3BCVA

Crystal structure of a putative glycosyltransferase from bacteroides fragilis
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
216
structure length
196
Chain Sequence
LIPKVSVIVPIYNVEKYLDQCVQALLAQTLSDIEIILIDDESPDNCPKICDDYAAQYPNIKVIHKKNAGLGMACNSGLDVATGEYVAFCDSDDYVDSDMYMTMYNVAQKYTCDAVFTFKLYKNKNEIHTLLKDLIASDPYAREERAIQVSAKVVLYRRNLIEKKHLRFVSERILPSEDLIFNVDVLANSNIVCVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative glycosyltransferase protein
publication title Crystal structure of a putative glycosyltransferase from Bacteroides fragilis.
rcsb
source organism Bacteroides fragilis
molecule tags Transferase
total genus 67
structure length 196
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3bcvA00
4ECMA 4EEMA 1G3LA 1R80A 2CU2A 3V0OA 5IDSA 3ZLKA 3GUEA 5AJOA 5FU8A 4NANA 4KXOA 2OI7A 1JV1A 4FRHA 4CJ8A 2AE7A 2V0JA 1H5SC 4GBPA 3I0JA 1S4PA 1FO8A 2WVMA 2P73A 2AGDA 2Y6PA 5IDTA 1TVYA 2ZU8A 1YROB 1GX4A 2OEGA 1LZJA 1VGZA 2RJ4A 4K6RA 3IOHA 2XWNA 1MP3A 3RMVA 2BO4A 2FYBA 1H7FA 1ZI5A 4R7PA 4UEGA 5DDVA 2RIXA 3CKQA 1VZXA 3CGXA 4HO2A 1FG5N 2RJ9A 2P6WA 3SXCA 2JCJA 3CKJA 4B4BA 1WVCA 3F1YA 1H7GA 5C4BA 4KPZA 4D0TA 4G87A 1H5SA 3T7MA 2Y4JA 1WT3A 1S4NA 3I0CA 4B4MA 1ZCUA 1ZDFA 4M2AA 5C3BA 4AYLA 1VGWA 1GWWA 3OH0A 4MYBA 3D98A 2OI5A 3U0XA 1G8OA 1H4CA 2DPWA 1W55A 4Y7UA 1O23B 2RITA 1GA8A 2V0HA 2Z87A 3I0FA 1VH3A 1NHEB 1H3MA 3V0MA 1VGTA 2W0WA 2FFUA 1GQCA 1QWJA 3POLA 2WGZA 2VS5A 4B4GA 1QGQA 1FR9A 2RIYA 4EEGA 1NWGB 4HOCA 3SXDA 5CMGX 1LL0A 2WAWA 5C47A 5L6SA 2PA4A 3IOJA 2RJ5A 1O7QA 4ZDQA 1OQMB 1ZCVA 2AECA 1W57A 2Y4KA 1ZI1A 4KNRA 3PKQA 5FUHA 4FCEA 1VH1A 5DDTA 1G95A 3E26A 1ZDGA 3USRA 2WEEA 3EE5A 2OEFA 2ZU7A 1ZJ3A 3CKNA 2AM5A 1R7YA 2ICXA 3OH1A 4CVHA 2Y7AA 1FXJA 3N9WA 5CQNX 2XWMA 4KRVA 3V90A 1INIA 2ICYA 5AJPA 4YS8A 3T7OA 4IRQA 1O0RA 2XWLA 5C4EA 1H5TB 3V91A 5HS2A 3SX8A 1H7TA 4HO0A 4EE4A 5C1LA 4M4KA 3KIAA 5C36A 4Y62A 4C2SA 2VS3A 1FXOA 2D7RA 3U2VA 1H5RA 4D11C 4HO4A 3Q4SA 1R7XA 2JCLA 2X60A 1MP4A 1HM8A 1NQIB 4BMAA 3SX3A 1PZYB 3TQDA 1NKHB 4M28A 3R2WA 4B42A 5C4CA 3RMWA 1G0RA 4ASJA 4NAIA 1FRWA 3D8VA 1XZ6A 2WVKA 3I0KA 4ASYA 4B3UA 3I0LA 1MP5A 3I0EA 3V0LA 1ZHJA 5FTVA 2O1GA 1E5KA 2VS4A 5EJ1A 1ZJ2A 4D48A 1W77A 4FRPA 2P72A 1TW5A 4IRPA 2A8WA 4G3SA 4CJCA 4M2BA 5C4FA 2NXVA 5IFYA 3BRKX 4NALA 1IINA 4EE3A 4Y7GA 1H7QA 3DJ4A 3SXEA 3FOQA 1JVDA 2VD4A 1FR8A 2RJ8A 4KNXA 4D11A 2Z86A 1H4DA 1XHBA 4Y7FA 1YP2A 4EEAA 1LVWA 3TZTA 5C3DA 1FOAA 1NF5B 5FYEA 1ON8A 3ST8A 2QH5A 1SS9A 3I0HA 3SX7A 2D7IA 2APCA 4KC4A 5CMJA 5C4DA 1G1LA 4G3PA 4FRMA 4KT7A 2PGYA 4HO6A 4ARWA 1QG8A 4HG6A 2VXMA 3OGZA 3K8DA 2VXLA 5C1HA 2PGVA 1ZJ1A 3Q7UA 5CMHA 3T7NA 2E8BA 5AJNA 2FYCB 2YESA 2RJ0A 1JYKA 1ZCTA 4FRBA 2X65A 3SPTA 2BO8A 1GQ9A 1ZJPA 3ZLLA 3V8YA 3SXBA 1FZWA 1KWSA 2VSIA 1V83A 3F1CA 3OAMA 4FREA 4HO9A 4JISA 4XWIA 4KC1A 2Q4JA 2FY7A 1H7LA 3I0DA 5C38A 2QKXA 1JV3A 3U2WA 4AAWA 4Y6UA 1HM0A 1WT1A 3HL3A 1GX0A 5FV9A 4CJBA 1VICA 4KPXA 3ZGGA 1K4VA 2RJ6A 2JCOA 2YQHA 2W0VA 2GGQA 1HJLA 4KQLA 1ZJ0A 2V0LA 4AC3A 1EZIA 5J49A 2VFZA 2PX7A 4EEOA 3OH3A 2YQSA 1HJJA 1ON6A 1ZI4A 1R82A 4E1KA 4P02A 3O3PA 3K8EA 2JCKA 3OH2A 2AM4A 1LZ0A 3JUKA 3RSBA 1GWVA 1H7HA 1R7TA 2UX8A 2YQJA 2QGIA 3U2UA 1V82A 1V84A 5CQPA 2FYAA 2GGOA 3V0NA 4HCQA 2FYDB 2MZBA 4L41C 2X5ZA 4FCUA 1QGSA 2VSHA 1LZ7A 2RJ7A 2RJ1A 4Y6NA 2BO7A 1ZIZA 4DDZA 3IOIA 1WSZA 1JYLA 1FO9A 4J18A 2I7BA 1YP3A 4AYJA 4Y9XA 2V0KA 3DUVA 3D5NA 4BQHA 1LZIA 2AH9A 5CQLX 3V0QA 5C48A 1JVGA 4LW3A 1IIMA 3LW6A 1TW1A 1H4EA 5CQOA 1FWYA 3SXGA 1G97A 1I52A 3DK5A 5C8RA 1S4OA 2BO6A 2AM3A 5CMIA 1EYRA 5C3AA 1H5TA 3USQA 3V8ZA 2YC5A 