3BCVA

Crystal structure of a putative glycosyltransferase from bacteroides fragilis
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
216
structure length
196
Chain Sequence
LIPKVSVIVPIYNVEKYLDQCVQALLAQTLSDIEIILIDDESPDNCPKICDDYAAQYPNIKVIHKKNAGLGMACNSGLDVATGEYVAFCDSDDYVDSDMYMTMYNVAQKYTCDAVFTFKLYKNKNEIHTLLKDLIASDPYAREERAIQVSAKVVLYRRNLIEKKHLRFVSERILPSEDLIFNVDVLANSNIVCVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative glycosyltransferase protein
publication title Crystal structure of a putative glycosyltransferase from Bacteroides fragilis.
rcsb
source organism Bacteroides fragilis
molecule tags Transferase
total genus 67
structure length 196
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3bcvA00
3V91A 1H5TB 1WT2A 2BO7A 4FROA 1ZJ0A 1O23B 3D98A 1G8OA 4FRQA 3F1CA 4R7PA 1NHEB 4NAKA 1H4DA 1SS9A 5CMGX 2PGVA 3TZTA 1ZJ2A 5FTVA 3V0OA 2JCJA 3JUJA 1FGXA 5C4BA 1MP4A 4GBPA 4Y9XA 2RJ5A 3BRKX 3SX5A 4E1KA 1INJA 2I7BA 4HOCA 1XZ6A 1HM0A 2PX7A 1H5SD 1W55A 3SPTA 1JYKA 1FXJA 2WVMA 4DDZA 4NAIA 4Y7VA 1LL3A 2JCKA 2FFUA 4ASJA 5C3DA 3I0HA 4JISA 2RJ1A 1ZJ3A 5JQQA 1Z90A 1FG5N 2V0KA 4KT7A 3ZF8A 3U2XA 2YCMA 4KQLA 1R7XA 1GQCA 1FO8A 2W0VA 1S4OA 2XWLA 1WT0A 4KPZA 4KC1A 3I0GA 3U0YA 2ICXA 3EE5A 2WE9A 3U0XA 2X5ZA 1ZJOA 2ICYA 3V0MA 2D0JA 3POLA 3U2UA 3I0LA 3NGWA 4G3SA 2V0LA 2O1HA 4B5BA 4FREA 2BO4A 1QGSA 4FRMA 5HS2A 3OC9A 2VSHA 2FYBA 1WSZA 5CMFX 4K6RA 4M28A 1FWYA 2OEFA 1FR9A 2V0HA 4KXOA 5FYEA 3I0FA 4AYLA 3SX7A 4HO9A 1FZWA 5AJNA 1ZDGA 1FO9A 4HO0A 2RJ8A 4B4MA 2UX8A 1JYLA 1IINA 2YQCA 1JV3A 4C2SA 1ZCUA 1H4EA 2MZBA 3ST8A 2D7RA 1LL2A 4L41C 3I0IX 4KC4A 1ZCVA 1YP2A 3O3PA 2WVLA 4EE3A 4Y6NA 3V0QA 1G2VA 5CQOA 3ZLKA 1W77A 3V90A 4HO4A 5EIYA 1QGQA 1OMZA 4CJCA 1TZFA 2GGQA 3OH2A 1HM8A 3Q7UA 1W57A 4DE7A 1TVYA 1ZCTA 1G97A 1VZTA 2Y7AA 3SX8A 3SXDA 2FY7A 2VS4A 2ZU9A 1ZJ1A 4AAWA 1H7FA 1H7HA 4FRAA 3OH0A 1LZIA 1VGZA 2A8WA 3CU0A 3DUVA 3ZGGA 3I0JA 3U2VA 5AJPA 4BMAA 1K4VA 3N9WA 1E5KA 3CKVA 3SX3A 5C48A 1S4NA 1G3LA 2Z87A 2Y4KA 1TW5A 4ZDQA 1H3MA 2AH9A 1G93A 4Y64A 3ZLLA 1G23A 5DDVA 1NMMB 4NANA 2AM3A 4B42A 3T7OA 2Y4MA 2VFZA 4EEMA 1ZJPA 1NKHB 1PZYB 1WT1A 3RSBA 3V0LA 1H5RA 5L6SA 5CQPA 3USQA 1G0RA 3FWWA 1H7QA 3KIAA 4D48A 2QH5A 1VM8A 2WEEA 1GX4A 2P6WA 1R7UA 1VGWA 2V0IA 1EYRA 1HM9A 4Y6UA 1IIMA 3I0KA 1H5RB 3Q80A 4UEGA 3OH1A 1V83A 5CQLX 2I5EA 3R3IA 5FTSA 4B2WA 1H5SC 1H5SA 3JTJA 1H7GA 5C4DA 1FR8A 3OH4A 3DJ4A 3CGXA 2VS3A 2RJ0A 5EJZA 5DDTA 3Q4SA 4NALA 5IDSA 5C1GA 3U2TA 2Q4JA 2VXLA 5EJ1A 3GUEA 3OGZA 2E8BA 4G3QA 4Y63A 1GQ9A 1ZIZA 1H5SB 2OEGA 2VS5A 2RJ4A 4Y7TA 1HV9A 1EZIA 2YQHA 4EE4A 1YP3A 2Y6PA 1YP4A 4FQWA 4HCQA 5FUHA 4LW6A 2FYCB 1G1LA 1XHBA 1MP3A 4EEGA 4HO5A 4EE5A 5C36A 2V0JA 3IOHA 2XWNA 1WT3A 3F1YA 2DPWA 1WVCA 1O7OA 4MYBA 2D7IA 3QVBA 4ECMA 3TQDA 4HO2A 4HO8A 3U2WA 1R7YA 5C8RA 2Z86A 4LW3A 4FCEA 2FFVA 2AM5A 5C3BA 5FV9A 3FOQA 4KNRA 3E25A 1YROB 4KRVA 3V0NA 4Y7GA 2AM4A 3SXGA 1ZDFA 3R2WA 2VSIA 4MNDA 2VD4A 2APCA 5C4FA 1VGUA 4FRDA 1INIA 4B4GA 2Y4JA 1LZ0A 2RJ9A 2XWMA 2RJ6A 4M4KA 4M2BA 1GX0A 3V8ZA 4D0TA 4FRHA 1HJJA 1R82A 1LZJA 3E26A 1I52A 5C3AA 4YS8A 4JD0A 1MC3A 2ZU7A 2OI5A 2YQJA 2X5SA 1R7VA 1GWVA 3BCVA 2AECA 2FYDB 4HG6A 3CKJA 4B4BA 3K8DA 3SXCA 3RMWA 3SXEA 1JVGA 1VPAA 2QKXA 3IOJA 4P00A 2RIZA 2YQSA 1ZCYA 1HJLA 2ZU8A 1ZI1A 2YC3A 1QWJA 2E3DA 5AJOA 2XMEA 2RIXA 4CJ8A 5CQNX 4DECA 1H4CA 2O1FA 3V0PA 1S4PA 1LVWA 5C4CA 3T7NA 1V82A 3PKQA 1VH1A 1GWWA 2Y4LA 2XMHA 1ZI4A 3JUKA 3I0DA 4P02A 5CMIA 2NXVA 4KPXA 5CQMX 5I1FA 1NQIB 2GGOA 2O1GA 5FU0A 3CKNA 3OKRA 5CMJA 4FRBA 1R81A 5C1HA 2AGDA 2P73A 2FYAA 1NF5B 1QG8A 2OI7A 1ON8A 1H7LA 