4EE3A

Crystal structure of human m340h-beta-1,4-galactosyltransferase-1 (m340h-b4gal-t1) in complex with pentasaccharide
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
273
structure length
273
Chain Sequence
SLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGTTRHIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Beta-1,4-galactosyltransferase 1
publication title Binding of N-acetylglucosamine (GlcNAc) beta 1-6-branched oligosaccharide acceptors to beta 4-galactosyltransferase I reveals a new ligand binding mode.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 273
sequence length 273
chains with identical sequence B, C
ec nomenclature ec 2.4.1.22: Lactose synthase.
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02709 Glyco_transf_7C N-terminal domain of galactosyltransferase
A PF13733 Glyco_transf_7N N-terminal region of glycosyl transferase group 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4ee3A00
4ASJA 1LZ0A 1QGSA 1G97A 4FRLA 3IOHA 2V0HA 1ZJ3A 2E3DA 4FRMA 1INIA 3RSBA 1H7FA 4FROA 3I0JA 4B5BA 4CVHA 3V0OA 2WAWA 1QG8A 4Y6UA 2GGOA 5EJZA 5CMJA 2P73A 5C36A 1H5RA 1NKHB 3ZLKA 1G1LA 1XHBA 3K8DA 3E26A 1FGXA 2PGVA 2FFVA 1H5TB 1S4PA 5FTVA 3BCVA 2FFUA 1VPAA 1FWYA 3KIAA 2X5SA 4B4BA 2JCOA 4NALA 1H4CA 3Q7UA 2O1GA 1E5KA 4JISA 5FTSA 3SX8A 1H5SB 1MP4A 2VS5A 4FREA 1TW5A 1O0RA 5C1HA 3I0EA 4DECA 1H4EA 4KNXA 1HM0A 1G93A 1Z90A 4EE5A 2I5EA 3TQDA 1ZI3A 2P6WA 4KXOA 5L6SA 1H3MA 2D7RA 4BQHA 2XWMA 1LZIA 1ZI4A 2ZU7A 1H7EA 4MYBA 5AJPA 1MP3A 5C4BA 1IINA 1TW1A 4EEAA 5IFYA 1H7QA 1JYKA 2RITA 2QGIA 1FXJA 3USQA 1VGWA 5CQLX 3EE5A 1VGTA 2D7IA 2XWNA 1H5TA 1FZWA 1ZJOA 2ZU9A 1S4NA 2BO8A 3V0QA 2XWLA 1NQIB 5JQQA 2OI6A 4Y9XA 5IDTA 2CU2A 4L41C 2RJ4A 1VICA 1YROB 4EE4A 3F1CA 3R2WA 1GA8A 3Q4SA 4Y63A 1VM8A 2YQHA 2PGYA 4FRQA 5J49A 2V0IA 3ZGFA 1FGGA 4G3QA 1G9RA 1EYRA 3LW6A 1XZ6A 4G3SA 4M2AA 2A8UA 4D11C 4NAIA 1HJLA 1ZCUA 1O7QA 1WSZA 2RIYA 3U2TA 1PZYB 4CJBA 2Y4JA 4UEGA 3T7OA 2FYDB 4EEGA 2Y6PA 3CU0A 4LW3A 2VS4A 2AESA 3ZGGA 3OH1A 4DE7A 5FU0A 1ZDGA 1ZJ0A 3OH3A 2QH5A 2RJ8A 1G8OA 1ZCVA 1ZCTA 1W57A 1YP2A 2OEFA 1K4VA 1NMMB 3OKRA 4C2SA 3I0DA 5IDSA 2JCLA 1WT1A 4B2WA 1YP3A 2VD4A 3D98A 4EE3A 2PX7A 2VXLA 3V8ZA 1I52A 3R3IA 3OAMA 4AC3A 4ZDQA 1ZIZA 2XMEA 4M2BA 3I0LA 4KC2A 3JUKA 2YQJA 3I0IX 1LVWA 5AJNA 3U2XA 2WE9A 4FRHA 1ZDFA 1G95A 1H7GA 4HOCA 4BMAA 5C4CA 2BO4A 2A8WA 2OI7A 3I0GA 5C1GA 1NF5B 1LL3A 1PZTA 2FYCB 2AECA 1NWGB 2JCKA 4P00A 2ZU8A 1ON8A 3F1YA 5C4FA 1H4DA 3E25A 5C38A 4YS8A 1VH3A 2I5KA 2UX8A 3I0HA 4FQWA 5C48A 2Q4JA 1INJA 1VZXA 2D0JA 4P02A 2VS3A 5CMFX 1WT0A 2QKXA 2RIZA 3T7MA 3GUEA 3T7NA 1TVYA 5C8RA 5CMHA 1WT2A 3SX3A 1S4OA 4D11A 2VSHA 1VZTA 3FOQA 2Z86A 3QVBA 4HO8A 5EIYA 1YP4A 3IOIA 4K6RA 2VFZA 2RJ1A 4AYLA 4Y7GA 2GGQA 2FYAA 2YQSA 4KC1A 4HO3A 1G2VA 1R80A 1R7YA 2APCA 5DDTA 3SXBA 3ZLLA 1H5SA 1R7UA 1FR9A 1W77A 1VZUA 4KPXA 4ARWA 5CQMX 4CJ8A 1G23A 2O1HA 4CJCA 1R81A 1V84A 3SXGA 5C4EA 3V0LA 4Y64A 2BO6A 5AJOA 4B4MA 3HL3A 1TZFA 5DDVA 4B4GA 2XMHA 2MZBA 4B2XA 4M28A 1R7VA 4ASYA 1GX4A 4NAKA 2V0KA 4GBPA 1JV3A 3U0XA 3O3PA 1H5RB 1ZI1A 4IRPA 1JV1A 1ZJPA 3POLA 3DK5A 1KWSA 1IIMA 3PNNA 4M4KA 3ST8A 2V0LA 2WVMA 5FU8A 3U2VA 3V91A 1GWVA 2RJ5A 1HV9A 3CKNA 5CQNX 3OC9A 2YC5A 1QWJA 1ZHJA 2Y4KA 3FWWA 1R7TA 3Q80A 1FXOA 2BO7A 4HO4A 3JUJA 1H7TA 5FV9A 2YCMA 3CGXA 2W0VA 5FYEA 2Y4MA 3OH2A 1ON6A 2ICXA 1GX0A 1V83A 4FCUA 2Z87A 1O23B 3TZTA 3V8YA 3SPTA 1LL0A 4EEMA 5CMIA 2WEEA 3PKPA 2P72A 2VSIA 4KPZA 4Y7VA 4Y7UA 2AM3A 1H7LA 1GQ9A 1MC3A 3U2WA 2YESA 4G87A 4KQLA 2RJ0A 4HO6A 3SXEA 4ECMA 1FR8A 1QGQA 3U2UA 1H5SD 3N9WA 4FRPA 1JVGA 3I0FA 4KC4A 