH A;  2PGV A;  3V91 A;  2OI7 A;  1R7T A;  3ZLK A;  5CMH A;  1MC3 A;  2VSH A;  3Q80 A;  1FXJ A;  5CQN X;  1LZ7 A;  4B4G A;  5DDV A;  1W57 A;  3ZGF A;  1FWY A;  4FRO A;  2X65 A;  3F1C A;  5C38 A;  4L41 C;  4ECM A;  1EZI A;  3OH3 A;  1S4P A;  1H5R A;  1G2V A;  2BO7 A;  1HM8 A;  2RIZ A;  4KQL A;  5FYE A;  4HO4 A;  4M2A A;  1ZCU A;  2Y4J A;  3NGW A;  3SX3 A;  4KNX A;  4D11 A;  2ZU8 A;  3EE5 A;  4K6R A;  1NHE B;  1VZT A;  4B2W A;  1QWJ A;  4ARW A;  1ZJ2 A;  2RJ5 A;  5I1F A;  1FO8 A;  2XWL A;  2E8B A;  3RSB A;  3OC9 A;  3ST8 A;  2VD4 A;  2RJ0 A;  2YC3 A;  3TZT A;  3I0E A;  2QGI A;  3PNN A;  1ON8 A;  2GGO A;  1W55 A;  5C47 A;  1QG8 A;  3T7O A;  4EEG A;  1GQC A;  4JIS A;  2YQH A;  1LL2 A;  1TVY A;  1R7U A;  5C36 A;  1O7O A;  2A8W A;  1ZCT A;  1XHB A;  4HOC A;  4AAW A;  3ZLL A;  2OEG A;  2RJ9 A;  2OEF A;  2QKX A;  2VFZ A;  4Y9X A;  1VM8 A;  1VIC A;  5FV9 A;  4UEG A;  5AJP A;  1WT1 A;  2W0V A;  1R7V A;  4KC1 A;  2AGD A;  1R81 A;  2WVK A;  2D0J A;  3I0D A;  3CGX A;  3CKV A;  1H7H A;  1G93 A;  2XMH A;  5FUH A;  2Y4L A;  4XWI A;  1ZJ0 A;  1ZIZ A;  2E3D A;  4HO6 A;  4R7P A;  3SPT A;  1H7F A;  4IRP A;  2AES A;  2GGQ A;  2RJ1 A;  1WT2 A;  1H7Q A;  2XWM A;  2VXM A;  4B5B A;  3DK5 A;  1VPA A;  2BO8 A;  1I52 A;  1GWW A;  1Z90 A;  1G3L A;  1WSZ A;  1TW1 A;  2YES A;  4DDZ A;  5C49 A;  1OMZ A;  1LZ0 A;  3OKR A;  1OQM B;  3V0M A;  1WT3 A;  4M28 A;  1H5T A;  2DPW A;  5DDT A;  1FG5 N;  1O0R A;  2O1F A;  1O23 B;  1ON6 A;  1VGT A;  3SX8 A;  1YRO B;  2RJ7 A;  1H5S D;  4FRL A;  4Y7T A;  3V0P A;  4KRV A;  4Y7G A;  2W0W A;  1WT0 A;  5IDS A;  1FGG A;  3OH2 A;  1FZW A;  2AM5 A;  2ICY A;  1G97 A;  4FRQ A;  2X5S A;  3KIA A;  2Q4J A;  3IOJ A;  1MP4 A;  2QH5 A;  4FRH A;  3CKJ A;  2XWN A;  1LZJ A;  4FCU A;  4P02 A;  5CQP A;  2WE9 A;  3I0H A;  2WEE A;  1W77 A;  1H4D A;  1IIN A;  4NAN A;  5IFY A;  2A8U A;  4EE5 A;  1GX0 A;  1XZ6 A;  1HM0 A;  2VXL A;  1ZDG A;  3TQD A;  4E1K A;  2PX7 A;  2Y4K A;  1VGZ A;  2RIX A;  3R2W A;  4Y7U A;  3DJ4 A;  3U2V