2YC5A 3USRA 1V84A 1LL0A 4Y7UA 2OI6A 2A8UA 1VZXA 4EEOA 5CMHA 1KWSA 1OQMB 2AE7A 5C38A 4IRPA 1ZI3A 2BO8A 3I0CA 4G87A 1VGTA 4D0ZA 1MP5A 1PZTA 3HL3A 1R7TA 1TW1A 3I0EA 4EEAA 4Y62A 2YESA 3RMVA 1VZUA 2AESA 4KC2A 4CJBA 3T7MA 3PNNA 1R80A 5J49A 3D5NA 4B3UA 4Y7FA 2WAWA 1JVDA 1OMXA 3SXBA 4ASYA 4AC3A 2WGZA 1ZI5A 5C47A 2I5KA 4J18A 3CKQA 1FOAA 4KNXA 3D8VA 2VXMA 2PA4A 3V8YA 1G9RA 2W0WA 4FRLA 2CU2A 2X60A 3OAMA 4HO6A 3PKPA 1O0RA 3DK5A 1LZ7A 1ZHJA 5C4EA 5C1LA 3K8EA 4FCUA 4FRPA 3IOIA 4G3PA 2QGIA 4D11C 4BQHA 4D11A 1FRWA 1H7TA 4IRQA 5FU8A 4HO3A 4B2XA 2RJ7A 2BO6A 1ON6A 2JCOA 1O7QA 1VH3A 2RITA 1FGGA 1GA8A 2PGYA 3CKOA 1G95A 1H5TA 2JCLA 3LW6A 1FXOA 3ZGFA 5L6VA 1VICA 2P72A 1JV1A 5IFYA 4XWIA 1NWGB 5IDTA 2X65A 5BXCA 2RIYA 4AYJA 3OH3A 4CVHA 4M2AA 2WVKA 4ARWA 3SXAA 5C49A 4EVWA 1H7EA
chains in the Genus database with same CATH superfamily
3V91A 1H5TB 1WT2A 2BO7A 4FROA 1ZJ0A 1O23B 3D98A 1G8OA 4FRQA 3F1CA 4R7PA 1NHEB 4NAKA 1H4DA 1SS9A 5CMGX 2PGVA 3TZTA 1ZJ2A 5FTVA 3V0OA 2JCJA 3JUJA 1FGXA 5C4BA 1MP4A 4GBPA 4Y9XA 2RJ5A 3BRKX 3SX5A 4E1KA 1INJA 2I7BA 4HOCA 1XZ6A 1HM0A 2PX7A 1H5SD 1W55A 3SPTA 1JYKA 1FXJA 2WVMA 4DDZA 4NAIA 4Y7VA 1LL3A 2JCKA 2FFUA 4ASJA 5C3DA 3I0HA 4JISA 2RJ1A 1ZJ3A 5JQQA 1Z90A 1FG5N 2V0KA 4KT7A 3ZF8A 3U2XA 2YCMA 4FIYA 4KQLA 1R7XA 1GQCA 1FO8A 2W0VA 1S4OA 2XWLA 1WT0A 4KPZA 4KC1A 3I0GA 3U0YA 4O6NA 2ICXA 3EE5A 2WE9A 3U0XA 2X5ZA 1ZJOA 2ICYA 3V0MA 2D0JA 3POLA 3U2UA 3I0LA 3NGWA 4G3SA 2V0LA 2O1HA 4B5BA 4FREA 2BO4A 1QGSA 4FRMA 5HS2A 3OC9A 2VSHA 2FYBA 1WSZA 5CMFX 4K6RA 4M28A 1FWYA 2OEFA 1FR9A 2V0HA 4KXOA 5FYEA 3I0FA 4AYLA 3SX7A 4HO9A 4FIXA 1FZWA 5AJNA 1ZDGA 1FO9A 4HO0A 2RJ8A 4B4MA 2UX8A 1JYLA 1IINA 2YQCA 1JV3A 4C2SA 1ZCUA 1H4EA 2MZBA 3ST8A 2D7RA 1LL2A 4L41C 3I0IX 4KC4A 1ZCVA 1YP2A 3O3PA 2WVLA 4EE3A 4Y6NA 3V0QA 1G2VA 5CQOA 3ZLKA 1W77A 3V90A 4HO4A 5EIYA 1QGQA 1OMZA 4CJCA 1TZFA 2GGQA 3OH2A 1HM8A 3Q7UA 1W57A 4DE7A 1TVYA 1ZCTA 1G97A 1VZTA 2Y7AA 3SX8A 3SXDA 2FY7A 2VS4A 2ZU9A 1ZJ1A 2J0BA 4AAWA 1H7FA 1H7HA 4FRAA 3OH0A 1LZIA 1VGZA 2A8WA 3CU0A 3DUVA 3ZGGA 3I0JA 3U2VA 5AJPA 4BMAA 1K4VA 3N9WA 1E5KA 3CKVA 3SX3A 5C48A 1S4NA 1G3LA 2Z87A 2Y4KA 1TW5A 4ZDQA 1H3MA 2AH9A 1G93A 4Y64A 3ZLLA 1G23A 5DDVA 1NMMB 4NANA 2AM3A 4B42A 3T7OA 2Y4MA 2VFZA 4EEMA 1ZJPA 1NKHB 1PZYB 1WT1A 3RSBA 3V0LA 1H5RA 5L6SA 5CQPA 3USQA 1G0RA 3FWWA 1H7QA 3KIAA 4D48A 2QH5A 1VM8A 2WEEA 1GX4A 2P6WA 1R7UA 1VGWA 2V0IA 1EYRA 1HM9A 4Y6UA 1IIMA 3I0KA 1H5RB 3Q80A 4UEGA 3OH1A 1V83A 5CQLX 2I5EA 3R3IA 5FTSA 4B2WA 1H5SC 1H5SA 3JTJA 1H7GA 4MIXA 5C4DA 1FR8A 3OH4A 3DJ4A 3CGXA 2VS3A 2RJ0A 5EJZA 5DDTA 3Q4SA 4NALA 5IDSA 5C1GA 3U2TA 2Q4JA 2VXLA 5EJ1A 3GUEA 3OGZA 2E8BA 4G3QA 4Y63A 1GQ9A 1ZIZA 1H5SB 2OEGA 2VS5A 4O6MA 2RJ4A 4Y7TA 1HV9A 1EZIA 2YQHA 4EE4A 1YP3A 2Y6PA 1YP4A 4FQWA 4HCQA 5FUHA 4LW6A 2FYCB 1G1LA 1XHBA 1MP3A 4EEGA 4HO5A 4EE5A 5C36A 2V0JA 3IOHA 2XWNA 1WT3A 3F1YA 2DPWA 1WVCA 1O7OA 4MYBA 2D7IA 3QVBA 4ECMA 3TQDA 4HO2A 4HO8A 3U2WA 1R7YA 5C8RA 2Z86A 4LW3A 4FCEA 2FFVA 2AM5A 5C3BA 5FV9A 3FOQA 4KNRA 3E25A 1YROB 4KRVA 3V0NA 4Y7GA 2AM4A 3SXGA 1ZDFA 3R2WA 2VSIA 4MNDA 2VD4A 2APCA 5C4FA 1VGUA 4FRDA 1INIA 4B4GA 2Y4JA 1LZ0A 2RJ9A 2XWMA 2RJ6A 4M4KA 4M2BA 1GX0A 3V8ZA 4D0TA 4FRHA 1HJJA 1R82A 1LZJA 3E26A 1I52A 5C3AA 4YS8A 4JD0A 1MC3A 2ZU7A 2OI5A 2YQJA 2X5SA 1R7VA 1GWVA 3BCVA 2AECA 2FYDB 4HG6A 3CKJA 4B4BA 3K8DA 3SXCA 3RMWA 3SXEA 1JVGA 1VPAA 2QKXA 3IOJA 4P00A 2RIZA 2YQSA 1ZCYA 1HJLA 2ZU8A 1ZI1A 2YC3A 1QWJA 2E3DA 5AJOA 2XMEA 2RIXA 4CJ8A 5CQNX 4DECA 1H4CA 2O1FA 3V0PA 1S4PA 1LVWA 5C4CA 3T7NA 1V82A 3PKQA 1VH1A 1GWWA 2Y4LA 2XMHA 1ZI4A 3JUKA 3I0DA 4P02A 5CMIA 