4KRVA 1OQMB 4Y7TA 1EZIA 3D5NA 3D8VA 5L6VA 4HO0A 4R7PA 3SXDA 3OH4A 4AYJA 3RMVA 3SXAA 4Y7FA 4G3PA 3USRA 4B3UA 2X65A 2V0JA 1GQCA 4B42A 4FRBA 1FRWA 2X60A 3IOJA 1NHEB 1ZCYA 2NXVA 4AAWA 4JD0A 3CKVA 3K8EA 1G0RA 1O7OA 2DPWA 2VXMA 3CKOA 2RJ6A 4D0TA 3BRKX 3OH0A 2RJ9A 1LZJA 4Y62A 1WVCA 2RJ7A 1ZJ2A 4LW6A 3SX7A 1FO9A 1SS9A 5CMGX 3CKQA 3U0YA 1JYLA 4Y6NA 2AE7A 5CQOA 1HM9A 3SX5A 4FRDA 1MP5A 3V0PA 4J18A 4HO5A 3I0CA 4HCQA 2WVKA 1GWWA 2RIXA 5C3DA 1R7XA 4FRAA 2PA4A 2JCJA 2O1FA 2AM4A 4HG6A 1FG5N 3I0KA 4DDZA 3ZF8A 2X5ZA 4E1KA 4FCEA 1LZ7A 1VGUA 1W55A 3DJ4A 1R82A 3RMWA 2AM5A 5C1LA 5C3AA 2AGDA 5CQPA 3SXCA 4EVWA 1FO8A 3CKJA 3V90A 2ICYA 1LL2A 3NGWA 4HO9A 2W0WA 5C4DA 1H7HA 4NANA 4MNDA 1ZJ1A 4IRQA 2YQCA 3OGZA 1OMXA 1ZI5A 1VH1A 2WVLA 2Y7AA 4KNRA 3JTJA 5FUHA 4D48A 2FYBA 5C49A 4KT7A 1JVDA 5EJ1A 1G3LA 4D0ZA 2FY7A 1FOAA 1HJJA 4EEOA 2OEGA 2I7BA 1WT3A 2YC3A 5BXCA 3PKQA 3DUVA 3V0NA 4XWIA 1HM8A 5I1FA 2Y4LA 2WGZA 5HS2A 5C3BA 2AH9A 4HO2A 3V0MA 2OI5A 1OMZA 1V82A 5C47A 2E8BA 1H5SC 1VGZA
chains in the Genus database with same CATH superfamily
4ASJA 1LZ0A 1QGSA 1G97A 4FRLA 3IOHA 2V0HA 1ZJ3A 2E3DA 4FRMA 1INIA 3RSBA 1H7FA 4FROA 3I0JA 4B5BA 4CVHA 3V0OA 2WAWA 1QG8A 4Y6UA 2GGOA 5EJZA 5CMJA 2P73A 5C36A 1H5RA 1NKHB 3ZLKA 1G1LA 1XHBA 3K8DA 3E26A 1FGXA 2J0BA 2PGVA 2FFVA 1H5TB 1S4PA 5FTVA 3BCVA 2FFUA 1VPAA 1FWYA 3KIAA 2X5SA 4B4BA 2JCOA 4NALA 1H4CA 3Q7UA 2O1GA 1E5KA 4JISA 2C0NA 5FTSA 3SX8A 1H5SB 1MP4A 2VS5A 4FREA 1TW5A 1O0RA 5C1HA 3I0EA 4O6MA 4DECA 1H4EA 4KNXA 1HM0A 1G93A 1Z90A 4EE5A 2I5EA 3TQDA 1ZI3A 2P6WA 4KXOA 5L6SA 1H3MA 2D7RA 4BQHA 2XWMA 1LZIA 1ZI4A 2ZU7A 1H7EA 4MYBA 5AJPA 1MP3A 5C4BA 1IINA 1TW1A 4EEAA 5IFYA 1H7QA 1JYKA 2RITA 2QGIA 1FXJA 3USQA 1VGWA 5CQLX 3EE5A 1VGTA 2D7IA 2XWNA 1H5TA 1FZWA 1ZJOA 2ZU9A 1S4NA 2BO8A 3V0QA 2XWLA 1NQIB 5JQQA 2OI6A 4Y9XA 5IDTA 2CU2A 2J0AA 4L41C 2RJ4A 1VICA 1YROB 4EE4A 3F1CA 3R2WA 1GA8A 3Q4SA 4Y63A 1VM8A 2YQHA 2PGYA 4FRQA 5J49A 2V0IA 3ZGFA 1FGGA 4G3QA 1G9RA 1EYRA 3LW6A 1XZ6A 4G3SA 4M2AA 2A8UA 4D11C 4NAIA 1HJLA 1ZCUA 1O7QA 1WSZA 2RIYA 3U2TA 1PZYB 4CJBA 2Y4JA 4UEGA 3T7OA 2FYDB 4EEGA 2Y6PA 3CU0A 4LW3A 2VS4A 2AESA 3ZGGA 3OH1A 4DE7A 5FU0A 1ZDGA 1ZJ0A 3OH3A 2QH5A 2RJ8A 1G8OA 1ZCVA 1ZCTA 1W57A 1YP2A 2OEFA 1K4VA 1NMMB 3OKRA 4C2SA 3I0DA 5IDSA 2JCLA 1WT1A 4B2WA 1YP3A 2VD4A 3D98A 4EE3A 2PX7A 2VXLA 3V8ZA 1I52A 3R3IA 3OAMA 4AC3A 4ZDQA 1ZIZA 2XMEA 4M2BA 3I0LA 4KC2A 3JUKA 2YQJA 3I0IX 1LVWA 5AJNA 3U2XA 2WE9A 4FRHA 1ZDFA 1G95A 1H7GA 4HOCA 4BMAA 5C4CA 2BO4A 2A8WA 2OI7A 3I0GA 5C1GA 1NF5B 1LL3A 1PZTA 2FYCB 2AECA 1NWGB 2JCKA 4P00A 2ZU8A 1ON8A 3F1YA 5C4FA 1H4DA 3E25A 5C38A 4YS8A 1VH3A 2I5KA 2UX8A 3I0HA 4FQWA 5C48A 2Q4JA 1INJA 1VZXA 2D0JA 4P02A 2VS3A 5CMFX 1WT0A 2QKXA 2RIZA 3T7MA 3GUEA 3T7NA 1TVYA 5C8RA 5CMHA 1WT2A 3SX3A 1S4OA 4D11A 2VSHA 1VZTA 3FOQA 2Z86A 3QVBA 4HO8A 5EIYA 1YP4A 3IOIA 4K6RA 2VFZA 2RJ1A 4AYLA 4Y7GA 2GGQA 2FYAA 2YQSA 4KC1A 4HO3A 1G2VA 1R80A 1R7YA 2APCA 5D92A 5DDTA 3SXBA 3ZLLA 1H5SA 1R7UA 1FR9A 1W77A 1VZUA 4KPXA 4ARWA 5CQMX 4CJ8A 1G23A 2O1HA 4CJCA 1R81A 1V84A 3SXGA 5C4EA 3V0LA 4Y64A 2BO6A 5AJOA 4B4MA 3HL3A 1TZFA 5DDVA 4B4GA 2XMHA 2MZBA 4B2XA 4M28A 1R7VA 4ASYA 1GX4A 4NAKA 4FIXA 2V0KA 4GBPA 1JV3A 3U0XA 3O3PA 1H5RB 1ZI1A 4IRPA 1JV1A 1ZJPA 3POLA 3DK5A 1KWSA 1IIMA 3PNNA 4M4KA 3ST8A 2V0LA 2WVMA 5FU8A 3U2VA 3V91A 1GWVA 2RJ5A 1HV9A 3CKNA 5CQNX 3OC9A 4O6NA 2YC5A 1QWJA 1ZHJA 2Y4KA 3FWWA 1R7TA 3Q80A 1FXOA 2BO7A 4HO4A 3JUJA 1H7TA 4MIXA 2YCMA 5FV9A 3CGXA 2W0VA 5FYEA 2Y4MA 3OH2A 2VK9A 1ON6A 2ICXA 1GX0A 1V83A 4FCUA 2Z87A 1O23B 3TZTA 3V8YA 3SPTA 1LL0A 4EEMA 5CMIA 2WEEA 3PKPA 2P72A 2VSIA 4KPZA 4Y7VA 4Y7UA 2AM3A 