A;  2WAW A;  1EYR A;  2I5E A;  1HV9 A;  1H7L A;  4JD0 A;  4ASJ A;  3I0G A;  1G9R A;  3O3P A;  5C4B A;  3OH0 A;  2P72 A;  3ZF8 A;  2UX8 A;  1H5R B;  4MND A;  4G3P A;  2AM3 A;  5J49 A;  2AM4 A;  5C1H A;  2X5Z A;  1QGS A;  5CMF X;  1PZY B;  1INJ A;  2YC5 A;  4FRB A;  1JVG A;  4GBP A;  1VZU A;  4HCQ A;  4FRP A;  4HG6 A;  1NWG B;  1FR9 A;  3F1Y A;  4B3U A;  1YP4 A;  4FRM A;  3SXE A;  4M2B A;  4P00 A;  5EIY A;  4FRD A;  1HM9 A;  2NXV A;  3SXG A;  4Y7V A;  4NAK A;  1QGQ A;  2JCK A;  3D98 A;  1FGX A;  4FRA A;  3FWW A;  1NMM B;  4EEM A;  5EJZ A;  1ZDF A;  2BO4 A;  5C1L A;  5L6V A;  2ZU9 A;  3U0X A;  2OI6 A;  1H7T A;  1VH3 A;  4LW3 A;  4B4B A;  4CJ8 A;  3CKN A;  1H5S B;  1OMX A;  1ZJ3 A;  2FY7 A;  3JUJ A;  5CMG X;  1ZJ1 A;  5FU0 A;  4D48 A;  4D0Z A;  4EE4 A;  2MZB A;  1H7E A;  1GA8 A;  3USR A;  2BO6 A;  1R82 A;  5C1G A;  4CJC A;  3K8E A;  4KPX A;  5CMJ A;  4Y6N A;  3SXD A;  1ZHJ A;  4B4M A;  1JYL A;  3DUV A;  1H4E A; 
#chains in the Genus database with same CATH topology
 2RJ8 A;  1FOA A;  5C4C A;  3JUK A;  2Y6P A;  3U2X A;  2P6W A;  1HJJ A;  4KPZ A;  4HO9 A;  2PGY A;  3Q7U A;  4LW6 A;  1VZX A;  3HL3 A;  2CU2 A;  2X60 A;  2V0J A;  1WVC A;  1G95 A;  4NAL A;  2WVL A;  5C3B A;  3U2W A;  3OGZ A;  1ZI5 A;  4Y63 A;  5CMI A;  4FRE A;  1LVW A;  3I0F A;  4KT7 A;  5C4D A;  1S4O A;  1ZCY A;  1IIM A;  4HO8 A;  4Y64 A;  4DEC A;  3PKQ A;  2VS4 A;  1ZI3 A;  1NKH B;  4D11 C;  4IRQ A;  2WGZ A;  2VS5 A;  3E25 A;  4G87 A;  4G3S A;  5CQM X;  2J0B A;  1V83 A;  1V84 A;  3Q4S A;  1GWV A;  3RMW A;  1ZCV A;  3T7N A;  1LL3 A;  3U0Y A;  1G0R A;  3CKQ A;  3SX7 A;  3V90 A;  3V0O A;  1NF5 B;  3QVB A;  1S4N A;  3I0K A;  4ZDQ A;  4HO0 A;  3V0L A;  3T7M A;  5IDT A;  4BMA A;  4CVH A;  1TZF A;  1PZT A;  3GUE A;  3OH1 A;  4BQH A;  4EE3 A;  1R7X A;  2Z86 A;  4Y6U A;  1H5S C;  2RIY A;  4FIX A;  2AE7 A;  4KXO A;  3I0J A;  1MP3 A;  1FO9 A;  3SXB A;  3OH4 A;  3I0I X;  2O1H A;  5L6S A;  5AJN A;  1ZJP A;  3FOQ A;  2PA4 A;  5JQQ A;  2ZU7 A;  1K4V A;  3V8Z