2NXVA 4KPXA 5CQMX 5I1FA 1NQIB 5D91A 2GGOA 2O1GA 5FU0A 3CKNA 3OKRA 5CMJA 4FRBA 1R81A 5C1HA 2AGDA 2P73A 2FYAA 1NF5B 1QG8A 2OI7A 1ON8A 1H7LA 2YC5A 3USRA 1V84A 1LL0A 4Y7UA 2OI6A 2A8UA 1VZXA 4EEOA 5CMHA 1KWSA 1OQMB 2AE7A 5C38A 2VK9A 4IRPA 1ZI3A 2BO8A 3I0CA 4G87A 1VGTA 4D0ZA 1MP5A 1PZTA 4Q7CA 3HL3A 1R7TA 1TW1A 3I0EA 4EEAA 4Y62A 2YESA 3RMVA 1VZUA 2AESA 4KC2A 4CJBA 3T7MA 3PNNA 1R80A 5J49A 3D5NA 4B3UA 4Y7FA 2WAWA 1JVDA 1OMXA 3SXBA 5D92A 4ASYA 4AC3A 2WGZA 1ZI5A 5C47A 2I5KA 4J18A 3CKQA 1FOAA 4KNXA 3D8VA 2VXMA 2PA4A 3V8YA 1G9RA 2W0WA 4FRLA 2CU2A 2X60A 3OAMA 4HO6A 3PKPA 1O0RA 3DK5A 1LZ7A 1ZHJA 5C4EA 5C1LA 3K8EA 4FCUA 4FRPA 3IOIA 4G3PA 2QGIA 4D11C 2C0NA 4BQHA 1FRWA 4D11A 1H7TA 4IRQA 5FU8A 4HO3A 4B2XA 2RJ7A 2BO6A 2J0AA 1ON6A 2JCOA 1O7QA 1VH3A 2RITA 1FGGA 1GA8A 2PGYA 3CKOA 1G95A 1H5TA 2JCLA 3LW6A 1FXOA 3ZGFA 5L6VA 1VICA 2P72A 1JV1A 5IFYA 4XWIA 1NWGB 5IDTA 2X65A 5BXCA 2RIYA 4AYJA 3OH3A 4CVHA 4M2AA 2WVKA 4ARWA 3SXAA 5C49A 4EVWA 1H7EA
chains in the Genus database with same CATH topology
3V91A 1H5TB 1WT2A 2BO7A 4FROA 1ZJ0A 1O23B 3D98A 1G8OA 4FRQA 3F1CA 4R7PA 1NHEB 4NAKA 1H4DA 1SS9A 5CMGX 2PGVA 3TZTA 1ZJ2A 5FTVA 3V0OA 2JCJA 3JUJA 1FGXA 5C4BA 1MP4A 4GBPA 4Y9XA 2RJ5A 3BRKX 3SX5A 4E1KA 1INJA 2I7BA 4HOCA 1XZ6A 1HM0A 2PX7A 1H5SD 1W55A 3SPTA 1JYKA 1FXJA 2WVMA 4DDZA 4NAIA 4Y7VA 1LL3A 2JCKA 2FFUA 4ASJA 5C3DA 3I0HA 4JISA 2RJ1A 1ZJ3A 5JQQA 1Z90A 1FG5N 2V0KA 4KT7A 3ZF8A 3U2XA 2YCMA 4FIYA 4KQLA 1R7XA 1GQCA 1FO8A 2W0VA 1S4OA 2XWLA 1WT0A 4KPZA 4KC1A 3I0GA 3U0YA 4O6NA 2ICXA 3EE5A 2WE9A 3U0XA 2X5ZA 1ZJOA 2ICYA 3V0MA 2D0JA 3POLA 3U2UA 3I0LA 3NGWA 4G3SA 2V0LA 2O1HA 4B5BA 4FREA 2BO4A 1QGSA 4FRMA 5HS2A 3OC9A 2VSHA 2FYBA 1WSZA 5CMFX 4K6RA 4M28A 1FWYA 2OEFA 1FR9A 2V0HA 4KXOA 5FYEA 3I0FA 4AYLA 3SX7A 4HO9A 4FIXA 1FZWA 5AJNA 1ZDGA 1FO9A 4HO0A 2RJ8A 4B4MA 2UX8A 1JYLA 1IINA 2YQCA 1JV3A 4C2SA 1ZCUA 1H4EA 2MZBA 3ST8A 2D7RA 1LL2A 4L41C 3I0IX 4KC4A 1ZCVA 1YP2A 3O3PA 2WVLA 4EE3A 4Y6NA 3V0QA 1G2VA 5CQOA 3ZLKA 1W77A 3V90A 4HO4A 5EIYA 1QGQA 1OMZA 4CJCA 1TZFA 2GGQA 3OH2A 1HM8A 3Q7UA 1W57A 4DE7A 1TVYA 1ZCTA 1G97A 1VZTA 2Y7AA 3SX8A 3SXDA 2FY7A 2VS4A 2ZU9A 1ZJ1A 2J0BA 4AAWA 1H7FA 1H7HA 4FRAA 3OH0A 1LZIA 1VGZA 2A8WA 3CU0A 3DUVA 3ZGGA 3I0JA 3U2VA 5AJPA 4BMAA 1K4VA 3N9WA 1E5KA 3CKVA 3SX3A 5C48A 1S4NA 1G3LA 2Z87A 2Y4KA 1TW5A 4ZDQA 1H3MA 2AH9A 1G93A 4Y64A 3ZLLA 1G23A 5DDVA 1NMMB 4NANA 2AM3A 4B42A 3T7OA 2Y4MA 2VFZA 4EEMA 1ZJPA 1NKHB 1PZYB 1WT1A 3RSBA 3V0LA 1H5RA 5L6SA 5CQPA 3USQA 1G0RA 3FWWA 1H7QA 3KIAA 4D48A 2QH5A 1VM8A 2WEEA 1GX4A 2P6WA 1R7UA 1VGWA 2V0IA 1EYRA 1HM9A 4Y6UA 1IIMA 3I0KA 1H5RB 3Q80A 4UEGA 3OH1A 1V83A 5CQLX 2I5EA 3R3IA 5FTSA 4B2WA 1H5SC 1H5SA 3JTJA 1H7GA 4MIXA 5C4DA 1FR8A 3OH4A 3DJ4A 3CGXA 2VS3A 2RJ0A 5EJZA 5DDTA 3Q4SA 4NALA 5IDSA 5C1GA 3U2TA 2Q4JA 2VXLA 5EJ1A 3GUEA 3OGZA 2E8BA 4G3QA 4Y63A 1GQ9A 1ZIZA 1H5SB 2OEGA 2VS5A 4O6MA 2RJ4A 4Y7TA 1HV9A 1EZIA 2YQHA 4EE4A 1YP3A 2Y6PA 1YP4A 4FQWA 4HCQA 5FUHA 4LW6A 2FYCB 1G1LA 1XHBA 1MP3A 4EEGA 4HO5A 4EE5A 5C36A 2V0JA 3IOHA 2XWNA 1WT3A 3F1YA 2DPWA 1WVCA 1O7OA 4MYBA 2D7IA 3QVBA 4ECMA 3TQDA 4HO2A 4HO8A 3U2WA 1R7YA 5C8RA 2Z86A 4LW3A 4FCEA 2FFVA 2AM5A 5C3BA 5FV9A 3FOQA 4KNRA 3E25A 1YROB 4KRVA 3V0NA 4Y7GA 2AM4A 3SXGA 1ZDFA 3R2WA 2VSIA 4MNDA 2VD4A 2APCA 5C4FA 1VGUA 4FRDA 1INIA 4B4GA 2Y4JA 1LZ0A 2RJ9A 2XWMA 2RJ6A 4M4KA 4M2BA 1GX0A 3V8ZA 4D0TA 4FRHA 1HJJA 1R82A 1LZJA 3E26A 1I52A 5C3AA 4YS8A 4JD0A 1MC3A 2ZU7A 2OI5A 2YQJA 2X5SA 1R7VA 1GWVA 3BCVA 2AECA 2FYDB 4HG6A 3CKJA 4B4BA 3K8DA 3SXCA 3RMWA 3SXEA 1JVGA 1VPAA 2QKXA 3IOJA 4P00A 2RIZA 2YQSA 1ZCYA 1HJLA 2ZU8A 1ZI1A 