1H7LA 1GQ9A 1MC3A 3U2WA 2YESA 4G87A 4KQLA 2RJ0A 4HO6A 3SXEA 4ECMA 1FR8A 1QGQA 3U2UA 1H5SD 3N9WA 4FRPA 1JVGA 3I0FA 4KC4A 4KRVA 1OQMB 4Y7TA 1EZIA 3D5NA 3D8VA 5L6VA 4FIYA 4HO0A 4Q7CA 4R7PA 3OH4A 3SXDA 4AYJA 3RMVA 3SXAA 4Y7FA 4G3PA 3USRA 4B3UA 2X65A 2V0JA 1GQCA 4B42A 4FRBA 1FRWA 2X60A 3IOJA 1NHEB 1ZCYA 2NXVA 4AAWA 4JD0A 3CKVA 3K8EA 1G0RA 1O7OA 2DPWA 2VXMA 3CKOA 2RJ6A 4D0TA 3BRKX 3OH0A 2RJ9A 1LZJA 4Y62A 1WVCA 2RJ7A 1ZJ2A 4LW6A 3SX7A 1FO9A 1SS9A 5CMGX 3CKQA 3U0YA 1JYLA 4Y6NA 2AE7A 5CQOA 1HM9A 3SX5A 4FRDA 1MP5A 3V0PA 4J18A 4HO5A 3I0CA 4HCQA 2WVKA 1GWWA 2RIXA 5C3DA 1R7XA 4FRAA 2PA4A 2JCJA 2O1FA 2AM4A 4HG6A 1FG5N 3I0KA 4DDZA 3ZF8A 2X5ZA 4E1KA 4FCEA 1LZ7A 1VGUA 1W55A 3DJ4A 1R82A 3RMWA 2AM5A 5C1LA 5C3AA 2AGDA 5CQPA 3SXCA 4EVWA 1FO8A 3CKJA 3V90A 2ICYA 1LL2A 3NGWA 4HO9A 2W0WA 5C4DA 1H7HA 4NANA 4MNDA 1ZJ1A 4IRQA 2YQCA 3OGZA 1OMXA 1ZI5A 1VH1A 2WVLA 2Y7AA 4KNRA 3JTJA 5FUHA 4D48A 2FYBA 5C49A 4KT7A 1JVDA 5EJ1A 1G3LA 4D0ZA 2FY7A 1FOAA 1HJJA 4EEOA 2OEGA 2I7BA 1WT3A 2YC3A 5BXCA 3PKQA 3DUVA 3V0NA 4XWIA 1HM8A 5I1FA 2Y4LA 2WGZA 5D91A 5HS2A 5C3BA 2AH9A 4HO2A 3V0MA 2OI5A 1OMZA 1V82A 5C47A 2E8BA 1H5SC 1VGZA
chains in the Genus database with same CATH topology
4ASJA 1LZ0A 1QGSA 1G97A 4FRLA 3IOHA 2V0HA 1ZJ3A 2E3DA 4FRMA 1INIA 3RSBA 1H7FA 4FROA 3I0JA 4B5BA 4CVHA 3V0OA 2WAWA 1QG8A 4Y6UA 2GGOA 5EJZA 5CMJA 2P73A 5C36A 1H5RA 1NKHB 3ZLKA 1G1LA 1XHBA 3K8DA 3E26A 1FGXA 2J0BA 2PGVA 2FFVA 1H5TB 1S4PA 5FTVA 3BCVA 2FFUA 1VPAA 1FWYA 3KIAA 2X5SA 4B4BA 2JCOA 4NALA 1H4CA 3Q7UA 2O1GA 1E5KA 4JISA 2C0NA 5FTSA 3SX8A 1H5SB 1MP4A 2VS5A 4FREA 1TW5A 1O0RA 5C1HA 3I0EA 4O6MA 4DECA 1H4EA 4KNXA 1HM0A 1G93A 1Z90A 4EE5A 2I5EA 3TQDA 1ZI3A 2P6WA 4KXOA 5L6SA 1H3MA 2D7RA 4BQHA 2XWMA 1LZIA 1ZI4A 2ZU7A 1H7EA 4MYBA 5AJPA 1MP3A 5C4BA 1IINA 1TW1A 4EEAA 5IFYA 1H7QA 1JYKA 2RITA 2QGIA 1FXJA 3USQA 1VGWA 5CQLX 3EE5A 1VGTA 2D7IA 2XWNA 1H5TA 1FZWA 1ZJOA 2ZU9A 1S4NA 2BO8A 3V0QA 2XWLA 1NQIB 5JQQA 2OI6A 4Y9XA 5IDTA 2CU2A 2J0AA 4L41C 2RJ4A 1VICA 1YROB 4EE4A 3F1CA 3R2WA 1GA8A 3Q4SA 4Y63A 1VM8A 2YQHA 2PGYA 4FRQA 5J49A 2V0IA 3ZGFA 1FGGA 4G3QA 1G9RA 1EYRA 3LW6A 1XZ6A 4G3SA 4M2AA 2A8UA 4D11C 4NAIA 1HJLA 1ZCUA 1O7QA 1WSZA 2RIYA 3U2TA 1PZYB 4CJBA 2Y4JA 4UEGA 3T7OA 2FYDB 4EEGA 2Y6PA 3CU0A 4LW3A 2VS4A 2AESA 3ZGGA 3OH1A 4DE7A 5FU0A 1ZDGA 1ZJ0A 3OH3A 2QH5A 2RJ8A 1G8OA 1ZCVA 1ZCTA 1W57A 1YP2A 2OEFA 1K4VA 1NMMB 3OKRA 4C2SA 3I0DA 5IDSA 2JCLA 1WT1A 4B2WA 1YP3A 2VD4A 3D98A 4EE3A 2PX7A 2VXLA 3V8ZA 1I52A 3R3IA 3OAMA 4AC3A 4ZDQA 1ZIZA 2XMEA 4M2BA 3I0LA 4KC2A 3JUKA 2YQJA 3I0IX 1LVWA 5AJNA 3U2XA 2WE9A 4FRHA 1ZDFA 1G95A 1H7GA 4HOCA 4BMAA 5C4CA 2BO4A 2A8WA 2OI7A 3I0GA 5C1GA 1NF5B 1LL3A 1PZTA 2FYCB 2AECA 1NWGB 2JCKA 4P00A 2ZU8A 1ON8A 3F1YA 5C4FA 1H4DA 3E25A 5C38A 4YS8A 1VH3A 2I5KA 2UX8A 3I0HA 4FQWA 5C48A 2Q4JA 1INJA 1VZXA 2D0JA 4P02A 2VS3A 5CMFX 1WT0A 2QKXA 2RIZA 3T7MA 3GUEA 3T7NA 1TVYA 5C8RA 5CMHA 1WT2A 3SX3A 1S4OA 4D11A 2VSHA 1VZTA 3FOQA 2Z86A 3QVBA 4HO8A 5EIYA 1YP4A 3IOIA 4K6RA 2VFZA 2RJ1A 4AYLA 4Y7GA 2GGQA 2FYAA 2YQSA 4KC1A 4HO3A 1G2VA 1R80A 1R7YA 2APCA 5D92A 5DDTA 3SXBA 3ZLLA 1H5SA 1R7UA 1FR9A 1W77A 1VZUA 4KPXA 4ARWA 5CQMX 4CJ8A 1G23A 2O1HA 4CJCA 1R81A 1V84A 3SXGA 5C4EA 3V0LA 4Y64A 2BO6A 5AJOA 4B4MA 3HL3A 1TZFA 5DDVA 4B4GA 2XMHA 2MZBA 4B2XA 4M28A 1R7VA 4ASYA 1GX4A 4NAKA 4FIXA 2V0KA 4GBPA 1JV3A 3U0XA 3O3PA 1H5RB 1ZI1A 4IRPA 1JV1A 1ZJPA 3POLA 3DK5A 1KWSA 1IIMA 3PNNA 4M4KA 3ST8A 2V0LA 2WVMA 5FU8A 3U2VA 3V91A 1GWVA 2RJ5A 1HV9A 3CKNA 5CQNX 3OC9A 4O6NA 2YC5A 1QWJA 1ZHJA 2Y4KA 3FWWA 1R7TA 3Q80A 1FXOA 2BO7A 4HO4A 3JUJA 1H7TA 4MIXA 2YCMA 5FV9A 3CGXA 2W0VA 5FYEA 2Y4MA 