3U0YA 3PNNA 4HO5A 5C49A 1NMMB 1R7UA 1LL3A 4Y7VA 4B5BA 1ZI3A 4DECA 3QVBA 2XMEA 5FU0A 2ZU9A 5L6VA 4D0ZA 4FRDA 1Z90A 2D0JA 1R81A 1WT2A 3FWWA 5CMFX 4B2XA 3SX5A 1LL2A 5BXCA 4EE5A 4HO3A 2YCMA 5JQQA 5EJZA 1H5SD 2X5SA 1INJA 3Q80A 4KC2A 4P00A 3CKVA 3R3IA 4HO8A 4Y64A 1VGUA 5EIYA 2I5EA 1H5RB 2O1HA 1G9RA 3V0PA 1VM8A 1ZCYA 1H7EA 3I0GA 3U2XA 3CKOA 4FRLA 1VZTA 3BCVA 2A8UA 2WVLA 1PZTA 1VZUA 1R7VA 2AESA 1G23A 4LW6A 1ZJOA 1G2VA 2Y4MA 5C1GA 4FROA 3OC9A 2XMHA 1HM9A 2E3DA 1FGGA 4Y63A 4B2WA 2V0IA 2OI6A 3SXAA 2FFVA 1MC3A 1O7OA 4MNDA 2O1FA 4FRAA 5FTSA 1YP4A 2I5KA 3ZGFA 2YQCA 4JD0A 3OH4A 3NGWA 3U2TA 2RIZA 1FGXA 2Y4LA 1OMXA 4FRQA 2YC3A 1TZFA 3E25A 1HV9A 4DE7A 4EVWA 4NAKA 3JUJA 4G3QA 1H5SB 3ZF8A 5CQMX 5I1FA 1OMZA 3OKRA 1G93A 3CU0A 4FQWA 4Y7TA 1VPAA 3I0IX 3PKPA 1WT0A 2WE9A 3JTJA
chains in the Genus database with same CATH superfamily
4ECMA 4EEMA 1G3LA 1R80A 2CU2A 3V0OA 5IDSA 3ZLKA 3GUEA 5AJOA 5FU8A 4NANA 4KXOA 2OI7A 1JV1A 4FRHA 5D91A 4CJ8A 2AE7A 2V0JA 1H5SC 4GBPA 3I0JA 1S4PA 1FO8A 2WVMA 2P73A 2AGDA 2Y6PA 5IDTA 1TVYA 2ZU8A 1YROB 1GX4A 2OEGA 1LZJA 1VGZA 2RJ4A 4K6RA 3IOHA 2XWNA 1MP3A 3RMVA 2BO4A 2FYBA 1H7FA 1ZI5A 4R7PA 4UEGA 5DDVA 2RIXA 3CKQA 1VZXA 3CGXA 4HO2A 1FG5N 2RJ9A 2P6WA 3SXCA 2JCJA 3CKJA 4B4BA 1WVCA 3F1YA 1H7GA 5C4BA 4KPZA 4D0TA 4G87A 1H5SA 3T7MA 2Y4JA 1WT3A 1S4NA 3I0CA 4B4MA 1ZCUA 1ZDFA 4M2AA 5C3BA 4AYLA 1VGWA 1GWWA 3OH0A 4MYBA 3D98A 2OI5A 3U0XA 1G8OA 1H4CA 2DPWA 1W55A 4Y7UA 1O23B 2RITA 1GA8A 2V0HA 2Z87A 3I0FA 1VH3A 1NHEB 1H3MA 3V0MA 1VGTA 2W0WA 2FFUA 1GQCA 1QWJA 3POLA 2WGZA 2VS5A 4B4GA 1QGQA 1FR9A 2RIYA 4EEGA 1NWGB 4HOCA 3SXDA 5CMGX 1LL0A 2WAWA 5C47A 5L6SA 2PA4A 3IOJA 2RJ5A 1O7QA 4ZDQA 1OQMB 1ZCVA 2AECA 1W57A 2Y4KA 1ZI1A 4KNRA 3PKQA 5FUHA 4FCEA 1VH1A 5DDTA 1G95A 3E26A 1ZDGA 3USRA 2WEEA 3EE5A 2OEFA 4O6NA 2ZU7A 1ZJ3A 3CKNA 2AM5A 1R7YA 2ICXA 3OH1A 4CVHA 2Y7AA 1FXJA 3N9WA 5CQNX 2XWMA 4KRVA 3V90A 1INIA 2ICYA 5AJPA 4YS8A 3T7OA 4IRQA 1O0RA 2XWLA 5C4EA 1H5TB 3V91A 5HS2A 3SX8A 1H7TA 2J0AA 4HO0A 4EE4A 5C1LA 4M4KA 3KIAA 5C36A 4Y62A 4C2SA 2VS3A 1FXOA 2D7RA 3U2VA 1H5RA 4D11C 4HO4A 3Q4SA 1R7XA 2JCLA 2X60A 1MP4A 1HM8A 1NQIB 4BMAA 3SX3A 1PZYB 3TQDA 1NKHB 4M28A 3R2WA 4B42A 5C4CA 3RMWA 1G0RA 4ASJA 4NAIA 1FRWA 3D8VA 1XZ6A 2WVKA 3I0KA 4ASYA 4B3UA 3I0LA 1MP5A 3I0EA 3V0LA 1ZHJA 5FTVA 2O1GA 1E5KA 2VS4A 5EJ1A 1ZJ2A 4D48A 1W77A 4FRPA 2P72A 1TW5A 4IRPA 2A8WA 4G3SA 4CJCA 4M2BA 5C4FA 2NXVA 5IFYA 3BRKX 4NALA 1IINA 4EE3A 4Y7GA 1H7QA 3DJ4A 3SXEA 3FOQA 1JVDA 2VD4A 1FR8A 2RJ8A 4KNXA 4D11A 2Z86A 1H4DA 1XHBA 4Y7FA 1YP2A 4EEAA 1LVWA 3TZTA 5C3DA 1FOAA 1NF5B 5FYEA 1ON8A 3ST8A 2QH5A 1SS9A 3I0HA 3SX7A 2D7IA 2APCA 4KC4A 5CMJA 5C4DA 1G1LA 4G3PA 4FRMA 4KT7A 2PGYA 4HO6A 2J0BA 4ARWA 1QG8A 4HG6A 2VXMA 3OGZA 3K8DA 4MIXA 2VXLA 5C1HA 2PGVA 1ZJ1A 4Q7CA 3Q7UA 5CMHA 3T7NA 2E8BA 5AJNA 2FYCB 2YESA 2RJ0A 1JYKA 1ZCTA 4FRBA 2X65A 3SPTA 2BO8A 1GQ9A 1ZJPA 3ZLLA 3V8YA 3SXBA 1FZWA 1KWSA 2VSIA 1V83A 3F1CA 3OAMA 4FREA 4HO9A 4JISA 4O6MA 4KC1A 4XWIA 2Q4JA 2FY7A 1H7LA 3I0DA 5C38A 2QKXA 1JV3A 3U2WA 4AAWA 4Y6UA 1HM0A 1WT1A 3HL3A 1GX0A 5FV9A 4CJBA 1VICA 4KPXA 5D92A 3ZGGA 1K4VA 2RJ6A 2JCOA 2YQHA 2W0VA 2GGQA 1HJLA 4KQLA 1ZJ0A 2V0LA 4AC3A 1EZIA 5J49A 2VFZA 2PX7A 4EEOA 3OH3A 2YQSA 1HJJA 1ON6A 1ZI4A 1R82A 4E1KA 4P02A 3O3PA 3K8EA 2JCKA 3OH2A 2AM4A 1LZ0A 3JUKA 3RSBA 1GWVA 1H7HA 1R7TA 2UX8A 2YQJA 2QGIA 3U2UA 1V82A 1V84A 5CQPA 2FYAA 2GGOA 3V0NA 4HCQA 2FYDB 2MZBA 4L41C 4FIYA 2X5ZA 4FCUA 1QGSA 2VSHA 1LZ7A 2RJ7A 2RJ1A 4Y6NA 2BO7A 1ZIZA 4DDZA 3IOIA 1WSZA 1JYLA 1FO9A 4J18A 2I7BA 1YP3A 4AYJA 4Y9XA 2V0KA 3DUVA 3D5NA 4BQHA 1LZIA 2AH9A 5CQLX 