2YC3A 1QWJA 2E3DA 5AJOA 2XMEA 2RIXA 4CJ8A 5CQNX 4DECA 1H4CA 2O1FA 3V0PA 1S4PA 1LVWA 5C4CA 3T7NA 1V82A 3PKQA 1VH1A 1GWWA 2Y4LA 2XMHA 1ZI4A 3JUKA 3I0DA 4P02A 5CMIA 2NXVA 4KPXA 5CQMX 5I1FA 1NQIB 5D91A 2GGOA 2O1GA 5FU0A 3CKNA 3OKRA 5CMJA 4FRBA 1R81A 5C1HA 2AGDA 2P73A 2FYAA 1NF5B 1QG8A 2OI7A 1ON8A 1H7LA 2YC5A 3USRA 1V84A 1LL0A 4Y7UA 2OI6A 2A8UA 1VZXA 4EEOA 5CMHA 1KWSA 1OQMB 2AE7A 5C38A 2VK9A 4IRPA 1ZI3A 2BO8A 3I0CA 4G87A 1VGTA 4D0ZA 1MP5A 1PZTA 4Q7CA 3HL3A 1R7TA 1TW1A 3I0EA 4EEAA 4Y62A 2YESA 3RMVA 1VZUA 2AESA 4KC2A 4CJBA 3T7MA 3PNNA 1R80A 5J49A 3D5NA 4B3UA 4Y7FA 2WAWA 1JVDA 1OMXA 3SXBA 5D92A 4ASYA 4AC3A 2WGZA 1ZI5A 5C47A 2I5KA 4J18A 3CKQA 1FOAA 4KNXA 3D8VA 2VXMA 2PA4A 3V8YA 1G9RA 2W0WA 4FRLA 2CU2A 2X60A 3OAMA 4HO6A 3PKPA 1O0RA 3DK5A 1LZ7A 1ZHJA 5C4EA 5C1LA 3K8EA 4FCUA 4FRPA 3IOIA 4G3PA 2QGIA 4D11C 2C0NA 4BQHA 1FRWA 4D11A 1H7TA 4IRQA 5FU8A 4HO3A 4B2XA 2RJ7A 2BO6A 2J0AA 1ON6A 2JCOA 1O7QA 1VH3A 2RITA 1FGGA 1GA8A 2PGYA 3CKOA 1G95A 1H5TA 2JCLA 3LW6A 1FXOA 3ZGFA 5L6VA 1VICA 2P72A 1JV1A 5IFYA 4XWIA 1NWGB 5IDTA 2X65A 5BXCA 2RIYA 4AYJA 3OH3A 4CVHA 4M2AA 2WVKA 4ARWA 3SXAA 5C49A 4EVWA 1H7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V91 A;  1H5T B;  1WT2 A;  2BO7 A;  4FRO A;  1ZJ0 A;  1O23 B;  3D98 A;  1G8O A;  4FRQ A;  3F1C A;  4R7P A;  1NHE B;  4NAK A;  1H4D A;  1SS9 A;  5CMG X;  2PGV A;  3TZT A;  1ZJ2 A;  5FTV A;  3V0O A;  2JCJ A;  3JUJ A;  1FGX A;  5C4B A;  1MP4 A;  4GBP A;  4Y9X A;  2RJ5 A;  3BRK X;  3SX5 A;  4E1K A;  1INJ A;  2I7B A;  4HOC A;  1XZ6 A;  1HM0 A;  2PX7 A;  1H5S D;  1W55 A;  3SPT A;  1JYK A;  1FXJ A;  2WVM A;  4DDZ A;  4NAI A;  4Y7V A;  1LL3 A;  2JCK A;  2FFU A;  4ASJ A;  5C3D A;  3I0H A;  4JIS A;  2RJ1 A;  1ZJ3 A;  5JQQ A;  1Z90 A;  1FG5 N;  2V0K A;  4KT7 A;  3ZF8 A;  3U2X A;  2YCM A;  4KQL A;  1R7X A;  1GQC A;  1FO8 A;  2W0V A;  1S4O A;  2XWL A;  1WT0 A;  4KPZ A;  4KC1 A;  3I0G A;  3U0Y A;  2ICX A;  3EE5 A;  2WE9 A;  3U0X A;  2X5Z A;  1ZJO A;  2ICY A;  3V0M A;  2D0J A;  3POL A;  3U2U A;  3I0L A;  3NGW A;  4G3S A;  2V0L A;  2O1H A;  4B5B A;  4FRE A;  2BO4 A;  1QGS A;  4FRM A;  5HS2 A;  3OC9 A;  2VSH A;  2FYB A;  1WSZ A;  5CMF X;  4K6R A;  4M28 A;  1FWY A;  2OEF A;  1FR9 A;  2V0H A;  4KXO A;  5FYE A;  3I0F A;  4AYL A;  3SX7 A;  4HO9 A;  1FZW A;  5AJN A;  1ZDG A;  1FO9 A;  4HO0 A;  2RJ8 A;  4B4M A;  2UX8 A;  1JYL A;  1IIN A;  2YQC A;  1JV3 A;  4C2S A;  1ZCU A;  1H4E A;  2MZB A;  3ST8 A;  2D7R A;  1LL2 A;  4L41 C;  3I0I X;  4KC4 A;  1ZCV A;  1YP2 A;  3O3P A;  2WVL A;  4EE3 A;  4Y6N A;  3V0Q A;  1G2V A;  5CQO A;  3ZLK A;  1W77 A;  3V90 A;  4HO4 A;  5EIY A;  1QGQ A;  1OMZ A;  4CJC A;  1TZF A;  2GGQ A;  3OH2 A;  1HM8 A;  3Q7U A;  1W57 A;  4DE7 A;  1TVY A;  1ZCT A;  1G97 A;  1VZT A;  2Y7A A;  3SX8 A;  3SXD A;  2FY7 A;  2VS4 A;  2ZU9 A;  1ZJ1 A;  4AAW A;  1H7F A;  1H7H A;  4FRA A;  3OH0 A;  1LZI A;  1VGZ A;  2A8W A;  3CU0 A;  3DUV A;  3ZGG A;  3I0J A;  3U2V A;  5AJP A;  4BMA A;  1K4V A;  3N9W A;  1E5K A;  3CKV A;  3SX3 A;  5C48 A;  1S4N A;  1G3L A;  2Z87 A;  2Y4K A;  1TW5 A;  4ZDQ A;  1H3M A;  2AH9 A;  1G93 A;  4Y64 A;  3ZLL A;  1G23 A;  5DDV A;  1NMM B;  4NAN A;  2AM3 A;  4B42 A;  3T7O A;  2Y4M A;  2VFZ A;  4EEM A;  1ZJP A;  1NKH B;  1PZY B;  1WT1 A;  3RSB A;  3V0L A;  1H5R A;  5L6S A;  5CQP A;  3USQ A;  1G0R A;  3FWW A;  1H7Q A;  3KIA A;  4D48 A;  2QH5 A;  1VM8 A;  2WEE A;  1GX4 A;  2P6W A;  1R7U A;  1VGW A;  2V0I A;  1EYR A;  1HM9 A;  4Y6U A;  1IIM A;  3I0K A;  1H5R B;  3Q80 A;  4UEG A;  3OH1 A;  1V83 A;  5CQL X;  2I5E A;  3R3I