3OH2A 2VK9A 1ON6A 2ICXA 1GX0A 1V83A 4FCUA 2Z87A 1O23B 3TZTA 3V8YA 3SPTA 1LL0A 4EEMA 5CMIA 2WEEA 3PKPA 2P72A 2VSIA 4KPZA 4Y7VA 4Y7UA 2AM3A 1H7LA 1GQ9A 1MC3A 3U2WA 2YESA 4G87A 4KQLA 2RJ0A 4HO6A 3SXEA 4ECMA 1FR8A 1QGQA 3U2UA 1H5SD 3N9WA 4FRPA 1JVGA 3I0FA 4KC4A 4KRVA 1OQMB 4Y7TA 1EZIA 3D5NA 3D8VA 5L6VA 4FIYA 4HO0A 4Q7CA 4R7PA 3OH4A 3SXDA 4AYJA 3RMVA 3SXAA 4Y7FA 4G3PA 3USRA 4B3UA 2X65A 2V0JA 1GQCA 4B42A 4FRBA 1FRWA 2X60A 3IOJA 1NHEB 1ZCYA 2NXVA 4AAWA 4JD0A 3CKVA 3K8EA 1G0RA 1O7OA 2DPWA 2VXMA 3CKOA 2RJ6A 4D0TA 3BRKX 3OH0A 2RJ9A 1LZJA 4Y62A 1WVCA 2RJ7A 1ZJ2A 4LW6A 3SX7A 1FO9A 1SS9A 5CMGX 3CKQA 3U0YA 1JYLA 4Y6NA 2AE7A 5CQOA 1HM9A 3SX5A 4FRDA 1MP5A 3V0PA 4J18A 4HO5A 3I0CA 4HCQA 2WVKA 1GWWA 2RIXA 5C3DA 1R7XA 4FRAA 2PA4A 2JCJA 2O1FA 2AM4A 4HG6A 1FG5N 3I0KA 4DDZA 3ZF8A 2X5ZA 4E1KA 4FCEA 1LZ7A 1VGUA 1W55A 3DJ4A 1R82A 3RMWA 2AM5A 5C1LA 5C3AA 2AGDA 5CQPA 3SXCA 4EVWA 1FO8A 3CKJA 3V90A 2ICYA 1LL2A 3NGWA 4HO9A 2W0WA 5C4DA 1H7HA 4NANA 4MNDA 1ZJ1A 4IRQA 2YQCA 3OGZA 1OMXA 1ZI5A 1VH1A 2WVLA 2Y7AA 4KNRA 3JTJA 5FUHA 4D48A 2FYBA 5C49A 4KT7A 1JVDA 5EJ1A 1G3LA 4D0ZA 2FY7A 1FOAA 1HJJA 4EEOA 2OEGA 2I7BA 1WT3A 2YC3A 5BXCA 3PKQA 3DUVA 3V0NA 4XWIA 1HM8A 5I1FA 2Y4LA 2WGZA 5D91A 5HS2A 5C3BA 2AH9A 4HO2A 3V0MA 2OI5A 1OMZA 1V82A 5C47A 2E8BA 1H5SC 1VGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ASJ A;  1LZ0 A;  1QGS A;  1G97 A;  4FRL A;  3IOH A;  2V0H A;  1ZJ3 A;  2E3D A;  4FRM A;  1INI A;  3RSB A;  1H7F A;  4FRO A;  3I0J A;  4B5B A;  4CVH A;  3V0O A;  2WAW A;  1QG8 A;  4Y6U A;  2GGO A;  5EJZ A;  5CMJ A;  2P73 A;  5C36 A;  1H5R A;  1NKH B;  3ZLK A;  1G1L A;  1XHB A;  3K8D A;  3E26 A;  1FGX A;  2PGV A;  2FFV A;  1H5T B;  1S4P A;  5FTV A;  3BCV A;  2FFU A;  1VPA A;  1FWY A;  3KIA A;  2X5S A;  4B4B A;  2JCO A;  4NAL A;  1H4C A;  3Q7U A;  2O1G A;  1E5K A;  4JIS A;  5FTS A;  3SX8 A;  1H5S B;  1MP4 A;  2VS5 A;  4FRE A;  1TW5 A;  1O0R A;  5C1H A;  3I0E A;  4DEC A;  1H4E A;  4KNX A;  1HM0 A;  1G93 A;  1Z90 A;  4EE5 A;  2I5E A;  3TQD A;  1ZI3 A;  2P6W A;  4KXO A;  5L6S A;  1H3M A;  2D7R A;  4BQH A;  2XWM A;  1LZI A;  1ZI4 A;  2ZU7 A;  1H7E A;  4MYB A;  5AJP A;  1MP3 A;  5C4B A;  1IIN A;  1TW1 A;  4EEA A;  5IFY A;  1H7Q A;  1JYK A;  2RIT A;  2QGI A;  1FXJ A;  3USQ A;  1VGW A;  5CQL X;  3EE5 A;  1VGT A;  2D7I A;  2XWN A;  1H5T A;  1FZW A;  1ZJO A;  2ZU9 A;  1S4N A;  2BO8 A;  3V0Q A;  2XWL A;  1NQI B;  5JQQ A;  2OI6 A;  4Y9X A;  5IDT A;  2CU2 A;  4L41 C;  2RJ4 A;  1VIC A;  1YRO B;  4EE4 A;  3F1C A;  3R2W A;  1GA8 A;  3Q4S A;  4Y63 A;  1VM8 A;  2YQH A;  2PGY A;  4FRQ A;  5J49 A;  2V0I A;  3ZGF A;  1FGG A;  4G3Q A;  1G9R A;  1EYR A;  3LW6 A;  1XZ6 A;  4G3S A;  4M2A A;  2A8U A;  4D11 C;  4NAI A;  1HJL A;  1ZCU A;  1O7Q A;  1WSZ A;  2RIY A;  3U2T A;  1PZY B;  4CJB A;  2Y4J A;  4UEG A;  3T7O A;  2FYD B;  4EEG A;  2Y6P A;  3CU0 A;  4LW3 A;  2VS4 A;  2AES A;  3ZGG A;  3OH1 A;  4DE7 A;  5FU0 A;  1ZDG A;  1ZJ0 A;  3OH3 A;  2QH5 A;  2RJ8 A;  1G8O A;  1ZCV A;  1ZCT A;  1W57 A;  1YP2 A;  2OEF A;  1K4V A;  1NMM B;  3OKR A;  4C2S A;  3I0D A;  5IDS A;  2JCL A;  1WT1 A;  4B2W A;  1YP3 A;  2VD4 A;  3D98 A;  4EE3 A;  2PX7 A;  2VXL A;  3V8Z A;  1I52 A;  3R3I A;  3OAM A;  4AC3 A;  4ZDQ A;  1ZIZ A;  2XME A;  4M2B A;  3I0L A;  4KC2 A;  3JUK A;  2YQJ A;  3I0I X;  1LVW A;  5AJN A;  3U2X A;  2WE9 A;  4FRH A;  1ZDF A;  1G95 A;  1H7G A;  4HOC A;  4BMA A;  5C4C A;  2BO4 A;  2A8W A;  2OI7 A;  3I0G A;  5C1G A;  1NF5 B;  1LL3 A;  1PZT A;  2FYC B;  2AEC A;  1NWG B;  2JCK A;  4P00 A;  2ZU8 A;  1ON8 A;  3F1Y A;  5C4F A;  1H4D A;  3E25 A;  