A;  2I5K A;  3V8Y A;  4HO5 A;  3CU0 A;  2FYB A;  2FFU A;  1VGW A;  4EEA A;  5C8R A;  2V0K A;  2V0I A;  1MP5 A;  2RJ4 A;  2Y4M A;  1FR8 A;  2FYC B;  2YQS A;  4Y62 A;  4EVW A;  3USQ A;  1H3M A;  4D0T A;  4AC3 A;  2AH9 A;  2D7R A;  4MYB A;  5EJ1 A;  5BXC A;  1R7Y A;  4NAI A;  2FFV A;  1E5K A;  1H4C A;  2V0L A;  2APC A;  4B2X A;  2Z87 A;  2I7B A;  4HO3 A;  3V0N A;  5AJO A;  1TW5 A;  5C4E A;  4C2S A;  2P73 A;  2YQC A;  4FQW A;  3BCV A;  3ZGG A;  4J18 A;  2V0H A;  1G8O A;  1H5S A;  5C3A A;  4AYL A;  3IOI A;  4FCE A;  3D8V A;  1O7Q A;  4M4K A;  5FU8 A;  1JV3 A;  1G1L A;  1KWS A;  3BRK X;  3POL A;  2XME A;  3SX5 A;  3OAM A;  1GX4 A;  1V82 A;  4HO2 A;  5C4F A;  1JV1 A;  3N9W A;  5C48 A;  1R80 A;  3LW6 A;  3SXC A;  5FTV A;  1NQI B;  1JYK A;  1ZI4 A;  1ZJO A;  5FTS A;  2YCM A;  3R3I A;  4AYJ A;  4KC2 A;  4KNR A;  1ZI1 A;  5HS2 A;  3JTJ A;  3RMV A;  1FXO A;  1G23 A;  2AEC A;  3I0C A;  3I0L A;  4DE7 A;  2D7I A;  2Y7A A;  2FYD B;  2JCO A;  2ICX A;  1GQ9 A;  4B42 A;  3U2U A;  1YP2 A;  4EEO A;  2FYA A;  2OI5 A;  1H5T B;  4G3Q A;  3SXA A;  4Y7F A;  1SS9 A;  2YQJ A;  3U2T A;  5C3D A;  2VSI A;  4ASY A;  1H7G A;  3D5N A;  1LL0 A;  2O1G A;  1YP3 A;  1VGU A;  3E26 A;  4YS8 A;  2VS3 A;  1VH1 A;  1INI A;  4CJB A;  1JVD A;  5CQL X;  2WVM A;  2JCJ A;  5CQO A;  1LZI A;  2RJ6 A;  3K8D A;  3PKP A;  2RIT A;  1HJL A;  3CKO A;  3V0Q A;  4KC4 A;  2JCL A;  1FRW A;  2VK9 A;  3IOH A;  5D92 A;  2PGV A;  3V91 A;  2OI7 A;  1R7T A;  3ZLK A;  5CMH A;  1MC3 A;  5D91 A;  2VSH A;  3Q80 A;  1FXJ A;  5CQN X;  1LZ7 A;  4B4G A;  4O6M A;  5DDV A;  1W57 A;  3ZGF A;  1FWY A;  4FRO A;  2X65 A;  3F1C A;  5C38 A;  4L41 C;  4ECM A;  1EZI A;  3OH3 A;  1S4P A;  1H5R A;  1G2V A;  2BO7 A;  1HM8 A;  2RIZ A;  4KQL A;  5FYE A;  4HO4 A;  4M2A A;  1ZCU A;  2Y4J A;  3NGW A;  3SX3 A;  4KNX A;  4D11 A;  2ZU8 A;  3EE5 A;  4K6R A;  1NHE B;  1VZT A;  4B2W A;  1QWJ A;  4ARW A;  1ZJ2 A;  2RJ5 A;  5I1F A;  1FO8 A;  2XWL A;  2E8B A;  3RSB A;  2C0N A;  3OC9 A;  3ST8 A;  2VD4 