3V0QA 5C48A 1JVGA 4LW3A 1IIMA 3LW6A 1TW1A 1H4EA 5CQOA 1FWYA 3SXGA 1G97A 1I52A 3DK5A 5C8RA 1S4OA 2BO6A 2VK9A 2AM3A 5CMIA 1EYRA 5C3AA 1H5TA 3USQA 3V8ZA 2YC5A 3U0YA 3PNNA 4HO5A 5C49A 1NMMB 1R7UA 1LL3A 4Y7VA 4B5BA 1ZI3A 4DECA 3QVBA 2XMEA 5FU0A 2ZU9A 5L6VA 4D0ZA 4FRDA 1Z90A 2D0JA 1R81A 1WT2A 4FIXA 3FWWA 5CMFX 4B2XA 3SX5A 1LL2A 5BXCA 4EE5A 4HO3A 2YCMA 5JQQA 5EJZA 1H5SD 2X5SA 1INJA 3Q80A 4KC2A 4P00A 3CKVA 3R3IA 4HO8A 4Y64A 1VGUA 5EIYA 2I5EA 1H5RB 2O1HA 1G9RA 3V0PA 1VM8A 1ZCYA 1H7EA 3I0GA 3U2XA 3CKOA 4FRLA 1VZTA 3BCVA 2A8UA 2WVLA 1PZTA 1VZUA 1R7VA 2AESA 1G23A 4LW6A 1ZJOA 1G2VA 2Y4MA 5C1GA 4FROA 3OC9A 2XMHA 1HM9A 2E3DA 1FGGA 4Y63A 4B2WA 2V0IA 2OI6A 3SXAA 2FFVA 1MC3A 1O7OA 4MNDA 2O1FA 4FRAA 5FTSA 1YP4A 2I5KA 3ZGFA 2YQCA 4JD0A 3OH4A 3NGWA 3U2TA 2RIZA 1FGXA 2Y4LA 1OMXA 4FRQA 2YC3A 1TZFA 3E25A 1HV9A 4DE7A 4EVWA 4NAKA 3JUJA 4G3QA 1H5SB 3ZF8A 5CQMX 5I1FA 1OMZA 3OKRA 1G93A 3CU0A 4FQWA 4Y7TA 2C0NA 1VPAA 3I0IX 3PKPA 1WT0A 2WE9A 3JTJA
chains in the Genus database with same CATH topology
4ECMA 4EEMA 1G3LA 1R80A 2CU2A 3V0OA 5IDSA 3ZLKA 3GUEA 5AJOA 5FU8A 4NANA 4KXOA 2OI7A 1JV1A 4FRHA 5D91A 4CJ8A 2AE7A 2V0JA 1H5SC 4GBPA 3I0JA 1S4PA 1FO8A 2WVMA 2P73A 2AGDA 2Y6PA 5IDTA 1TVYA 2ZU8A 1YROB 1GX4A 2OEGA 1LZJA 1VGZA 2RJ4A 4K6RA 3IOHA 2XWNA 1MP3A 3RMVA 2BO4A 2FYBA 1H7FA 1ZI5A 4R7PA 4UEGA 5DDVA 2RIXA 3CKQA 1VZXA 3CGXA 4HO2A 1FG5N 2RJ9A 2P6WA 3SXCA 2JCJA 3CKJA 4B4BA 1WVCA 3F1YA 1H7GA 5C4BA 4KPZA 4D0TA 4G87A 1H5SA 3T7MA 2Y4JA 1WT3A 1S4NA 3I0CA 4B4MA 1ZCUA 1ZDFA 4M2AA 5C3BA 4AYLA 1VGWA 1GWWA 3OH0A 4MYBA 3D98A 2OI5A 3U0XA 1G8OA 1H4CA 2DPWA 1W55A 4Y7UA 1O23B 2RITA 1GA8A 2V0HA 2Z87A 3I0FA 1VH3A 1NHEB 1H3MA 3V0MA 1VGTA 2W0WA 2FFUA 1GQCA 1QWJA 3POLA 2WGZA 2VS5A 4B4GA 1QGQA 1FR9A 2RIYA 4EEGA 1NWGB 4HOCA 3SXDA 5CMGX 1LL0A 2WAWA 5C47A 5L6SA 2PA4A 3IOJA 2RJ5A 1O7QA 4ZDQA 1OQMB 1ZCVA 2AECA 1W57A 2Y4KA 1ZI1A 4KNRA 3PKQA 5FUHA 4FCEA 1VH1A 5DDTA 1G95A 3E26A 1ZDGA 3USRA 2WEEA 3EE5A 2OEFA 4O6NA 2ZU7A 1ZJ3A 3CKNA 2AM5A 1R7YA 2ICXA 3OH1A 4CVHA 2Y7AA 1FXJA 3N9WA 5CQNX 2XWMA 4KRVA 3V90A 1INIA 2ICYA 5AJPA 4YS8A 3T7OA 4IRQA 1O0RA 2XWLA 5C4EA 1H5TB 3V91A 5HS2A 3SX8A 1H7TA 2J0AA 4HO0A 4EE4A 5C1LA 4M4KA 3KIAA 5C36A 4Y62A 4C2SA 2VS3A 1FXOA 2D7RA 3U2VA 1H5RA 4D11C 4HO4A 3Q4SA 1R7XA 2JCLA 2X60A 1MP4A 1HM8A 1NQIB 4BMAA 3SX3A 1PZYB 3TQDA 1NKHB 4M28A 3R2WA 4B42A 5C4CA 3RMWA 1G0RA 4ASJA 4NAIA 1FRWA 3D8VA 1XZ6A 2WVKA 3I0KA 4ASYA 4B3UA 3I0LA 1MP5A 3I0EA 3V0LA 1ZHJA 5FTVA 2O1GA 1E5KA 2VS4A 5EJ1A 1ZJ2A 4D48A 1W77A 4FRPA 2P72A 1TW5A 4IRPA 2A8WA 4G3SA 4CJCA 4M2BA 5C4FA 2NXVA 5IFYA 3BRKX 4NALA 1IINA 4EE3A 4Y7GA 1H7QA 3DJ4A 3SXEA 3FOQA 1JVDA 2VD4A 1FR8A 2RJ8A 4KNXA 4D11A 2Z86A 1H4DA 1XHBA 4Y7FA 1YP2A 4EEAA 1LVWA 3TZTA 5C3DA 1FOAA 1NF5B 5FYEA 1ON8A 3ST8A 2QH5A 1SS9A 3I0HA 3SX7A 2D7IA 2APCA 4KC4A 5CMJA 5C4DA 1G1LA 4G3PA 4FRMA 4KT7A 2PGYA 4HO6A 2J0BA 4ARWA 1QG8A 4HG6A 2VXMA 3OGZA 3K8DA 4MIXA 2VXLA 5C1HA 2PGVA 1ZJ1A 4Q7CA 3Q7UA 5CMHA 3T7NA 2E8BA 5AJNA 2FYCB 2YESA 2RJ0A 1JYKA 1ZCTA 4FRBA 2X65A 3SPTA 2BO8A 1GQ9A 1ZJPA 3ZLLA 3V8YA 3SXBA 1FZWA 1KWSA 2VSIA 1V83A 3F1CA 3OAMA 4FREA 4HO9A 4JISA 4O6MA 4KC1A 4XWIA 2Q4JA 2FY7A 1H7LA 3I0DA 5C38A 2QKXA 1JV3A 3U2WA 4AAWA 4Y6UA 1HM0A 1WT1A 3HL3A 1GX0A 5FV9A 4CJBA 1VICA 4KPXA 5D92A 3ZGGA 1K4VA 2RJ6A 2JCOA 2YQHA 2W0VA 2GGQA 1HJLA 4KQLA 1ZJ0A 2V0LA 4AC3A 1EZIA 5J49A 2VFZA 2PX7A 4EEOA 3OH3A 2YQSA 1HJJA 1ON6A 1ZI4A 1R82A 4E1KA 4P02A 3O3PA 3K8EA 2JCKA 3OH2A 2AM4A 1LZ0A 3JUKA 3RSBA 1GWVA 1H7HA 1R7TA 2UX8A 2YQJA 2QGIA 3U2UA 1V82A 1V84A 5CQPA 2FYAA 2GGOA 3V0NA 4HCQA 2FYDB 2MZBA 4L41C 4FIYA 