5C38 A;  4YS8 A;  1VH3 A;  2I5K A;  2UX8 A;  3I0H A;  4FQW A;  5C48 A;  2Q4J A;  1INJ A;  1VZX A;  2D0J A;  4P02 A;  2VS3 A;  5CMF X;  1WT0 A;  2QKX A;  2RIZ A;  3T7M A;  3GUE A;  3T7N A;  1TVY A;  5C8R A;  5CMH A;  1WT2 A;  3SX3 A;  1S4O A;  4D11 A;  2VSH A;  1VZT A;  3FOQ A;  2Z86 A;  3QVB A;  4HO8 A;  5EIY A;  1YP4 A;  3IOI A;  4K6R A;  2VFZ A;  2RJ1 A;  4AYL A;  4Y7G A;  2GGQ A;  2FYA A;  2YQS A;  4KC1 A;  4HO3 A;  1G2V A;  1R80 A;  1R7Y A;  2APC A;  5DDT A;  3SXB A;  3ZLL A;  1H5S A;  1R7U A;  1FR9 A;  1W77 A;  1VZU A;  4KPX A;  4ARW A;  5CQM X;  4CJ8 A;  1G23 A;  2O1H A;  4CJC A;  1R81 A;  1V84 A;  3SXG A;  5C4E A;  3V0L A;  4Y64 A;  2BO6 A;  5AJO A;  4B4M A;  3HL3 A;  1TZF A;  5DDV A;  4B4G A;  2XMH A;  2MZB A;  4B2X A;  4M28 A;  1R7V A;  4ASY A;  1GX4 A;  4NAK A;  2V0K A;  4GBP A;  1JV3 A;  3U0X A;  3O3P A;  1H5R B;  1ZI1 A;  4IRP A;  1JV1 A;  1ZJP A;  3POL A;  3DK5 A;  1KWS A;  1IIM A;  3PNN A;  4M4K A;  3ST8 A;  2V0L A;  2WVM A;  5FU8 A;  3U2V A;  3V91 A;  1GWV A;  2RJ5 A;  1HV9 A;  3CKN A;  5CQN X;  3OC9 A;  2YC5 A;  1QWJ A;  1ZHJ A;  2Y4K A;  3FWW A;  1R7T A;  3Q80 A;  1FXO A;  2BO7 A;  4HO4 A;  3JUJ A;  1H7T A;  5FV9 A;  2YCM A;  3CGX A;  2W0V A;  5FYE A;  2Y4M A;  3OH2 A;  1ON6 A;  2ICX A;  1GX0 A;  1V83 A;  4FCU A;  2Z87 A;  1O23 B;  3TZT A;  3V8Y A;  3SPT A;  1LL0 A;  4EEM A;  5CMI A;  2WEE A;  3PKP A;  2P72 A;  2VSI A;  4KPZ A;  4Y7V A;  4Y7U A;  2AM3 A;  1H7L A;  1GQ9 A;  1MC3 A;  3U2W A;  2YES A;  4G87 A;  4KQL A;  2RJ0 A;  4HO6 A;  3SXE A;  4ECM A;  1FR8 A;  1QGQ A;  3U2U A;  1H5S D;  3N9W A;  4FRP A;  1JVG A;  3I0F A;  4KC4 A;  4KRV A;  1OQM B;  4Y7T A;  1EZI A;  3D5N A;  3D8V A;  5L6V A;  4HO0 A;  4R7P A;  3SXD A;  3OH4 A;  4AYJ A;  3RMV A;  3SXA A;  4Y7F A;  4G3P A;  3USR A;  4B3U A;  2X65 A;  2V0J A;  1GQC A;  4B42 A;  4FRB A;  1FRW A;  2X60 A;  3IOJ A;  1NHE B;  1ZCY A;  2NXV A;  4AAW A;  4JD0 A;  3CKV A;  3K8E A;  1G0R A;  1O7O A;  2DPW A;  2VXM A;  3CKO A;  2RJ6 A;  4D0T A;  3BRK X;  3OH0 A;  2RJ9 A;  1LZJ A;  4Y62 A;  1WVC A;  2RJ7 A;  1ZJ2 A;  4LW6 A;  3SX7 A;  1FO9 A;  1SS9 A;  5CMG X;  3CKQ A;  3U0Y A;  1JYL A;  4Y6N A;  2AE7 A;  5CQO A;  1HM9 A;  3SX5 A;  4FRD A;  1MP5 A;  3V0P A;  4J18 A;  4HO5 A;  3I0C A;  4HCQ A;  2WVK A;  1GWW A;  2RIX A;  5C3D A;  1R7X A;  4FRA A;  2PA4 A;  2JCJ A;  2O1F A;  2AM4 A;  4HG6 A;  1FG5 N;  3I0K A;  4DDZ A;  3ZF8 A;  2X5Z A;  4E1K A;  4FCE A;  1LZ7 A;  1VGU A;  1W55 A;  3DJ4 A;  1R82 A;  3RMW A;  2AM5 A;  5C1L A;  5C3A A;  2AGD A;  5CQP A;  3SXC A;  4EVW A;  1FO8 A;  3CKJ A;  3V90 A;  2ICY A;  1LL2 A;  3NGW A;  4HO9 A;  2W0W A;  5C4D A;  1H7H A;  4NAN A;  4MND A;  1ZJ1 A;  4IRQ A;  2YQC A;  3OGZ A;  1OMX A;  1ZI5 A;  1VH1 A;  2WVL A;  2Y7A A;  4KNR A;  3JTJ A;  5FUH A;  4D48 A;  2FYB A;  5C49 A;  4KT7 A;  1JVD A;  5EJ1 A;  1G3L A;  4D0Z A;  2FY7 A;  1FOA A;  1HJJ A;  4EEO A;  2OEG A;  2I7B A;  1WT3 A;  2YC3 A;  5BXC A;  3PKQ A;  3DUV A;  3V0N A;  4XWI A;  1HM8 A;  5I1F A;  2Y4L A;  2WGZ A;  5HS2 A;  5C3B A;  2AH9 A;  4HO2 A;  3V0M A;  2OI5 A;  1OMZ A;  1V82 A;  5C47 A;  2E8B A;  1H5S C;  1VGZ A; 
#chains in the Genus database with same CATH topology