A;  2RJ0 A;  2YC3 A;  3TZT A;  3I0E A;  4O6N A;  2QGI A;  3PNN A;  1ON8 A;  4MIX A;  2GGO A;  1W55 A;  5C47 A;  1QG8 A;  3T7O A;  4EEG A;  1GQC A;  4JIS A;  2YQH A;  1LL2 A;  1TVY A;  1R7U A;  4FIY A;  5C36 A;  1O7O A;  2A8W A;  1ZCT A;  1XHB A;  4HOC A;  4AAW A;  3ZLL A;  2OEG A;  2RJ9 A;  2OEF A;  2QKX A;  2VFZ A;  4Y9X A;  1VM8 A;  1VIC A;  5FV9 A;  4UEG A;  5AJP A;  1WT1 A;  2W0V A;  1R7V A;  4KC1 A;  2AGD A;  1R81 A;  2WVK A;  2D0J A;  3I0D A;  3CGX A;  3CKV A;  1H7H A;  1G93 A;  2XMH A;  5FUH A;  2Y4L A;  4XWI A;  1ZJ0 A;  1ZIZ A;  2E3D A;  4HO6 A;  4R7P A;  3SPT A;  1H7F A;  4IRP A;  2AES A;  2GGQ A;  2RJ1 A;  1WT2 A;  1H7Q A;  2XWM A;  2VXM A;  4B5B A;  3DK5 A;  1VPA A;  2BO8 A;  4Q7C A;  1I52 A;  1GWW A;  1Z90 A;  1G3L A;  1WSZ A;  1TW1 A;  2YES A;  4DDZ A;  5C49 A;  1OMZ A;  1LZ0 A;  3OKR A;  1OQM B;  3V0M A;  1WT3 A;  4M28 A;  1H5T A;  2DPW A;  5DDT A;  1FG5 N;  1O0R A;  2O1F A;  1O23 B;  1ON6 A;  1VGT A;  3SX8 A;  1YRO B;  2RJ7 A;  1H5S D;  4FRL A;  4Y7T A;  3V0P A;  4KRV A;  4Y7G A;  2W0W A;  1WT0 A;  5IDS A;  1FGG A;  3OH2 A;  1FZW A;  2AM5 A;  2ICY A;  1G97 A;  4FRQ A;  2X5S A;  3KIA A;  2Q4J A;  3IOJ A;  1MP4 A;  2QH5 A;  4FRH A;  3CKJ A;  2XWN A;  1LZJ A;  4FCU A;  4P02 A;  5CQP A;  2WE9 A;  3I0H A;  2WEE A;  1W77 A;  1H4D A;  1IIN A;  4NAN A;  5IFY A;  2A8U A;  4EE5 A;  1GX0 A;  1XZ6 A;  1HM0 A;  2VXL A;  1ZDG A;  3TQD A;  4E1K A;  2PX7 A;  2Y4K A;  1VGZ A;  2RIX A;  3R2W A;  4Y7U A;  3DJ4 A;  3U2V A;  2WAW A;  1EYR A;  2I5E A;  1HV9 A;  1H7L A;  4JD0 A;  4ASJ A;  3I0G A;  1G9R A;  3O3P A;  5C4B A;  3OH0 A;  2P72 A;  3ZF8 A;  2UX8 A;  1H5R B;  4MND A;  4G3P A;  2AM3 A;  5J49 A;  2AM4 A;  5C1H A;  2X5Z A;  1QGS A;  5CMF X;  1PZY B;  1INJ A;  2YC5 A;  4FRB A;  1JVG A;  4GBP A;  1VZU A;  4HCQ A;  4FRP A;  4HG6 A;  1NWG B;  1FR9 A;  3F1Y A;  4B3U A;  1YP4 A;  4FRM A;  3SXE A;  4M2B A;  4P00 A;  5EIY A;  4FRD A;  1HM9 A;  2NXV A;  3SXG A;  4Y7V A;  4NAK A;  1QGQ A;  2JCK A;  3D98 A;  1FGX A;  4FRA A;  3FWW A;  1NMM B;  4EEM A;  5EJZ A;  1ZDF A;  2BO4 A;  5C1L A;  5L6V A;  2ZU9 A;  3U0X A;  2OI6 A;  1H7T A;  1VH3 A;  4LW3 A;  4B4B A;  4CJ8 A;  3CKN A;  1H5S B;  1OMX A;  1ZJ3 A;  2FY7 A;  3JUJ A;  5CMG X;  1ZJ1 A;  5FU0 A;  4D48 A;  4D0Z A;  4EE4 A;  2MZB A;  1H7E A;  1GA8 A;  3USR A;  2BO6 A;  2J0A A;  1R82 A;  5C1G A;  4CJC A;  3K8E A;  4KPX A;  5CMJ A;  4Y6N A;  3SXD A;  1ZHJ A;  4B4M A;  1JYL A;  3DUV A;  1H4E A; 
#chains in the Genus database with same CATH homology
 2RJ8 A;  1FOA A;  5C4C A;  3JUK A;  2Y6P A;  3U2X A;  2P6W A;  1HJJ A;  4KPZ A;  4HO9 A;  2PGY A;  3Q7U A;  4LW6 A;  1VZX A;  3HL3 A;  2CU2 A;  2X60 A;  2V0J A;  1WVC A;  1G95 A;  4NAL A;  2WVL A;  5C3B A;  3U2W A;  3OGZ A;  1ZI5 A;  4Y63 A;  5CMI A;  4FRE A;  1LVW A;  3I0F A;  4KT7 A;  5C4D A;  1S4O A;  1ZCY A;  1IIM A;  4HO8 A;  4Y64 A;  4DEC A;  3PKQ A;  2VS4 A;  1ZI3 A;  1NKH B;  4D11 C;  4IRQ A;  2WGZ A;  2VS5 A;  3E25 A;  4G87 A;  4G3S A;  5CQM X;  2J0B A;  1V83 A;  1V84 A;  3Q4S A;  1GWV A;  3RMW A;  1ZCV A;  3T7N A;  1LL3 A;  3U0Y A;  1G0R A;  3CKQ A;  3SX7 A;  3V90 A;  3V0O A;  1NF5 B;  3QVB A;  1S4N A;  3I0K A;  4ZDQ A;  4HO0 A;  3V0L A;  3T7M A;  5IDT A;  4BMA A;  4CVH A;  1TZF A;  1PZT A;  3GUE A;  3OH1 A;  4BQH A;  4EE3 A;  1R7X A;  2Z86 A;  4Y6U A;  1H5S C;  2RIY A;  4FIX A;  2AE7 A;  4KXO A;  3I0J A;  1MP3 A;  1FO9 A;  3SXB A;  3OH4 A;  3I0I X;  2O1H A;  5L6S A;  5AJN A;  1ZJP A;  3FOQ A;  2PA4 A;  5JQQ A;  2ZU7 A;  1K4V A;  3V8Z A;  2I5K A;  3V8Y A;  4HO5 A;  3CU0 A;  2FYB A;  2FFU A;  1VGW A;  4EEA A;  5C8R A;  2V0K A;  2V0I A;  1MP5 A;  2RJ4 A;  2Y4M A;  1FR8 A;  2FYC B;  2YQS A;  4Y62 A;  4EVW A;  3USQ A;  1H3M A;  4D0T A;  4AC3 A;  2AH9 A;  2D7R A;  4MYB A;  5EJ1 A;  5BXC A;  1R7Y A;  4NAI A;  2FFV A;  1E5K A;  1H4C A;  2V0L A;  2APC A;  4B2X A;  2Z87 A;  2I7B A;  4HO3 A;  3V0N A;  5AJO A;  1TW5 A;  5C4E A;  4C2S A;  2P73 A;  2YQC A;  4FQW A;  3BCV A;  3ZGG A;  4J18 A;  2V0H A;  1G8O A;  1H5S A;  5C3A