A;  5FTS A;  4B2W A;  1H5S C;  1H5S A;  3JTJ A;  1H7G A;  5C4D A;  1FR8 A;  3OH4 A;  3DJ4 A;  3CGX A;  2VS3 A;  2RJ0 A;  5EJZ A;  5DDT A;  3Q4S A;  4NAL A;  5IDS A;  5C1G A;  3U2T A;  2Q4J A;  2VXL A;  5EJ1 A;  3GUE A;  3OGZ A;  2E8B A;  4G3Q A;  4Y63 A;  1GQ9 A;  1ZIZ A;  1H5S B;  2OEG A;  2VS5 A;  2RJ4 A;  4Y7T A;  1HV9 A;  1EZI A;  2YQH A;  4EE4 A;  1YP3 A;  2Y6P A;  1YP4 A;  4FQW A;  4HCQ A;  5FUH A;  4LW6 A;  2FYC B;  1G1L A;  1XHB A;  1MP3 A;  4EEG A;  4HO5 A;  4EE5 A;  5C36 A;  2V0J A;  3IOH A;  2XWN A;  1WT3 A;  3F1Y A;  2DPW A;  1WVC A;  1O7O A;  4MYB A;  2D7I A;  3QVB A;  4ECM A;  3TQD A;  4HO2 A;  4HO8 A;  3U2W A;  1R7Y A;  5C8R A;  2Z86 A;  4LW3 A;  4FCE A;  2FFV A;  2AM5 A;  5C3B A;  5FV9 A;  3FOQ A;  4KNR A;  3E25 A;  1YRO B;  4KRV A;  3V0N A;  4Y7G A;  2AM4 A;  3SXG A;  1ZDF A;  3R2W A;  2VSI A;  4MND A;  2VD4 A;  2APC A;  5C4F A;  1VGU A;  4FRD A;  1INI A;  4B4G A;  2Y4J A;  1LZ0 A;  2RJ9 A;  2XWM A;  2RJ6 A;  4M4K A;  4M2B A;  1GX0 A;  3V8Z A;  4D0T A;  4FRH A;  1HJJ A;  1R82 A;  1LZJ A;  3E26 A;  1I52 A;  5C3A A;  4YS8 A;  4JD0 A;  1MC3 A;  2ZU7 A;  2OI5 A;  2YQJ A;  2X5S A;  1R7V A;  1GWV A;  3BCV A;  2AEC A;  2FYD B;  4HG6 A;  3CKJ A;  4B4B A;  3K8D A;  3SXC A;  3RMW A;  3SXE A;  1JVG A;  1VPA A;  2QKX A;  3IOJ A;  4P00 A;  2RIZ A;  2YQS A;  1ZCY A;  1HJL A;  2ZU8 A;  1ZI1 A;  2YC3 A;  1QWJ A;  2E3D A;  5AJO A;  2XME A;  2RIX A;  4CJ8 A;  5CQN X;  4DEC A;  1H4C A;  2O1F A;  3V0P A;  1S4P A;  1LVW A;  5C4C A;  3T7N A;  1V82 A;  3PKQ A;  1VH1 A;  1GWW A;  2Y4L A;  2XMH A;  1ZI4 A;  3JUK A;  3I0D A;  4P02 A;  5CMI A;  2NXV A;  4KPX A;  5CQM X;  5I1F A;  1NQI B;  2GGO A;  2O1G A;  5FU0 A;  3CKN A;  3OKR A;  5CMJ A;  4FRB A;  1R81 A;  5C1H A;  2AGD A;  2P73 A;  2FYA A;  1NF5 B;  1QG8 A;  2OI7 A;  1ON8 A;  1H7L A;  2YC5 A;  3USR A;  1V84 A;  1LL0 A;  4Y7U A;  2OI6 A;  2A8U A;  1VZX A;  4EEO A;  5CMH A;  1KWS A;  1OQM B;  2AE7 A;  5C38 A;  4IRP A;  1ZI3 A;  2BO8 A;  3I0C A;  4G87 A;  1VGT A;  4D0Z A;  1MP5 A;  1PZT A;  3HL3 A;  1R7T A;  1TW1 A;  3I0E A;  4EEA A;  4Y62 A;  2YES A;  3RMV A;  1VZU A;  2AES A;  4KC2 A;  4CJB A;  3T7M A;  3PNN A;  1R80 A;  5J49 A;  3D5N A;  4B3U A;  4Y7F A;  2WAW A;  1JVD A;  1OMX A;  3SXB A;  4ASY A;  4AC3 A;  2WGZ A;  1ZI5 A;  5C47 A;  2I5K A;  4J18 A;  3CKQ A;  1FOA A;  4KNX A;  3D8V A;  2VXM A;  2PA4 A;  3V8Y A;  1G9R A;  2W0W A;  4FRL A;  2CU2 A;  2X60 A;  3OAM A;  4HO6 A;  3PKP A;  1O0R A;  3DK5 A;  1LZ7 A;  1ZHJ A;  5C4E A;  5C1L A;  3K8E A;  4FCU A;  4FRP A;  3IOI A;  4G3P A;  2QGI A;  4D11 C;  4BQH A;  4D11 A;  1FRW A;  1H7T A;  4IRQ A;  5FU8 A;  4HO3 A;  4B2X A;  2RJ7 A;  2BO6 A;  1ON6 A;  2JCO A;  1O7Q A;  1VH3 A;  2RIT A;  1FGG A;  1GA8 A;  2PGY A;  3CKO A;  1G95 A;  1H5T A;  2JCL A;  3LW6 A;  1FXO A;  3ZGF A;  5L6V A;  1VIC A;  2P72 A;  1JV1 A;  5IFY A;  4XWI A;  1NWG B;  5IDT A;  2X65 A;  5BXC A;  2RIY A;  4AYJ A;  3OH3 A;  4CVH A;  4M2A A;  2WVK A;  4ARW A;  3SXA A;  5C49 A;  4EVW A;  1H7E A; 
#chains in the Genus database with same CATH topology