2X5ZA 4FCUA 1QGSA 2VSHA 1LZ7A 2RJ7A 2RJ1A 4Y6NA 2BO7A 1ZIZA 4DDZA 3IOIA 1WSZA 1JYLA 1FO9A 4J18A 2I7BA 1YP3A 4AYJA 4Y9XA 2V0KA 3DUVA 3D5NA 4BQHA 1LZIA 2AH9A 5CQLX 3V0QA 5C48A 1JVGA 4LW3A 1IIMA 3LW6A 1TW1A 1H4EA 5CQOA 1FWYA 3SXGA 1G97A 1I52A 3DK5A 5C8RA 1S4OA 2BO6A 2VK9A 2AM3A 5CMIA 1EYRA 5C3AA 1H5TA 3USQA 3V8ZA 2YC5A 3U0YA 3PNNA 4HO5A 5C49A 1NMMB 1R7UA 1LL3A 4Y7VA 4B5BA 1ZI3A 4DECA 3QVBA 2XMEA 5FU0A 2ZU9A 5L6VA 4D0ZA 4FRDA 1Z90A 2D0JA 1R81A 1WT2A 4FIXA 3FWWA 5CMFX 4B2XA 3SX5A 1LL2A 5BXCA 4EE5A 4HO3A 2YCMA 5JQQA 5EJZA 1H5SD 2X5SA 1INJA 3Q80A 4KC2A 4P00A 3CKVA 3R3IA 4HO8A 4Y64A 1VGUA 5EIYA 2I5EA 1H5RB 2O1HA 1G9RA 3V0PA 1VM8A 1ZCYA 1H7EA 3I0GA 3U2XA 3CKOA 4FRLA 1VZTA 3BCVA 2A8UA 2WVLA 1PZTA 1VZUA 1R7VA 2AESA 1G23A 4LW6A 1ZJOA 1G2VA 2Y4MA 5C1GA 4FROA 3OC9A 2XMHA 1HM9A 2E3DA 1FGGA 4Y63A 4B2WA 2V0IA 2OI6A 3SXAA 2FFVA 1MC3A 1O7OA 4MNDA 2O1FA 4FRAA 5FTSA 1YP4A 2I5KA 3ZGFA 2YQCA 4JD0A 3OH4A 3NGWA 3U2TA 2RIZA 1FGXA 2Y4LA 1OMXA 4FRQA 2YC3A 1TZFA 3E25A 1HV9A 4DE7A 4EVWA 4NAKA 3JUJA 4G3QA 1H5SB 3ZF8A 5CQMX 5I1FA 1OMZA 3OKRA 1G93A 3CU0A 4FQWA 4Y7TA 2C0NA 1VPAA 3I0IX 3PKPA 1WT0A 2WE9A 3JTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ECM A;  4EEM A;  1G3L A;  1R80 A;  2CU2 A;  3V0O A;  5IDS A;  3ZLK A;  3GUE A;  5AJO A;  5FU8 A;  4NAN A;  4KXO A;  2OI7 A;  1JV1 A;  4FRH A;  4CJ8 A;  2AE7 A;  2V0J A;  1H5S C;  4GBP A;  3I0J A;  1S4P A;  1FO8 A;  2WVM A;  2P73 A;  2AGD A;  2Y6P A;  5IDT A;  1TVY A;  2ZU8 A;  1YRO B;  1GX4 A;  2OEG A;  1LZJ A;  1VGZ A;  2RJ4 A;  4K6R A;  3IOH A;  2XWN A;  1MP3 A;  3RMV A;  2BO4 A;  2FYB A;  1H7F A;  1ZI5 A;  4R7P A;  4UEG A;  5DDV A;  2RIX A;  3CKQ A;  1VZX A;  3CGX A;  4HO2 A;  1FG5 N;  2RJ9 A;  2P6W A;  3SXC A;  2JCJ A;  3CKJ A;  4B4B A;  1WVC A;  3F1Y A;  1H7G A;  5C4B A;  4KPZ A;  4D0T A;  4G87 A;  1H5S A;  3T7M A;  2Y4J A;  1WT3 A;  1S4N A;  3I0C A;  4B4M A;  1ZCU A;  1ZDF A;  4M2A A;  5C3B A;  4AYL A;  1VGW A;  1GWW A;  3OH0 A;  4MYB A;  3D98 A;  2OI5 A;  3U0X A;  1G8O A;  1H4C A;  2DPW A;  1W55 A;  4Y7U A;  1O23 B;  2RIT A;  1GA8 A;  2V0H A;  2Z87 A;  3I0F A;  1VH3 A;  1NHE B;  1H3M A;  3V0M A;  1VGT A;  2W0W A;  2FFU A;  1GQC A;  1QWJ A;  3POL A;  2WGZ A;  2VS5 A;  4B4G A;  1QGQ A;  1FR9 A;  2RIY A;  4EEG A;  1NWG B;  4HOC A;  3SXD A;  5CMG X;  1LL0 A;  2WAW A;  5C47 A;  5L6S A;  2PA4 A;  3IOJ A;  2RJ5 A;  1O7Q A;  4ZDQ A;  1OQM B;  1ZCV A;  2AEC A;  1W57 A;  2Y4K A;  1ZI1 A;  4KNR A;  3PKQ A;  5FUH A;  4FCE A;  1VH1 A;  5DDT A;  1G95 A;  3E26 A;  1ZDG A;  3USR A;  2WEE A;  3EE5 A;  2OEF A;  2ZU7 A;  1ZJ3 A;  3CKN A;  2AM5 A;  1R7Y A;  2ICX A;  3OH1 A;  4CVH A;  2Y7A A;  1FXJ A;  3N9W A;  5CQN X;  2XWM A;  4KRV A;  3V90 A;  1INI A;  2ICY A;  5AJP A;  4YS8 A;  3T7O A;  4IRQ A;  1O0R A;  2XWL A;  5C4E A;  1H5T B;  3V91 A;  5HS2 A;  3SX8 A;  1H7T A;  4HO0 A;  4EE4 A;  5C1L A;  4M4K A;  3KIA A;  5C36 A;  4Y62 A;  4C2S A;  2VS3 A;  1FXO A;  2D7R A;  3U2V A;  1H5R A;  4D11 C;  4HO4 A;  3Q4S A;  1R7X A;  2JCL A;  2X60 A;  1MP4 A;  1HM8 A;  1NQI B;  4BMA A;  3SX3 A;  1PZY B;  3TQD A;  1NKH B;  4M28 A;  3R2W A;  4B42 A;  5C4C A;  3RMW A;  1G0R A;  4ASJ A;  4NAI A;  1FRW A;  3D8V A;  1XZ6 A;  2WVK A;  3I0K A;  4ASY A;  4B3U A;  3I0L A;  1MP5 A;  3I0E A;  3V0L A;  1ZHJ A;  5FTV A;  2O1G A;  1E5K A;  2VS4 A;  5EJ1 A;  1ZJ2 A;  4D48 A;  1W77 A;  4FRP A;  2P72 A;  1TW5 A;  4IRP A;  2A8W A;  4G3S A;  4CJC A;  4M2B A;  5C4F A;  2NXV A;  5IFY A;  3BRK X;  4NAL A;  1IIN A;  4EE3 A;  4Y7G A;  1H7Q A;  3DJ4 A;  3SXE A;  3FOQ A;  1JVD A;  2VD4 A;  1FR8 A;  2RJ8 A;  4KNX A;  4D11 A;  2Z86 A;  1H4D A;  1XHB A;  4Y7F A;  1YP2 A;  4EEA A;  1LVW A;  3TZT A;  5C3D A;  1FOA A;  1NF5 B;  5FYE A;  1ON8 A;  3ST8 A;  2QH5 A;  1SS9 A;  3I0H A;  3SX7 A;  2D7I A;  2APC A;  4KC4 A;  5CMJ A;  5C4D A;  1G1L A;  4G3P A;  4FRM A;  4KT7 A;  2PGY A;  4HO6 A;  4ARW A;  1QG8 A;  4HG6 A;  2VXM A;  3OGZ A;  3K8D A;  2VXL A;  5C1H A;  2PGV A;  1ZJ1 A;  3Q7U A;  5CMH A;  3T7N A;  2E8B A;  5AJN A;  2FYC B;  2YES A;  2RJ0 A;  1JYK A;  1ZCT A;  4FRB A;  2X65 A;  3SPT A;  2BO8 A;  1GQ9 A;  1ZJP A;  3ZLL A;  3V8Y A;  3SXB A;  1FZW A;  1KWS A;  2VSI A;  1V83 A;  3F1C A;  3OAM A;  4FRE A;  4HO9 A;  4JIS A;  4XWI A;  4KC1 A;  2Q4J A;  2FY7 A;  1H7L A;  3I0D A;  5C38 A;  2QKX A;  1JV3 A;  3U2W A;  4AAW A;  4Y6U A;  1HM0 A;  1WT1 A;  3HL3 A;  1GX0 A;  5FV9 A;  4CJB A;  1VIC A;  4KPX A;  3ZGG A;  1K4V A;  2RJ6 A;  2JCO A;  2YQH A;  2W0V A;  2GGQ A;  1HJL A;  4KQL A;  1ZJ0 A;  2V0L A;  4AC3 A;  1EZI A;  5J49 A;  2VFZ A;  2PX7 A;  4EEO A;  3OH3 A;  2YQS A;  1HJJ A;  1ON6 A;  1ZI4 A;  1R82 A;  4E1K A;  4P02 A;  3O3P A;  3K8E A;  2JCK A;  3OH2 A;  2AM4 A;  1LZ0 A;  3JUK A;  3RSB A;  1GWV A;  1H7H A;  1R7T A;  2UX8 A;  2YQJ A;  2QGI A;  3U2U A;  1V82 A;  1V84 A;  5CQP A;  2FYA A;  2GGO A;  3V0N A;  4HCQ A;  2FYD B;  2MZB A;  4L41 C;  2X5Z A;  4FCU A;  1QGS A;  2VSH A;  1LZ7 A;  2RJ7 A;  2RJ1 A;  4Y6N A;  2BO7 A;  1ZIZ A;  4DDZ A;  3IOI A;  1WSZ A;  1JYL A;  1FO9 A;  4J18 A;  2I7B A;  1YP3 A;  4AYJ A;  4Y9X A;  2V0K A;  3DUV A;  3D5N A;  4BQH A;  1LZI A;  2AH9 A;  5CQL X;  3V0Q A;  5C48 A;  1JVG A;  4LW3 A;  1IIM A;  3LW6 A;  1TW1 A;  1H4E A;  5CQO A;  1FWY A;  3SXG A;  1G97 A;  1I52 A;  3DK5 A;  5C8R A;  1S4O A;  2BO6 A;  2AM3 A;  5CMI A;  1EYR A;  5C3A A;  1H5T A;  3USQ A;  3V8Z A;  2YC5 A;  3U0Y A;  3PNN A;  4HO5 A;  5C49 A;  1NMM B;  1R7U A;  1LL3 A;  4Y7V A;  4B5B A;  1ZI3 A;  4DEC A;  3QVB A;  2XME A;  5FU0 A;  2ZU9 A;  5L6V A;  4D0Z A;  4FRD A;  1Z90 A;  2D0J A;  1R81 A;  1WT2 A;  3FWW A;  5CMF X;  4B2X A;  3SX5 A;  1LL2 A;  5BXC A;  4EE5 A;  4HO3 A;  2YCM A;  5JQQ A;  5EJZ A;  1H5S D;  2X5S A;  1INJ A;  3Q80 A;  4KC2 A;  4P00 A;  3CKV A;  3R3I A;  4HO8 A;  4Y64 A;  1VGU A;  5EIY A;  2I5E A;  1H5R B;  2O1H A;  1G9R A;  3V0P A;  1VM8 A;  1ZCY A;  1H7E A;  3I0G A;  3U2X A;  3CKO A;  4FRL A;  1VZT A;  3BCV A;  2A8U A;  2WVL A;  1PZT A;  1VZU A;  1R7V A;  2AES A;  1G23 A;  4LW6 A;  1ZJO A;  1G2V A;  2Y4M A;  5C1G A;  4FRO A;  3OC9 A;  2XMH A;  1HM9 A;  2E3D A;  1FGG A;  4Y63 A;  4B2W A;  2V0I A;  2OI6 A;  3SXA A;  2FFV A;  1MC3 A;  1O7O A;  4MND A;  2O1F A;  4FRA A;  5FTS A;  1YP4 A;  2I5K A;  3ZGF A;  2YQC A;  4JD0 A;  3OH4 A;  3NGW A;  3U2T A;  2RIZ A;  1FGX A;  2Y4L A;  1OMX A;  4FRQ A;  2YC3 A;  1TZF A;  3E25 A;  1HV9 A;  4DE7 A;  4EVW A;  4NAK A;  3JUJ A;  4G3Q A;  1H5S B;  3ZF8 A;  5CQM X;  5I1F A;  1OMZ A;  3OKR A;  1G93 A;  3CU0 A;  4FQW A;  4Y7T A;  1VPA A;  3I0I X;  3PKP A;  1WT0 A;  2WE9 A;  3JTJ A; 
#chains in the Genus database with same CATH topology