A;  4AYL A;  3IOI A;  4FCE A;  3D8V A;  1O7Q A;  4M4K A;  5FU8 A;  1JV3 A;  1G1L A;  1KWS A;  3BRK X;  3POL A;  2XME A;  3SX5 A;  3OAM A;  1GX4 A;  1V82 A;  4HO2 A;  5C4F A;  1JV1 A;  3N9W A;  5C48 A;  1R80 A;  3LW6 A;  3SXC A;  5FTV A;  1NQI B;  1JYK A;  1ZI4 A;  1ZJO A;  5FTS A;  2YCM A;  3R3I A;  4AYJ A;  4KC2 A;  4KNR A;  1ZI1 A;  5HS2 A;  3JTJ A;  3RMV A;  1FXO A;  1G23 A;  2AEC A;  3I0C A;  3I0L A;  4DE7 A;  2D7I A;  2Y7A A;  2FYD B;  2JCO A;  2ICX A;  1GQ9 A;  4B42 A;  3U2U A;  1YP2 A;  4EEO A;  2FYA A;  2OI5 A;  1H5T B;  4G3Q A;  3SXA A;  4Y7F A;  1SS9 A;  2YQJ A;  3U2T A;  5C3D A;  2VSI A;  4ASY A;  1H7G A;  3D5N A;  1LL0 A;  2O1G A;  1YP3 A;  1VGU A;  3E26 A;  4YS8 A;  2VS3 A;  1VH1 A;  1INI A;  4CJB A;  1JVD A;  5CQL X;  2WVM A;  2JCJ A;  5CQO A;  1LZI A;  2RJ6 A;  3K8D A;  3PKP A;  2RIT A;  1HJL A;  3CKO A;  3V0Q A;  4KC4 A;  2JCL A;  1FRW A;  2VK9 A;  3IOH A;  5D92 A;  2PGV A;  3V91 A;  2OI7 A;  1R7T A;  3ZLK A;  5CMH A;  1MC3 A;  5D91 A;  2VSH A;  3Q80 A;  1FXJ A;  5CQN X;  1LZ7 A;  4B4G A;  4O6M A;  5DDV A;  1W57 A;  3ZGF A;  1FWY A;  4FRO A;  2X65 A;  3F1C A;  5C38 A;  4L41 C;  4ECM A;  1EZI A;  3OH3 A;  1S4P A;  1H5R A;  1G2V A;  2BO7 A;  1HM8 A;  2RIZ A;  4KQL A;  5FYE A;  4HO4 A;  4M2A A;  1ZCU A;  2Y4J A;  3NGW A;  3SX3 A;  4KNX A;  4D11 A;  2ZU8 A;  3EE5 A;  4K6R A;  1NHE B;  1VZT A;  4B2W A;  1QWJ A;  4ARW A;  1ZJ2 A;  2RJ5 A;  5I1F A;  1FO8 A;  2XWL A;  2E8B A;  3RSB A;  2C0N A;  3OC9 A;  3ST8 A;  2VD4 A;  2RJ0 A;  2YC3 A;  3TZT A;  3I0E A;  4O6N A;  2QGI A;  3PNN A;  1ON8 A;  4MIX A;  2GGO A;  1W55 A;  5C47 A;  1QG8 A;  3T7O A;  4EEG A;  1GQC A;  4JIS A;  2YQH A;  1LL2 A;  1TVY A;  1R7U A;  4FIY A;  5C36 A;  1O7O A;  2A8W A;  1ZCT A;  1XHB A;  4HOC A;  4AAW A;  3ZLL A;  2OEG A;  2RJ9 A;  2OEF A;  2QKX A;  2VFZ A;  4Y9X A;  1VM8 A;  1VIC A;  5FV9 A;  4UEG A;  5AJP A;  1WT1 A;  2W0V A;  1R7V A;  4KC1 A;  2AGD A;  1R81 A;  2WVK A;  2D0J A;  3I0D A;  3CGX A;  3CKV A;  1H7H A;  1G93 