 4ASJ A;  1LZ0 A;  1QGS A;  1G97 A;  4FRL A;  3IOH A;  2V0H A;  1ZJ3 A;  2E3D A;  4FRM A;  1INI A;  3RSB A;  1H7F A;  4FRO A;  3I0J A;  4B5B A;  4CVH A;  3V0O A;  2WAW A;  1QG8 A;  4Y6U A;  2GGO A;  5EJZ A;  5CMJ A;  2P73 A;  5C36 A;  1H5R A;  1NKH B;  3ZLK A;  1G1L A;  1XHB A;  3K8D A;  3E26 A;  1FGX A;  2J0B A;  2PGV A;  2FFV A;  1H5T B;  1S4P A;  5FTV A;  3BCV A;  2FFU A;  1VPA A;  1FWY A;  3KIA A;  2X5S A;  4B4B A;  2JCO A;  4NAL A;  1H4C A;  3Q7U A;  2O1G A;  1E5K A;  4JIS A;  2C0N A;  5FTS A;  3SX8 A;  1H5S B;  1MP4 A;  2VS5 A;  4FRE A;  1TW5 A;  1O0R A;  5C1H A;  3I0E A;  4O6M A;  4DEC A;  1H4E A;  4KNX A;  1HM0 A;  1G93 A;  1Z90 A;  4EE5 A;  2I5E A;  3TQD A;  1ZI3 A;  2P6W A;  4KXO A;  5L6S A;  1H3M A;  2D7R A;  4BQH A;  2XWM A;  1LZI A;  1ZI4 A;  2ZU7 A;  1H7E A;  4MYB A;  5AJP A;  1MP3 A;  5C4B A;  1IIN A;  1TW1 A;  4EEA A;  5IFY A;  1H7Q A;  1JYK A;  2RIT A;  2QGI A;  1FXJ A;  3USQ A;  1VGW A;  5CQL X;  3EE5 A;  1VGT A;  2D7I A;  2XWN A;  1H5T A;  1FZW A;  1ZJO A;  2ZU9 A;  1S4N A;  2BO8 A;  3V0Q A;  2XWL A;  1NQI B;  5JQQ A;  2OI6 A;  4Y9X A;  5IDT A;  2CU2 A;  2J0A A;  4L41 C;  2RJ4 A;  1VIC A;  1YRO B;  4EE4 A;  3F1C A;  3R2W A;  1GA8 A;  3Q4S A;  4Y63 A;  1VM8 A;  2YQH A;  2PGY A;  4FRQ A;  5J49 A;  2V0I A;  3ZGF A;  1FGG A;  4G3Q A;  1G9R A;  1EYR A;  3LW6 A;  1XZ6 A;  4G3S A;  4M2A A;  2A8U A;  4D11 C;  4NAI A;  1HJL A;  1ZCU A;  1O7Q A;  1WSZ A;  2RIY A;  3U2T A;  1PZY B;  4CJB A;  2Y4J A;  4UEG A;  3T7O A;  2FYD B;  4EEG A;  2Y6P A;  3CU0 A;  4LW3 A;  2VS4 A;  2AES A;  3ZGG A;  3OH1 A;  4DE7 A;  5FU0 A;  1ZDG A;  1ZJ0 A;  3OH3 A;  2QH5 A;  2RJ8 A;  1G8O A;  1ZCV A;  1ZCT A;  1W57 A;  1YP2 A;  2OEF A;  1K4V A;  1NMM B;  3OKR A;  4C2S A;  3I0D A;  5IDS A;  2JCL A;  1WT1 A;  4B2W A;  1YP3 A;  2VD4 A;  3D98 A;  4EE3 A;  2PX7 A;  2VXL A;  3V8Z A;  1I52 A;  3R3I A;  3OAM A;  4AC3 A;  4ZDQ A;  1ZIZ A;  2XME A;  4M2B A;  3I0L A;  4KC2 A;  3JUK A;  2YQJ A;  3I0I X;  1LVW A;  5AJN A;  3U2X A;  2WE9 A;  4FRH A;  1ZDF A;  1G95 A;  1H7G A;  4HOC A;  4BMA A;  5C4C A;  2BO4 A;  2A8W A;  2OI7 A;  3I0G A;  5C1G A;  1NF5 B;  1LL3 A;  1PZT A;  2FYC B;  2AEC A;  1NWG B;  2JCK A;  4P00 A;  2ZU8 A;  1ON8 A;  3F1Y A;  5C4F A;  1H4D A;  3E25 A;  5C38 A;  4YS8 A;  1VH3 A;  2I5K A;  2UX8 A;  3I0H A;  4FQW A;  5C48 A;  2Q4J A;  1INJ A;  1VZX A;  2D0J A;  4P02 A;  2VS3 A;  5CMF X;  1WT0 A;  2QKX A;  2RIZ A;  3T7M A;  3GUE A;  3T7N A;  1TVY A;  5C8R A;  5CMH A;  1WT2 A;  3SX3 A;  1S4O A;  4D11 A;  2VSH A;  1VZT A;  3FOQ A;  2Z86 A;  3QVB A;  4HO8 A;  5EIY A;  1YP4 A;  3IOI A;  4K6R A;  2VFZ A;  2RJ1 A;  4AYL A;  4Y7G A;  2GGQ A;  2FYA A;  2YQS A;  4KC1 A;  4HO3 A;  1G2V A;  1R80 A;  1R7Y A;  2APC A;  5D92 A;  5DDT A;  3SXB A;  3ZLL A;  1H5S A;  1R7U A;  1FR9 A;  1W77 A;  1VZU A;  4KPX A;  4ARW A;  5CQM X;  4CJ8 A;  1G23 A;  2O1H A;  4CJC A;  1R81 A;  1V84 A;  3SXG A;  5C4E A;  3V0L A;  4Y64 A;  2BO6 A;  5AJO A;  4B4M A;  3HL3 A;  1TZF A;  5DDV A;  4B4G A;  2XMH A;  2MZB A;  4B2X A;  4M28 A;  1R7V A;  4ASY A;  1GX4 A;  4NAK A;  4FIX A;  2V0K A;  4GBP A;  1JV3 A;  3U0X A;  3O3P A;  1H5R B;  1ZI1 A;  4IRP A;  1JV1 A;  1ZJP A;  3POL A;  3DK5 A;  1KWS A;  1IIM A;  3PNN A;  4M4K A;  3ST8 A;  2V0L A;  2WVM A;  5FU8 A;  3U2V A;  3V91 A;  1GWV A;  2RJ5 A;  1HV9 A;  3CKN A;  5CQN X;  3OC9 A;  4O6N A;  2YC5 A;  1QWJ A;  1ZHJ A;  2Y4K A;  3FWW A;  1R7T A;  3Q80 A;  1FXO A;  2BO7 A;  4HO4 A;  3JUJ A;  1H7T A;  4MIX A;  2YCM A;  5FV9 A;  3CGX A;  2W0V A;  5FYE A;  2Y4M A;  3OH2 A;  2VK9 A;  1ON6 A;  2ICX A;  1GX0 A;  1V83 A;  4FCU A;  2Z87 A;  1O23 B;  3TZT A;  3V8Y A;  3SPT A;  1LL0 A;  4EEM A;  5CMI A;  2WEE A;  3PKP A;  2P72 A;  2VSI A;  4KPZ A;  4Y7V A;  4Y7U A;  2AM3 A;  1H7L A;  1GQ9 A;  1MC3 A;  3U2W A;  2YES A;  4G87 A;  4KQL A;  2RJ0 A;  4HO6 A;  3SXE A;  4ECM A;  1FR8 A;  1QGQ A;  3U2U A;  1H5S D;  3N9W A;  4FRP A;  1JVG A;  