 4ECM A;  4EEM A;  1G3L A;  1R80 A;  2CU2 A;  3V0O A;  5IDS A;  3ZLK A;  3GUE A;  5AJO A;  5FU8 A;  4NAN A;  4KXO A;  2OI7 A;  1JV1 A;  4FRH A;  5D91 A;  4CJ8 A;  2AE7 A;  2V0J A;  1H5S C;  4GBP A;  3I0J A;  1S4P A;  1FO8 A;  2WVM A;  2P73 A;  2AGD A;  2Y6P A;  5IDT A;  1TVY A;  2ZU8 A;  1YRO B;  1GX4 A;  2OEG A;  1LZJ A;  1VGZ A;  2RJ4 A;  4K6R A;  3IOH A;  2XWN A;  1MP3 A;  3RMV A;  2BO4 A;  2FYB A;  1H7F A;  1ZI5 A;  4R7P A;  4UEG A;  5DDV A;  2RIX A;  3CKQ A;  1VZX A;  3CGX A;  4HO2 A;  1FG5 N;  2RJ9 A;  2P6W A;  3SXC A;  2JCJ A;  3CKJ A;  4B4B A;  1WVC A;  3F1Y A;  1H7G A;  5C4B A;  4KPZ A;  4D0T A;  4G87 A;  1H5S A;  3T7M A;  2Y4J A;  1WT3 A;  1S4N A;  3I0C A;  4B4M A;  1ZCU A;  1ZDF A;  4M2A A;  5C3B A;  4AYL A;  1VGW A;  1GWW A;  3OH0 A;  4MYB A;  3D98 A;  2OI5 A;  3U0X A;  1G8O A;  1H4C A;  2DPW A;  1W55 A;  4Y7U A;  1O23 B;  2RIT A;  1GA8 A;  2V0H A;  2Z87 A;  3I0F A;  1VH3 A;  1NHE B;  1H3M A;  3V0M A;  1VGT A;  2W0W A;  2FFU A;  1GQC A;  1QWJ A;  3POL A;  2WGZ A;  2VS5 A;  4B4G A;  1QGQ A;  1FR9 A;  2RIY A;  4EEG A;  1NWG B;  4HOC A;  3SXD A;  5CMG X;  1LL0 A;  2WAW A;  5C47 A;  5L6S A;  2PA4 A;  3IOJ A;  2RJ5 A;  1O7Q A;  4ZDQ A;  1OQM B;  1ZCV A;  2AEC A;  1W57 A;  2Y4K A;  1ZI1 A;  4KNR A;  3PKQ A;  5FUH A;  4FCE A;  1VH1 A;  5DDT A;  1G95 A;  3E26 A;  1ZDG A;  3USR A;  2WEE A;  3EE5 A;  2OEF A;  4O6N A;  2ZU7 A;  1ZJ3 A;  3CKN A;  2AM5 A;  1R7Y A;  2ICX A;  3OH1 A;  4CVH A;  2Y7A A;  1FXJ A;  3N9W A;  5CQN X;  2XWM A;  4KRV A;  3V90 A;  1INI A;  2ICY A;  5AJP A;  4YS8 A;  3T7O A;  4IRQ A;  1O0R A;  2XWL A;  5C4E A;  1H5T B;  3V91 A;  5HS2 A;  3SX8 A;  1H7T A;  2J0A A;  4HO0 A;  4EE4 A;  5C1L A;  4M4K A;  3KIA A;  5C36 A;  4Y62 A;  4C2S A;  2VS3 A;  1FXO A;  2D7R A;  3U2V A;  1H5R A;  4D11 C;  4HO4 A;  3Q4S A;  1R7X A;  2JCL A;  2X60 A;  1MP4 A;  1HM8 A;  1NQI B;  4BMA A;  3SX3 A;  1PZY B;  3TQD A;  1NKH B;  4M28 A;  3R2W A;  4B42 A;  5C4C A;  3RMW A;  1G0R A;  4ASJ A;  4NAI A;  1FRW A;  3D8V A;  1XZ6 A;  2WVK A;  3I0K A;  4ASY A;  4B3U A;  3I0L A;  1MP5 A;  3I0E A;  3V0L A;  1ZHJ A;  5FTV A;  2O1G A;  1E5K A;  2VS4 A;  5EJ1 A;  1ZJ2 A;  4D48 A;  1W77 A;  4FRP A;  2P72 A;  1TW5 A;  4IRP A;  2A8W A;  4G3S A;  4CJC A;  4M2B A;  5C4F A;  2NXV A;  5IFY A;  3BRK X;  4NAL A;  1IIN A;  4EE3 A;  4Y7G A;  1H7Q A;  3DJ4 A;  3SXE A;  3FOQ A;  1JVD A;  2VD4 A;  1FR8 A;  2RJ8 A;  4KNX A;  4D11 A;  2Z86 A;  1H4D A;  1XHB A;  4Y7F A;  1YP2 A;  4EEA A;  1LVW A;  3TZT A;  5C3D A;  1FOA A;  1NF5 B;  5FYE A;  1ON8 A;  3ST8 A;  2QH5 A;  1SS9 A;  3I0H A;  3SX7 A;  2D7I A;  2APC A;  4KC4 A;  5CMJ A;  5C4D A;  1G1L A;  4G3P A;  4FRM A;  4KT7 A;  2PGY A;  4HO6 A;  2J0B A;  4ARW A;  1QG8 A;  4HG6 A;  2VXM A;  3OGZ A;  3K8D A;  4MIX A;  2VXL A;  5C1H A;  2PGV A;  1ZJ1 A;  4Q7C A;  3Q7U A;  5CMH A;  3T7N A;  2E8B A;  5AJN A;  2FYC B;  2YES A;  2RJ0 A;  1JYK A;  1ZCT A;  4FRB A;  2X65 A;  3SPT A;  2BO8 A;  1GQ9 A;  1ZJP A;  3ZLL A;  3V8Y A;  3SXB A;  1FZW A;  1KWS A;  2VSI A;  1V83 A;  3F1C A;  3OAM A;  4FRE A;  4HO9 A;  4JIS A;  4O6M A;  4KC1 A;  4XWI A;  2Q4J A;  2FY7 A;  1H7L A;  3I0D A;  5C38 A;  2QKX A;  1JV3 A;  3U2W A;  4AAW A;  4Y6U A;  1HM0 A;  1WT1 A;  3HL3 A;  1GX0 A;  5FV9 A;  4CJB A;  1VIC A;  4KPX A;  5D92 A;  3ZGG A;  1K4V A;  2RJ6 A;  2JCO A;  2YQH A;  2W0V A;  2GGQ A;  1HJL A;  4KQL A;  1ZJ0 A;  2V0L A;  4AC3 A;  1EZI A;  5J49 A;  2VFZ A;  2PX7 A;  4EEO A;  3OH3 A;  2YQS A;  1HJJ A;  1ON6 A;  1ZI4 A;  1R82 A;  4E1K A;  4P02 A;  3O3P A;  3K8E A;  2JCK A;  3OH2 A;  2AM4 A;  1LZ0 A;  3JUK A;  3RSB A;  1GWV A;  1H7H A;  1R7T A;  2UX8 A;  2YQJ A;  2QGI A;  3U2U A;  1V82 A;  1V84 A;  5CQP A;  2FYA A;  2GGO A;  3V0N A;  4HCQ A;  2FYD B;  2MZB A;  4L41 C;  4FIY A;  2X5Z A;  4FCU A;  1QGS A;  2VSH A;  1LZ7 A;  2RJ7 A;  2RJ1 A;  4Y6N A;  2BO7 A;  1ZIZ A;  4DDZ A;  3IOI A;  1WSZ A;  1JYL A;  1FO9 A;  4J18 A;  2I7B A;  1YP3 A;  4AYJ A;  4Y9X A;  2V0K A;  3DUV A;  3D5N A;  4BQH