 3V91 A;  1H5T B;  1WT2 A;  2BO7 A;  4FRO A;  1ZJ0 A;  1O23 B;  3D98 A;  1G8O A;  4FRQ A;  3F1C A;  4R7P A;  1NHE B;  4NAK A;  1H4D A;  1SS9 A;  5CMG X;  2PGV A;  3TZT A;  1ZJ2 A;  5FTV A;  3V0O A;  2JCJ A;  3JUJ A;  1FGX A;  5C4B A;  1MP4 A;  4GBP A;  4Y9X A;  2RJ5 A;  3BRK X;  3SX5 A;  4E1K A;  1INJ A;  2I7B A;  4HOC A;  1XZ6 A;  1HM0 A;  2PX7 A;  1H5S D;  1W55 A;  3SPT A;  1JYK A;  1FXJ A;  2WVM A;  4DDZ A;  4NAI A;  4Y7V A;  1LL3 A;  2JCK A;  2FFU A;  4ASJ A;  5C3D A;  3I0H A;  4JIS A;  2RJ1 A;  1ZJ3 A;  5JQQ A;  1Z90 A;  1FG5 N;  2V0K A;  4KT7 A;  3ZF8 A;  3U2X A;  2YCM A;  4FIY A;  4KQL A;  1R7X A;  1GQC A;  1FO8 A;  2W0V A;  1S4O A;  2XWL A;  1WT0 A;  4KPZ A;  4KC1 A;  3I0G A;  3U0Y A;  4O6N A;  2ICX A;  3EE5 A;  2WE9 A;  3U0X A;  2X5Z A;  1ZJO A;  2ICY A;  3V0M A;  2D0J A;  3POL A;  3U2U A;  3I0L A;  3NGW A;  4G3S A;  2V0L A;  2O1H A;  4B5B A;  4FRE A;  2BO4 A;  1QGS A;  4FRM A;  5HS2 A;  3OC9 A;  2VSH A;  2FYB A;  1WSZ A;  5CMF X;  4K6R A;  4M28 A;  1FWY A;  2OEF A;  1FR9 A;  2V0H A;  4KXO A;  5FYE A;  3I0F A;  4AYL A;  3SX7 A;  4HO9 A;  4FIX A;  1FZW A;  5AJN A;  1ZDG A;  1FO9 A;  4HO0 A;  2RJ8 A;  4B4M A;  2UX8 A;  1JYL A;  1IIN A;  2YQC A;  1JV3 A;  4C2S A;  1ZCU A;  1H4E A;  2MZB A;  3ST8 A;  2D7R A;  1LL2 A;  4L41 C;  3I0I X;  4KC4 A;  1ZCV A;  1YP2 A;  3O3P A;  2WVL A;  4EE3 A;  4Y6N A;  3V0Q A;  1G2V A;  5CQO A;  3ZLK A;  1W77 A;  3V90 A;  4HO4 A;  5EIY A;  1QGQ A;  1OMZ A;  4CJC A;  1TZF A;  2GGQ A;  3OH2 A;  1HM8 A;  3Q7U A;  1W57 A;  4DE7 A;  1TVY A;  1ZCT A;  1G97 A;  1VZT A;  2Y7A A;  3SX8 A;  3SXD A;  2FY7 A;  2VS4 A;  2ZU9 A;  1ZJ1 A;  2J0B A;  4AAW A;  1H7F A;  1H7H A;  4FRA A;  3OH0 A;  1LZI A;  1VGZ A;  2A8W A;  3CU0 A;  3DUV A;  3ZGG A;  3I0J A;  3U2V A;  5AJP A;  4BMA A;  1K4V A;  3N9W A;  1E5K A;  3CKV A;  3SX3 A;  5C48 A;  1S4N A;  1G3L A;  2Z87 A;  2Y4K A;  1TW5 A;  4ZDQ A;  1H3M A;  2AH9 A;  1G93 A;  4Y64 A;  3ZLL A;  1G23 A;  5DDV A;  1NMM B;  4NAN A;  2AM3 A;  4B42 A;  3T7O A;  2Y4M A;  2VFZ A;  4EEM A;  1ZJP A;  1NKH B;  1PZY B;  1WT1 A;  3RSB A;  3V0L A;  1H5R A;  5L6S A;  5CQP A;  3USQ A;  1G0R A;  3FWW A;  1H7Q A;  3KIA A;  4D48 A;  2QH5 A;  1VM8 A;  2WEE A;  1GX4 A;  2P6W A;  1R7U A;  1VGW A;  2V0I A;  1EYR A;  1HM9 A;  4Y6U A;  1IIM A;  3I0K A;  1H5R B;  3Q80 A;  4UEG A;  3OH1 A;  1V83 A;  5CQL X;  2I5E A;  3R3I A;  5FTS A;  4B2W A;  1H5S C;  1H5S A;  3JTJ A;  1H7G A;  4MIX A;  5C4D A;  1FR8 A;  3OH4 A;  3DJ4 A;  3CGX A;  2VS3 A;  2RJ0 A;  5EJZ A;  5DDT A;  3Q4S A;  4NAL A;  5IDS A;  5C1G A;  3U2T A;  2Q4J A;  2VXL A;  5EJ1 A;  3GUE A;  3OGZ A;  2E8B A;  4G3Q A;  4Y63 A;  1GQ9 A;  1ZIZ A;  1H5S B;  2OEG A;  2VS5 A;  4O6M A;  2RJ4 A;  4Y7T A;  1HV9 A;  1EZI A;  2YQH A;  4EE4 A;  1YP3 A;  2Y6P A;  1YP4 A;  4FQW A;  4HCQ A;  5FUH A;  4LW6 A;  2FYC B;  1G1L A;  1XHB A;  1MP3 A;  4EEG A;  4HO5 A;  4EE5 A;  5C36 A;  2V0J A;  3IOH A;  2XWN A;  1WT3 A;  3F1Y A;  2DPW A;  1WVC A;  1O7O A;  4MYB A;  2D7I A;  3QVB A;  4ECM A;  3TQD A;  4HO2 A;  4HO8 A;  3U2W A;  1R7Y A;  5C8R A;  2Z86 A;  4LW3 A;  4FCE A;  2FFV A;  2AM5 A;  5C3B A;  5FV9 A;  3FOQ A;  4KNR A;  3E25 A;  1YRO B;  4KRV A;  3V0N A;  4Y7G A;  2AM4 A;  3SXG A;  1ZDF A;  3R2W A;  2VSI A;  4MND A;  2VD4 A;  2APC A;  5C4F A;  1VGU A;  4FRD A;  1INI A;  4B4G A;  2Y4J A;  1LZ0 A;  2RJ9 A;  2XWM A;  2RJ6 A;  4M4K A;  4M2B A;  1GX0 A;  3V8Z A;  4D0T A;  4FRH A;  1HJJ A;  1R82 A;  1LZJ A;  3E26 A;  1I52 A;  5C3A A;  4YS8 A;  4JD0 A;  1MC3 A;  2ZU7 A;  2OI5 A;  2YQJ A;  2X5S A;  1R7V A;  1GWV A;  3BCV A;  2AEC A;  2FYD B;  4HG6 A;  3CKJ A;  4B4B A;  3K8D A;  3SXC A;  3RMW A;  3SXE A;  1JVG A;  1VPA A;  2QKX A;  3IOJ A;  4P00 A;  2RIZ A;  2YQS A;  1ZCY A;  1HJL A;  2ZU8 A;  1ZI1 A;  2YC3 A;  1QWJ A;  2E3D A;  5AJO A;  2XME A;  2RIX A;  4CJ8 A;  5CQN X;  4DEC A;  1H4C A;  2O1F A;  3V0P A;  1S4P A;  1LVW A;  5C4C A;  3T7N A;  1V82 A;  3PKQ A;  1VH1 A;  1GWW A;  2Y4L A;  2XMH A;  1ZI4 A;  3JUK