A;  2XMH A;  5FUH A;  2Y4L A;  4XWI A;  1ZJ0 A;  1ZIZ A;  2E3D A;  4HO6 A;  4R7P A;  3SPT A;  1H7F A;  4IRP A;  2AES A;  2GGQ A;  2RJ1 A;  1WT2 A;  1H7Q A;  2XWM A;  2VXM A;  4B5B A;  3DK5 A;  1VPA A;  2BO8 A;  4Q7C A;  1I52 A;  1GWW A;  1Z90 A;  1G3L A;  1WSZ A;  1TW1 A;  2YES A;  4DDZ A;  5C49 A;  1OMZ A;  1LZ0 A;  3OKR A;  1OQM B;  3V0M A;  1WT3 A;  4M28 A;  1H5T A;  2DPW A;  5DDT A;  1FG5 N;  1O0R A;  2O1F A;  1O23 B;  1ON6 A;  1VGT A;  3SX8 A;  1YRO B;  2RJ7 A;  1H5S D;  4FRL A;  4Y7T A;  3V0P A;  4KRV A;  4Y7G A;  2W0W A;  1WT0 A;  5IDS A;  1FGG A;  3OH2 A;  1FZW A;  2AM5 A;  2ICY A;  1G97 A;  4FRQ A;  2X5S A;  3KIA A;  2Q4J A;  3IOJ A;  1MP4 A;  2QH5 A;  4FRH A;  3CKJ A;  2XWN A;  1LZJ A;  4FCU A;  4P02 A;  5CQP A;  2WE9 A;  3I0H A;  2WEE A;  1W77 A;  1H4D A;  1IIN A;  4NAN A;  5IFY A;  2A8U A;  4EE5 A;  1GX0 A;  1XZ6 A;  1HM0 A;  2VXL A;  1ZDG A;  3TQD A;  4E1K A;  2PX7 A;  2Y4K A;  1VGZ A;  2RIX A;  3R2W A;  4Y7U A;  3DJ4 A;  3U2V A;  2WAW A;  1EYR A;  2I5E A;  1HV9 A;  1H7L A;  4JD0 A;  4ASJ A;  3I0G A;  1G9R A;  3O3P A;  5C4B A;  3OH0 A;  2P72 A;  3ZF8 A;  2UX8 A;  1H5R B;  4MND A;  4G3P A;  2AM3 A;  5J49 A;  2AM4 A;  5C1H A;  2X5Z A;  1QGS A;  5CMF X;  1PZY B;  1INJ A;  2YC5 A;  4FRB A;  1JVG A;  4GBP A;  1VZU A;  4HCQ A;  4FRP A;  4HG6 A;  1NWG B;  1FR9 A;  3F1Y A;  4B3U A;  1YP4 A;  4FRM A;  3SXE A;  4M2B A;  4P00 A;  5EIY A;  4FRD A;  1HM9 A;  2NXV A;  3SXG A;  4Y7V A;  4NAK A;  1QGQ A;  2JCK A;  3D98 A;  1FGX A;  4FRA A;  3FWW A;  1NMM B;  4EEM A;  5EJZ A;  1ZDF A;  2BO4 A;  5C1L A;  5L6V A;  2ZU9 A;  3U0X A;  2OI6 A;  1H7T A;  1VH3 A;  4LW3 A;  4B4B A;  4CJ8 A;  3CKN A;  1H5S B;  1OMX A;  1ZJ3 A;  2FY7 A;  3JUJ A;  5CMG X;  1ZJ1 A;  5FU0 A;  4D48 A;  4D0Z A;  4EE4 A;  2MZB A;  1H7E A;  1GA8 A;  3USR A;  2BO6 A;  2J0A A;  1R82 A;  5C1G A;  4CJC A;  3K8E A;  4KPX A;  5CMJ A;  4Y6N A;  3SXD A;  1ZHJ A;  4B4M A;  1JYL A;  3DUV A;  1H4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...