A;  1LZI A;  2AH9 A;  5CQL X;  3V0Q A;  5C48 A;  1JVG A;  4LW3 A;  1IIM A;  3LW6 A;  1TW1 A;  1H4E A;  5CQO A;  1FWY A;  3SXG A;  1G97 A;  1I52 A;  3DK5 A;  5C8R A;  1S4O A;  2BO6 A;  2VK9 A;  2AM3 A;  5CMI A;  1EYR A;  5C3A A;  1H5T A;  3USQ A;  3V8Z A;  2YC5 A;  3U0Y A;  3PNN A;  4HO5 A;  5C49 A;  1NMM B;  1R7U A;  1LL3 A;  4Y7V A;  4B5B A;  1ZI3 A;  4DEC A;  3QVB A;  2XME A;  5FU0 A;  2ZU9 A;  5L6V A;  4D0Z A;  4FRD A;  1Z90 A;  2D0J A;  1R81 A;  1WT2 A;  4FIX A;  3FWW A;  5CMF X;  4B2X A;  3SX5 A;  1LL2 A;  5BXC A;  4EE5 A;  4HO3 A;  2YCM A;  5JQQ A;  5EJZ A;  1H5S D;  2X5S A;  1INJ A;  3Q80 A;  4KC2 A;  4P00 A;  3CKV A;  3R3I A;  4HO8 A;  4Y64 A;  1VGU A;  5EIY A;  2I5E A;  1H5R B;  2O1H A;  1G9R A;  3V0P A;  1VM8 A;  1ZCY A;  1H7E A;  3I0G A;  3U2X A;  3CKO A;  4FRL A;  1VZT A;  3BCV A;  2A8U A;  2WVL A;  1PZT A;  1VZU A;  1R7V A;  2AES A;  1G23 A;  4LW6 A;  1ZJO A;  1G2V A;  2Y4M A;  5C1G A;  4FRO A;  3OC9 A;  2XMH A;  1HM9 A;  2E3D A;  1FGG A;  4Y63 A;  4B2W A;  2V0I A;  2OI6 A;  3SXA A;  2FFV A;  1MC3 A;  1O7O A;  4MND A;  2O1F A;  4FRA A;  5FTS A;  1YP4 A;  2I5K A;  3ZGF A;  2YQC A;  4JD0 A;  3OH4 A;  3NGW A;  3U2T A;  2RIZ A;  1FGX A;  2Y4L A;  1OMX A;  4FRQ A;  2YC3 A;  1TZF A;  3E25 A;  1HV9 A;  4DE7 A;  4EVW A;  4NAK A;  3JUJ A;  4G3Q A;  1H5S B;  3ZF8 A;  5CQM X;  5I1F A;  1OMZ A;  3OKR A;  1G93 A;  3CU0 A;  4FQW A;  4Y7T A;  2C0N A;  1VPA A;  3I0I X;  3PKP A;  1WT0 A;  2WE9 A;  3JTJ A; 
#chains in the Genus database with same CATH homology
 4ECM A;  4EEM A;  1G3L A;  1R80 A;  2CU2 A;  3V0O A;  5IDS A;  3ZLK A;  3GUE A;  5AJO A;  5FU8 A;  4NAN A;  4KXO A;  2OI7 A;  1JV1 A;  4FRH A;  5D91 A;  4CJ8 A;  2AE7 A;  2V0J A;  1H5S C;  4GBP A;  3I0J A;  1S4P A;  1FO8 A;  2WVM A;  2P73 A;  2AGD A;  2Y6P A;  5IDT A;  1TVY A;  2ZU8 A;  1YRO B;  1GX4 A;  2OEG A;  1LZJ A;  1VGZ A;  2RJ4 A;  4K6R A;  3IOH A;  2XWN A;  1MP3 A;  3RMV A;  2BO4 A;  2FYB A;  1H7F A;  1ZI5 A;  4R7P A;  4UEG A;  5DDV A;  2RIX A;  3CKQ A;  1VZX A;  3CGX A;  4HO2 A;  1FG5 N;  2RJ9 A;  2P6W A;  3SXC A;  2JCJ A;  3CKJ A;  4B4B A;  1WVC A;  3F1Y A;  1H7G A;  5C4B A;  4KPZ A;  4D0T A;  4G87 A;  1H5S A;  3T7M A;  2Y4J A;  1WT3 A;  1S4N A;  3I0C A;  4B4M A;  1ZCU A;  1ZDF A;  4M2A A;  5C3B A;  4AYL A;  1VGW A;  1GWW A;  3OH0 A;  4MYB A;  3D98 A;  2OI5 A;  3U0X A;  1G8O A;  1H4C A;  2DPW A;  1W55 A;  4Y7U A;  1O23 B;  2RIT A;  1GA8 A;  2V0H A;  2Z87 A;  3I0F A;  1VH3 A;  1NHE B;  1H3M A;  3V0M A;  1VGT A;  2W0W A;  2FFU A;  1GQC A;  1QWJ A;  3POL A;  2WGZ A;  2VS5 A;  4B4G A;  1QGQ A;  1FR9 A;  2RIY A;  4EEG A;  1NWG B;  4HOC A;  3SXD A;  5CMG X;  1LL0 A;  2WAW A;  5C47 A;  5L6S A;  2PA4 A;  3IOJ A;  2RJ5 A;  1O7Q A;  4ZDQ A;  1OQM B;  1ZCV A;  2AEC A;  1W57 A;  2Y4K A;  1ZI1 A;  4KNR A;  3PKQ A;  5FUH A;  4FCE A;  1VH1 A;  5DDT A;  1G95 A;  3E26 A;  1ZDG A;  3USR A;  2WEE A;  3EE5 A;  2OEF A;  4O6N A;  2ZU7 A;  1ZJ3 A;  3CKN A;  2AM5 A;  1R7Y A;  2ICX A;  3OH1 A;  4CVH A;  2Y7A A;  1FXJ A;  3N9W A;  5CQN X;  2XWM A;  4KRV A;  3V90 A;  1INI A;  2ICY A;  5AJP A;  4YS8 A;  3T7O A;  4IRQ A;  1O0R A;  2XWL A;  5C4E A;  1H5T B;  3V91 A;  5HS2 A;  3SX8 A;  1H7T A;  2J0A A;  4HO0 A;  4EE4 A;  5C1L A;  4M4K A;  3KIA A;  5C36 A;  4Y62 A;  4C2S A;  2VS3 A;  1FXO A;  2D7R A;  3U2V A;  1H5R A;  4D11 C;  4HO4 A;  3Q4S A;  1R7X A;  2JCL A;  2X60 A;  1MP4 A;  1HM8 A;  1NQI B;  4BMA A;  3SX3 A;  1PZY B;  3TQD A;  1NKH B;  4M28 A;  3R2W A;  4B42 A;  5C4C A;  3RMW A;  1G0R A;  4ASJ A;  