A;  3I0D A;  4P02 A;  5CMI A;  2NXV A;  4KPX A;  5CQM X;  5I1F A;  1NQI B;  5D91 A;  2GGO A;  2O1G A;  5FU0 A;  3CKN A;  3OKR A;  5CMJ A;  4FRB A;  1R81 A;  5C1H A;  2AGD A;  2P73 A;  2FYA A;  1NF5 B;  1QG8 A;  2OI7 A;  1ON8 A;  1H7L A;  2YC5 A;  3USR A;  1V84 A;  1LL0 A;  4Y7U A;  2OI6 A;  2A8U A;  1VZX A;  4EEO A;  5CMH A;  1KWS A;  1OQM B;  2AE7 A;  5C38 A;  2VK9 A;  4IRP A;  1ZI3 A;  2BO8 A;  3I0C A;  4G87 A;  1VGT A;  4D0Z A;  1MP5 A;  1PZT A;  4Q7C A;  3HL3 A;  1R7T A;  1TW1 A;  3I0E A;  4EEA A;  4Y62 A;  2YES A;  3RMV A;  1VZU A;  2AES A;  4KC2 A;  4CJB A;  3T7M A;  3PNN A;  1R80 A;  5J49 A;  3D5N A;  4B3U A;  4Y7F A;  2WAW A;  1JVD A;  1OMX A;  3SXB A;  5D92 A;  4ASY A;  4AC3 A;  2WGZ A;  1ZI5 A;  5C47 A;  2I5K A;  4J18 A;  3CKQ A;  1FOA A;  4KNX A;  3D8V A;  2VXM A;  2PA4 A;  3V8Y A;  1G9R A;  2W0W A;  4FRL A;  2CU2 A;  2X60 A;  3OAM A;  4HO6 A;  3PKP A;  1O0R A;  3DK5 A;  1LZ7 A;  1ZHJ A;  5C4E A;  5C1L A;  3K8E A;  4FCU A;  4FRP A;  3IOI A;  4G3P A;  2QGI A;  4D11 C;  2C0N A;  4BQH A;  1FRW A;  4D11 A;  1H7T A;  4IRQ A;  5FU8 A;  4HO3 A;  4B2X A;  2RJ7 A;  2BO6 A;  2J0A A;  1ON6 A;  2JCO A;  1O7Q A;  1VH3 A;  2RIT A;  1FGG A;  1GA8 A;  2PGY A;  3CKO A;  1G95 A;  1H5T A;  2JCL A;  3LW6 A;  1FXO A;  3ZGF A;  5L6V A;  1VIC A;  2P72 A;  1JV1 A;  5IFY A;  4XWI A;  1NWG B;  5IDT A;  2X65 A;  5BXC A;  2RIY A;  4AYJ A;  3OH3 A;  4CVH A;  4M2A A;  2WVK A;  4ARW A;  3SXA A;  5C49 A;  4EVW A;  1H7E A; 
#chains in the Genus database with same CATH homology
 3V91 A;  1H5T B;  1WT2 A;  2BO7 A;  4FRO A;  1ZJ0 A;  1O23 B;  3D98 A;  1G8O A;  4FRQ A;  3F1C A;  4R7P A;  1NHE B;  4NAK A;  1H4D A;  1SS9 A;  5CMG X;  2PGV A;  3TZT A;  1ZJ2 A;  5FTV A;  3V0O A;  2JCJ A;  3JUJ A;  1FGX A;  5C4B A;  1MP4 A;  4GBP A;  4Y9X A;  2RJ5 A;  3BRK X;  3SX5 A;  4E1K A;  1INJ A;  2I7B A;  4HOC A;  1XZ6 A;  1HM0 A;  2PX7 A;  1H5S D;  1W55 A;  3SPT A;  1JYK A;  1FXJ A;  2WVM A;  4DDZ A;  4NAI A;  4Y7V A;  1LL3 A;  2JCK A;  2FFU A;  4ASJ A;  5C3D A;  3I0H A;  4JIS A;  2RJ1 A;  1ZJ3 A;  5JQQ A;  1Z90 A;  1FG5 N;  2V0K A;  4KT7 A;  3ZF8 A;  3U2X A;  2YCM A;  4FIY A;  4KQL A;  1R7X A;  1GQC A;  1FO8 A;  2W0V A;  1S4O A;  2XWL A;  1WT0 A;  4KPZ A;  4KC1 A;  3I0G A;  3U0Y A;  4O6N A;  2ICX A;  3EE5 A;  2WE9 A;  3U0X A;  2X5Z A;  1ZJO A;  2ICY A;  3V0M A;  2D0J A;  3POL A;  3U2U A;  3I0L A;  3NGW A;  4G3S A;  2V0L A;  2O1H A;  4B5B A;  4FRE A;  2BO4 A;  1QGS A;  4FRM A;  5HS2 A;  3OC9 A;  2VSH A;  2FYB A;  1WSZ A;  5CMF X;  4K6R A;  4M28 A;  1FWY A;  2OEF A;  1FR9 A;  2V0H A;  4KXO A;  5FYE A;  3I0F A;  4AYL A;  3SX7 A;  4HO9 A;  4FIX A;  1FZW A;  5AJN A;  1ZDG A;  1FO9 A;  4HO0 A;  2RJ8 A;  4B4M A;  2UX8 A;  1JYL A;  1IIN A;  2YQC A;  1JV3 A;  4C2S A;  1ZCU A;  1H4E A;  2MZB A;  3ST8 A;  2D7R A;  1LL2 A;  4L41 C;  3I0I X;  4KC4 A;  1ZCV A;  1YP2 A;  3O3P A;  2WVL A;  4EE3 A;  4Y6N A;  3V0Q A;  1G2V A;  5CQO A;  3ZLK A;  1W77 A;  3V90 A;  4HO4 A;  5EIY A;  1QGQ A;  1OMZ A;  4CJC A;  1TZF A;  2GGQ A;  3OH2 A;  1HM8 A;  3Q7U A;  1W57 A;  4DE7 A;  1TVY A;  1ZCT A;  1G97 A;  1VZT A;  2Y7A A;  3SX8 A;  3SXD A;  2FY7 A;  2VS4 A;  2ZU9 A;  1ZJ1 A;  2J0B A;  4AAW A;  1H7F A;  1H7H A;  4FRA A;  3OH0 A;  1LZI A;  1VGZ A;  2A8W A;  3CU0 A;  3DUV A;  3ZGG A;  3I0J A;  3U2V A;  5AJP A;  4BMA A;  1K4V A;  3N9W A;  1E5K A;  3CKV A;  3SX3 A;  5C48 A;  1S4N A;  1G3L A;  2Z87 A;  2Y4K A;  1TW5 A;  4ZDQ A;  1H3M A;  2AH9 A;  1G93 A;  4Y64 A;  3ZLL A;  1G23 A;  5DDV A;  1NMM B;  4NAN A;  