3I0F A;  4KC4 A;  4KRV A;  1OQM B;  4Y7T A;  1EZI A;  3D5N A;  3D8V A;  5L6V A;  4FIY A;  4HO0 A;  4Q7C A;  4R7P A;  3OH4 A;  3SXD A;  4AYJ A;  3RMV A;  3SXA A;  4Y7F A;  4G3P A;  3USR A;  4B3U A;  2X65 A;  2V0J A;  1GQC A;  4B42 A;  4FRB A;  1FRW A;  2X60 A;  3IOJ A;  1NHE B;  1ZCY A;  2NXV A;  4AAW A;  4JD0 A;  3CKV A;  3K8E A;  1G0R A;  1O7O A;  2DPW A;  2VXM A;  3CKO A;  2RJ6 A;  4D0T A;  3BRK X;  3OH0 A;  2RJ9 A;  1LZJ A;  4Y62 A;  1WVC A;  2RJ7 A;  1ZJ2 A;  4LW6 A;  3SX7 A;  1FO9 A;  1SS9 A;  5CMG X;  3CKQ A;  3U0Y A;  1JYL A;  4Y6N A;  2AE7 A;  5CQO A;  1HM9 A;  3SX5 A;  4FRD A;  1MP5 A;  3V0P A;  4J18 A;  4HO5 A;  3I0C A;  4HCQ A;  2WVK A;  1GWW A;  2RIX A;  5C3D A;  1R7X A;  4FRA A;  2PA4 A;  2JCJ A;  2O1F A;  2AM4 A;  4HG6 A;  1FG5 N;  3I0K A;  4DDZ A;  3ZF8 A;  2X5Z A;  4E1K A;  4FCE A;  1LZ7 A;  1VGU A;  1W55 A;  3DJ4 A;  1R82 A;  3RMW A;  2AM5 A;  5C1L A;  5C3A A;  2AGD A;  5CQP A;  3SXC A;  4EVW A;  1FO8 A;  3CKJ A;  3V90 A;  2ICY A;  1LL2 A;  3NGW A;  4HO9 A;  2W0W A;  5C4D A;  1H7H A;  4NAN A;  4MND A;  1ZJ1 A;  4IRQ A;  2YQC A;  3OGZ A;  1OMX A;  1ZI5 A;  1VH1 A;  2WVL A;  2Y7A A;  4KNR A;  3JTJ A;  5FUH A;  4D48 A;  2FYB A;  5C49 A;  4KT7 A;  1JVD A;  5EJ1 A;  1G3L A;  4D0Z A;  2FY7 A;  1FOA A;  1HJJ A;  4EEO A;  2OEG A;  2I7B A;  1WT3 A;  2YC3 A;  5BXC A;  3PKQ A;  3DUV A;  3V0N A;  4XWI A;  1HM8 A;  5I1F A;  2Y4L A;  2WGZ A;  5D91 A;  5HS2 A;  5C3B A;  2AH9 A;  4HO2 A;  3V0M A;  2OI5 A;  1OMZ A;  1V82 A;  5C47 A;  2E8B A;  1H5S C;  1VGZ A; 
#chains in the Genus database with same CATH homology
 4ASJ A;  1LZ0 A;  1QGS A;  1G97 A;  4FRL A;  3IOH A;  2V0H A;  1ZJ3 A;  2E3D A;  4FRM A;  1INI A;  3RSB A;  1H7F A;  4FRO A;  3I0J A;  4B5B A;  4CVH A;  3V0O A;  2WAW A;  1QG8 A;  4Y6U A;  2GGO A;  5EJZ A;  5CMJ A;  2P73 A;  5C36 A;  1H5R A;  1NKH B;  3ZLK A;  1G1L A;  1XHB A;  3K8D A;  3E26 A;  1FGX A;  2J0B A;  2PGV A;  2FFV A;  1H5T B;  1S4P A;  5FTV A;  3BCV A;  2FFU A;  1VPA A;  1FWY A;  3KIA A;  2X5S A;  4B4B A;  2JCO A;  4NAL A;  1H4C A;  3Q7U A;  2O1G A;  1E5K A;  4JIS A;  2C0N A;  5FTS A;  3SX8 A;  1H5S B;  1MP4 A;  2VS5 A;  4FRE A;  1TW5 A;  1O0R A;  5C1H A;  3I0E A;  4O6M A;  4DEC A;  1H4E A;  4KNX A;  1HM0 A;  1G93 A;  1Z90 A;  4EE5 A;  2I5E A;  3TQD A;  1ZI3 A;  2P6W A;  4KXO A;  5L6S A;  1H3M A;  2D7R A;  4BQH A;  2XWM A;  1LZI A;  1ZI4 A;  2ZU7 A;  1H7E A;  4MYB A;  5AJP A;  1MP3 A;  5C4B A;  1IIN A;  1TW1 A;  4EEA A;  5IFY A;  1H7Q A;  1JYK A;  2RIT A;  2QGI A;  1FXJ A;  3USQ A;  1VGW A;  5CQL X;  3EE5 A;  1VGT A;  2D7I A;  2XWN A;  1H5T A;  1FZW A;  1ZJO A;  2ZU9 A;  1S4N A;  2BO8 A;  3V0Q A;  2XWL A;  1NQI B;  5JQQ A;  2OI6 A;  4Y9X A;  5IDT A;  2CU2 A;  2J0A A;  4L41 C;  2RJ4 A;  1VIC A;  1YRO B;  4EE4 A;  3F1C A;  3R2W A;  1GA8 A;  3Q4S A;  4Y63 A;  1VM8 A;  2YQH A;  2PGY A;  4FRQ A;  5J49 A;  2V0I A;  3ZGF A;  1FGG A;  4G3Q A;  1G9R A;  1EYR A;  3LW6 A;  1XZ6 A;  4G3S A;  4M2A A;  2A8U A;  4D11 C;  4NAI A;  1HJL A;  1ZCU A;  1O7Q A;  1WSZ A;  2RIY A;  3U2T A;  1PZY B;  4CJB A;  2Y4J A;  4UEG A;  3T7O A;  2FYD B;  4EEG A;  2Y6P A;  3CU0 A;  4LW3 A;  2VS4 A;  2AES A;  3ZGG A;  3OH1 A;  4DE7 A;  5FU0 A;  1ZDG A;  1ZJ0 A;  3OH3 A;  2QH5 A;  2RJ8 A;  1G8O A;  1ZCV A;  1ZCT A;  1W57 A;  1YP2 A;  2OEF A;  1K4V A;  1NMM B;  3OKR A;  4C2S A;  3I0D A;  5IDS A;  2JCL A;  1WT1 A;  4B2W A;  1YP3 A;  2VD4 A;  3D98 A;  4EE3 A;  2PX7 A;  2VXL A;  3V8Z A;  1I52 A;  3R3I A;  3OAM A;  4AC3 A;  4ZDQ A;  1ZIZ A;  2XME A;  4M2B A;  3I0L A;  4KC2 A;  3JUK A;  