4NAI A;  1FRW A;  3D8V A;  1XZ6 A;  2WVK A;  3I0K A;  4ASY A;  4B3U A;  3I0L A;  1MP5 A;  3I0E A;  3V0L A;  1ZHJ A;  5FTV A;  2O1G A;  1E5K A;  2VS4 A;  5EJ1 A;  1ZJ2 A;  4D48 A;  1W77 A;  4FRP A;  2P72 A;  1TW5 A;  4IRP A;  2A8W A;  4G3S A;  4CJC A;  4M2B A;  5C4F A;  2NXV A;  5IFY A;  3BRK X;  4NAL A;  1IIN A;  4EE3 A;  4Y7G A;  1H7Q A;  3DJ4 A;  3SXE A;  3FOQ A;  1JVD A;  2VD4 A;  1FR8 A;  2RJ8 A;  4KNX A;  4D11 A;  2Z86 A;  1H4D A;  1XHB A;  4Y7F A;  1YP2 A;  4EEA A;  1LVW A;  3TZT A;  5C3D A;  1FOA A;  1NF5 B;  5FYE A;  1ON8 A;  3ST8 A;  2QH5 A;  1SS9 A;  3I0H A;  3SX7 A;  2D7I A;  2APC A;  4KC4 A;  5CMJ A;  5C4D A;  1G1L A;  4G3P A;  4FRM A;  4KT7 A;  2PGY A;  4HO6 A;  2J0B A;  4ARW A;  1QG8 A;  4HG6 A;  2VXM A;  3OGZ A;  3K8D A;  4MIX A;  2VXL A;  5C1H A;  2PGV A;  1ZJ1 A;  4Q7C A;  3Q7U A;  5CMH A;  3T7N A;  2E8B A;  5AJN A;  2FYC B;  2YES A;  2RJ0 A;  1JYK A;  1ZCT A;  4FRB A;  2X65 A;  3SPT A;  2BO8 A;  1GQ9 A;  1ZJP A;  3ZLL A;  3V8Y A;  3SXB A;  1FZW A;  1KWS A;  2VSI A;  1V83 A;  3F1C A;  3OAM A;  4FRE A;  4HO9 A;  4JIS A;  4O6M A;  4KC1 A;  4XWI A;  2Q4J A;  2FY7 A;  1H7L A;  3I0D A;  5C38 A;  2QKX A;  1JV3 A;  3U2W A;  4AAW A;  4Y6U A;  1HM0 A;  1WT1 A;  3HL3 A;  1GX0 A;  5FV9 A;  4CJB A;  1VIC A;  4KPX A;  5D92 A;  3ZGG A;  1K4V A;  2RJ6 A;  2JCO A;  2YQH A;  2W0V A;  2GGQ A;  1HJL A;  4KQL A;  1ZJ0 A;  2V0L A;  4AC3 A;  1EZI A;  5J49 A;  2VFZ A;  2PX7 A;  4EEO A;  3OH3 A;  2YQS A;  1HJJ A;  1ON6 A;  1ZI4 A;  1R82 A;  4E1K A;  4P02 A;  3O3P A;  3K8E A;  2JCK A;  3OH2 A;  2AM4 A;  1LZ0 A;  3JUK A;  3RSB A;  1GWV A;  1H7H A;  1R7T A;  2UX8 A;  2YQJ A;  2QGI A;  3U2U A;  1V82 A;  1V84 A;  5CQP A;  2FYA A;  2GGO A;  3V0N A;  4HCQ A;  2FYD B;  2MZB A;  4L41 C;  4FIY A;  2X5Z A;  4FCU A;  1QGS A;  2VSH A;  1LZ7 A;  2RJ7 A;  2RJ1 A;  4Y6N A;  2BO7 A;  1ZIZ A;  4DDZ A;  3IOI A;  1WSZ A;  1JYL A;  1FO9 A;  4J18 A;  2I7B A;  1YP3 A;  4AYJ A;  4Y9X A;  2V0K A;  3DUV A;  3D5N A;  4BQH A;  1LZI A;  2AH9 A;  5CQL X;  3V0Q A;  5C48 A;  1JVG A;  4LW3 A;  1IIM A;  3LW6 A;  1TW1 A;  1H4E A;  5CQO A;  1FWY A;  3SXG A;  1G97 A;  1I52 A;  3DK5 A;  5C8R A;  1S4O A;  2BO6 A;  2VK9 A;  2AM3 A;  5CMI A;  1EYR A;  5C3A A;  1H5T A;  3USQ A;  3V8Z A;  2YC5 A;  3U0Y A;  3PNN A;  4HO5 A;  5C49 A;  1NMM B;  1R7U A;  1LL3 A;  4Y7V A;  4B5B A;  1ZI3 A;  4DEC A;  3QVB A;  2XME A;  5FU0 A;  2ZU9 A;  5L6V A;  4D0Z A;  4FRD A;  1Z90 A;  2D0J A;  1R81 A;  1WT2 A;  4FIX A;  3FWW A;  5CMF X;  4B2X A;  3SX5 A;  1LL2 A;  5BXC A;  4EE5 A;  4HO3 A;  2YCM A;  5JQQ A;  5EJZ A;  1H5S D;  2X5S A;  1INJ A;  3Q80 A;  4KC2 A;  4P00 A;  3CKV A;  3R3I A;  4HO8 A;  4Y64 A;  1VGU A;  5EIY A;  2I5E A;  1H5R B;  2O1H A;  1G9R A;  3V0P A;  1VM8 A;  1ZCY A;  1H7E A;  3I0G A;  3U2X A;  3CKO A;  4FRL A;  1VZT A;  3BCV A;  2A8U A;  2WVL A;  1PZT A;  1VZU A;  1R7V A;  2AES A;  1G23 A;  4LW6 A;  1ZJO A;  1G2V A;  2Y4M A;  5C1G A;  4FRO A;  3OC9 A;  2XMH A;  1HM9 A;  2E3D A;  1FGG A;  4Y63 A;  4B2W A;  2V0I A;  2OI6 A;  3SXA A;  2FFV A;  1MC3 A;  1O7O A;  4MND A;  2O1F A;  4FRA A;  5FTS A;  1YP4 A;  2I5K A;  3ZGF A;  2YQC A;  4JD0 A;  3OH4 A;  3NGW A;  3U2T A;  2RIZ A;  1FGX A;  2Y4L A;  1OMX A;  4FRQ A;  2YC3 A;  1TZF A;  3E25 A;  1HV9 A;  4DE7 A;  4EVW A;  4NAK A;  3JUJ A;  4G3Q A;  1H5S B;  3ZF8 A;  5CQM X;  5I1F A;  1OMZ A;  3OKR A;  1G93 A;  3CU0 A;  4FQW A;  4Y7T A;  2C0N A;  1VPA A;  3I0I X;  3PKP A;  1WT0 A;  2WE9 A;  3JTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...