2AM3 A;  4B42 A;  3T7O A;  2Y4M A;  2VFZ A;  4EEM A;  1ZJP A;  1NKH B;  1PZY B;  1WT1 A;  3RSB A;  3V0L A;  1H5R A;  5L6S A;  5CQP A;  3USQ A;  1G0R A;  3FWW A;  1H7Q A;  3KIA A;  4D48 A;  2QH5 A;  1VM8 A;  2WEE A;  1GX4 A;  2P6W A;  1R7U A;  1VGW A;  2V0I A;  1EYR A;  1HM9 A;  4Y6U A;  1IIM A;  3I0K A;  1H5R B;  3Q80 A;  4UEG A;  3OH1 A;  1V83 A;  5CQL X;  2I5E A;  3R3I A;  5FTS A;  4B2W A;  1H5S C;  1H5S A;  3JTJ A;  1H7G A;  4MIX A;  5C4D A;  1FR8 A;  3OH4 A;  3DJ4 A;  3CGX A;  2VS3 A;  2RJ0 A;  5EJZ A;  5DDT A;  3Q4S A;  4NAL A;  5IDS A;  5C1G A;  3U2T A;  2Q4J A;  2VXL A;  5EJ1 A;  3GUE A;  3OGZ A;  2E8B A;  4G3Q A;  4Y63 A;  1GQ9 A;  1ZIZ A;  1H5S B;  2OEG A;  2VS5 A;  4O6M A;  2RJ4 A;  4Y7T A;  1HV9 A;  1EZI A;  2YQH A;  4EE4 A;  1YP3 A;  2Y6P A;  1YP4 A;  4FQW A;  4HCQ A;  5FUH A;  4LW6 A;  2FYC B;  1G1L A;  1XHB A;  1MP3 A;  4EEG A;  4HO5 A;  4EE5 A;  5C36 A;  2V0J A;  3IOH A;  2XWN A;  1WT3 A;  3F1Y A;  2DPW A;  1WVC A;  1O7O A;  4MYB A;  2D7I A;  3QVB A;  4ECM A;  3TQD A;  4HO2 A;  4HO8 A;  3U2W A;  1R7Y A;  5C8R A;  2Z86 A;  4LW3 A;  4FCE A;  2FFV A;  2AM5 A;  5C3B A;  5FV9 A;  3FOQ A;  4KNR A;  3E25 A;  1YRO B;  4KRV A;  3V0N A;  4Y7G A;  2AM4 A;  3SXG A;  1ZDF A;  3R2W A;  2VSI A;  4MND A;  2VD4 A;  2APC A;  5C4F A;  1VGU A;  4FRD A;  1INI A;  4B4G A;  2Y4J A;  1LZ0 A;  2RJ9 A;  2XWM A;  2RJ6 A;  4M4K A;  4M2B A;  1GX0 A;  3V8Z A;  4D0T A;  4FRH A;  1HJJ A;  1R82 A;  1LZJ A;  3E26 A;  1I52 A;  5C3A A;  4YS8 A;  4JD0 A;  1MC3 A;  2ZU7 A;  2OI5 A;  2YQJ A;  2X5S A;  1R7V A;  1GWV A;  3BCV A;  2AEC A;  2FYD B;  4HG6 A;  3CKJ A;  4B4B A;  3K8D A;  3SXC A;  3RMW A;  3SXE A;  1JVG A;  1VPA A;  2QKX A;  3IOJ A;  4P00 A;  2RIZ A;  2YQS A;  1ZCY A;  1HJL A;  2ZU8 A;  1ZI1 A;  2YC3 A;  1QWJ A;  2E3D A;  5AJO A;  2XME A;  2RIX A;  4CJ8 A;  5CQN X;  4DEC A;  1H4C A;  2O1F A;  3V0P A;  1S4P A;  1LVW A;  5C4C A;  3T7N A;  1V82 A;  3PKQ A;  1VH1 A;  1GWW A;  2Y4L A;  2XMH A;  1ZI4 A;  3JUK A;  3I0D A;  4P02 A;  5CMI A;  2NXV A;  4KPX A;  5CQM X;  5I1F A;  1NQI B;  5D91 A;  2GGO A;  2O1G A;  5FU0 A;  3CKN A;  3OKR A;  5CMJ A;  4FRB A;  1R81 A;  5C1H A;  2AGD A;  2P73 A;  2FYA A;  1NF5 B;  1QG8 A;  2OI7 A;  1ON8 A;  1H7L A;  2YC5 A;  3USR A;  1V84 A;  1LL0 A;  4Y7U A;  2OI6 A;  2A8U A;  1VZX A;  4EEO A;  5CMH A;  1KWS A;  1OQM B;  2AE7 A;  5C38 A;  2VK9 A;  4IRP A;  1ZI3 A;  2BO8 A;  3I0C A;  4G87 A;  1VGT A;  4D0Z A;  1MP5 A;  1PZT A;  4Q7C A;  3HL3 A;  1R7T A;  1TW1 A;  3I0E A;  4EEA A;  4Y62 A;  2YES A;  3RMV A;  1VZU A;  2AES A;  4KC2 A;  4CJB A;  3T7M A;  3PNN A;  1R80 A;  5J49 A;  3D5N A;  4B3U A;  4Y7F A;  2WAW A;  1JVD A;  1OMX A;  3SXB A;  5D92 A;  4ASY A;  4AC3 A;  2WGZ A;  1ZI5 A;  5C47 A;  2I5K A;  4J18 A;  3CKQ A;  1FOA A;  4KNX A;  3D8V A;  2VXM A;  2PA4 A;  3V8Y A;  1G9R A;  2W0W A;  4FRL A;  2CU2 A;  2X60 A;  3OAM A;  4HO6 A;  3PKP A;  1O0R A;  3DK5 A;  1LZ7 A;  1ZHJ A;  5C4E A;  5C1L A;  3K8E A;  4FCU A;  4FRP A;  3IOI A;  4G3P A;  2QGI A;  4D11 C;  2C0N A;  4BQH A;  1FRW A;  4D11 A;  1H7T A;  4IRQ A;  5FU8 A;  4HO3 A;  4B2X A;  2RJ7 A;  2BO6 A;  2J0A A;  1ON6 A;  2JCO A;  1O7Q A;  1VH3 A;  2RIT A;  1FGG A;  1GA8 A;  2PGY A;  3CKO A;  1G95 A;  1H5T A;  2JCL A;  3LW6 A;  1FXO A;  3ZGF A;  5L6V A;  1VIC A;  2P72 A;  1JV1 A;  5IFY A;  4XWI A;  1NWG B;  5IDT A;  2X65 A;  5BXC A;  2RIY A;  4AYJ A;  3OH3 A;  4CVH A;  4M2A A;  2WVK A;  4ARW A;  3SXA A;  5C49 A;  4EVW A;  1H7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...