2YQJ A;  3I0I X;  1LVW A;  5AJN A;  3U2X A;  2WE9 A;  4FRH A;  1ZDF A;  1G95 A;  1H7G A;  4HOC A;  4BMA A;  5C4C A;  2BO4 A;  2A8W A;  2OI7 A;  3I0G A;  5C1G A;  1NF5 B;  1LL3 A;  1PZT A;  2FYC B;  2AEC A;  1NWG B;  2JCK A;  4P00 A;  2ZU8 A;  1ON8 A;  3F1Y A;  5C4F A;  1H4D A;  3E25 A;  5C38 A;  4YS8 A;  1VH3 A;  2I5K A;  2UX8 A;  3I0H A;  4FQW A;  5C48 A;  2Q4J A;  1INJ A;  1VZX A;  2D0J A;  4P02 A;  2VS3 A;  5CMF X;  1WT0 A;  2QKX A;  2RIZ A;  3T7M A;  3GUE A;  3T7N A;  1TVY A;  5C8R A;  5CMH A;  1WT2 A;  3SX3 A;  1S4O A;  4D11 A;  2VSH A;  1VZT A;  3FOQ A;  2Z86 A;  3QVB A;  4HO8 A;  5EIY A;  1YP4 A;  3IOI A;  4K6R A;  2VFZ A;  2RJ1 A;  4AYL A;  4Y7G A;  2GGQ A;  2FYA A;  2YQS A;  4KC1 A;  4HO3 A;  1G2V A;  1R80 A;  1R7Y A;  2APC A;  5D92 A;  5DDT A;  3SXB A;  3ZLL A;  1H5S A;  1R7U A;  1FR9 A;  1W77 A;  1VZU A;  4KPX A;  4ARW A;  5CQM X;  4CJ8 A;  1G23 A;  2O1H A;  4CJC A;  1R81 A;  1V84 A;  3SXG A;  5C4E A;  3V0L A;  4Y64 A;  2BO6 A;  5AJO A;  4B4M A;  3HL3 A;  1TZF A;  5DDV A;  4B4G A;  2XMH A;  2MZB A;  4B2X A;  4M28 A;  1R7V A;  4ASY A;  1GX4 A;  4NAK A;  4FIX A;  2V0K A;  4GBP A;  1JV3 A;  3U0X A;  3O3P A;  1H5R B;  1ZI1 A;  4IRP A;  1JV1 A;  1ZJP A;  3POL A;  3DK5 A;  1KWS A;  1IIM A;  3PNN A;  4M4K A;  3ST8 A;  2V0L A;  2WVM A;  5FU8 A;  3U2V A;  3V91 A;  1GWV A;  2RJ5 A;  1HV9 A;  3CKN A;  5CQN X;  3OC9 A;  4O6N A;  2YC5 A;  1QWJ A;  1ZHJ A;  2Y4K A;  3FWW A;  1R7T A;  3Q80 A;  1FXO A;  2BO7 A;  4HO4 A;  3JUJ A;  1H7T A;  4MIX A;  2YCM A;  5FV9 A;  3CGX A;  2W0V A;  5FYE A;  2Y4M A;  3OH2 A;  2VK9 A;  1ON6 A;  2ICX A;  1GX0 A;  1V83 A;  4FCU A;  2Z87 A;  1O23 B;  3TZT A;  3V8Y A;  3SPT A;  1LL0 A;  4EEM A;  5CMI A;  2WEE A;  3PKP A;  2P72 A;  2VSI A;  4KPZ A;  4Y7V A;  4Y7U A;  2AM3 A;  1H7L A;  1GQ9 A;  1MC3 A;  3U2W A;  2YES A;  4G87 A;  4KQL A;  2RJ0 A;  4HO6 A;  3SXE A;  4ECM A;  1FR8 A;  1QGQ A;  3U2U A;  1H5S D;  3N9W A;  4FRP A;  1JVG A;  3I0F A;  4KC4 A;  4KRV A;  1OQM B;  4Y7T A;  1EZI A;  3D5N A;  3D8V A;  5L6V A;  4FIY A;  4HO0 A;  4Q7C A;  4R7P A;  3OH4 A;  3SXD A;  4AYJ A;  3RMV A;  3SXA A;  4Y7F A;  4G3P A;  3USR A;  4B3U A;  2X65 A;  2V0J A;  1GQC A;  4B42 A;  4FRB A;  1FRW A;  2X60 A;  3IOJ A;  1NHE B;  1ZCY A;  2NXV A;  4AAW A;  4JD0 A;  3CKV A;  3K8E A;  1G0R A;  1O7O A;  2DPW A;  2VXM A;  3CKO A;  2RJ6 A;  4D0T A;  3BRK X;  3OH0 A;  2RJ9 A;  1LZJ A;  4Y62 A;  1WVC A;  2RJ7 A;  1ZJ2 A;  4LW6 A;  3SX7 A;  1FO9 A;  1SS9 A;  5CMG X;  3CKQ A;  3U0Y A;  1JYL A;  4Y6N A;  2AE7 A;  5CQO A;  1HM9 A;  3SX5 A;  4FRD A;  1MP5 A;  3V0P A;  4J18 A;  4HO5 A;  3I0C A;  4HCQ A;  2WVK A;  1GWW A;  2RIX A;  5C3D A;  1R7X A;  4FRA A;  2PA4 A;  2JCJ A;  2O1F A;  2AM4 A;  4HG6 A;  1FG5 N;  3I0K A;  4DDZ A;  3ZF8 A;  2X5Z A;  4E1K A;  4FCE A;  1LZ7 A;  1VGU A;  1W55 A;  3DJ4 A;  1R82 A;  3RMW A;  2AM5 A;  5C1L A;  5C3A A;  2AGD A;  5CQP A;  3SXC A;  4EVW A;  1FO8 A;  3CKJ A;  3V90 A;  2ICY A;  1LL2 A;  3NGW A;  4HO9 A;  2W0W A;  5C4D A;  1H7H A;  4NAN A;  4MND A;  1ZJ1 A;  4IRQ A;  2YQC A;  3OGZ A;  1OMX A;  1ZI5 A;  1VH1 A;  2WVL A;  2Y7A A;  4KNR A;  3JTJ A;  5FUH A;  4D48 A;  2FYB A;  5C49 A;  4KT7 A;  1JVD A;  5EJ1 A;  1G3L A;  4D0Z A;  2FY7 A;  1FOA A;  1HJJ A;  4EEO A;  2OEG A;  2I7B A;  1WT3 A;  2YC3 A;  5BXC A;  3PKQ A;  3DUV A;  3V0N A;  4XWI A;  1HM8 A;  5I1F A;  2Y4L A;  2WGZ A;  5D91 A;  5HS2 A;  5C3B A;  2AH9 A;  4HO2 A;  3V0M A;  2OI5 A;  1OMZ A;  1V82 A;  5C47 A;  2E8B A;  1H5S C;  1VGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...