4Y63A

Aaglyb in complex with amino-acid analogues
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
282
structure length
282
Chain Sequence
VSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYGGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histo-blood group ABO system transferase
publication title Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
doi rcsb
source organism Homo sapiens
total genus 97
structure length 282
sequence length 282
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2015-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03414 Glyco_transf_6 Glycosyltransferase family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4y63A00
5C1HA 1WT2A 2RJ6A 2VXLA 1H7FA 1G0RA 5IDSA 1LL3A 1G1LA 1MP3A 1ZDGA 4HO3A 2VXMA 4DE7A 1VZTA 2VS5A 4C2SA 3RMWA 3SXDA 1WT1A 3SX7A 1HM0A 1VICA 4FRLA 2BO4A 3IOHA 2VFZA 3BRKX 3HL3A 5C3AA 5FYEA 5C3BA 2YQHA 3Q80A 1VM8A 4HO4A 2MZBA 1G95A 1G9RA 4Y7VA 4DDZA 1WVCA 3V8YA 4M2BA 1H7GA 2ZU9A 1I52A 2FFUA 3D98A 4FCUA 1VZXA 5FV9A 2XWNA 2O1HA 4FRMA 2X5ZA 2JCKA 2WVKA 1H5SB 3V0NA 1EYRA 2FYAA 3JUKA 1ZJ3A 3JTJA 1LZIA 1R81A 1GWWA 3I0HA 3CKOA 3DJ4A 1WT3A 1FXOA 5J49A 4LW3A 1QGSA 3V0PA 1S4PA 1WT0A 2BO6A 1IIMA 3IOJA 1QGQA 5C4FA 1MP5A 3DUVA 1ZJPA 4FRHA 1R7VA 4FRBA 5FTSA 4IRPA 3V8ZA 5HS2A 1W55A 2RIYA 4KPZA 3U2WA 3GUEA 4K6RA 2YCMA 2Y4MA 5C1GA 3I0FA 1G93A 2JCLA 2RJ9A 4KC1A 4B4MA 2X60A 4E1KA 3T7MA 4G3PA 5C38A 4CJCA 4HO5A 1ZDFA 2Q4JA 4AYLA 3OH2A 4NALA 4P00A 4EEGA 1VPAA 1R80A 2V0LA 4ECMA 2I5EA 4HO2A 1FR9A 1H5SA 2XMHA 1H5RA 5C4BA 1ZI4A 4D11C 3OH4A 2ICXA 3F1YA 2AECA 5C47A 5C48A 3ZGGA 1VZUA 4LW6A 2AM3A 3I0IX 3PKQA 1H3MA 1NMMB 3SPTA 2X65A 3F1CA 2WVLA 1O0RA 2AGDA 3SXGA 1OMXA 2OEGA 4B4GA 4CJBA 2OI7A 1R82A 1HM8A 1NHEB 1XZ6A 3ZF8A 2AE7A 1H7EA 5CQMX 2P6WA 1O7OA 2W0VA 2YESA 3U0XA 1FRWA 1LZ0A 4D48A 4FRQA 1W57A 1FR8A 2VD4A 3O3PA 2A8WA 2RJ0A 1GQCA 1H5SD 1ZI5A 4FROA 2BO7A 4NANA 3PKPA 3U2VA 1ZCTA 2XWMA 2JCOA 4FREA 2W0WA 4BQHA 2Z86A 1INJA 1FWYA 1NWGB 4FQWA 1V84A 1S4OA 5CMFX 2Z87A 3ST8A 1R7XA 3CU0A 4BMAA 1R7YA 1YP2A 3Q7UA 1EZIA 2V0HA 5FUHA 1ZCYA 4MNDA 3D8VA 1R7TA 3V0OA 3T7OA 4MYBA 1QG8A 2WEEA 3IOIA 4D0ZA 2XWLA 2FYCB 1MP4A 4B4BA 3SX3A 3FWWA 2GGOA 1V83A 4Y9XA 1YP4A 3RMVA 2AM4A 5CMHA 1HJJA 5CQPA 4L41C 2RJ8A 2V0IA 2RJ5A 1H5RB 2Y4KA 3FOQA 1O23B 5IFYA 1PZYB 2ICYA 1Z90A 2ZU7A 2D0JA 4G87A 1HV9A 3U2TA 1H7LA 3I0EA 3T7NA 4HO8A 4CVHA 2WAWA 4ARWA 3EE5A 3SX5A 4EEMA 5AJNA 4DECA 4AC3A 3PNNA 4R7PA 1YP3A 2PX7A 2X5SA 4B2WA 3U2XA 5FTVA 4XWIA 4KQLA 4Y63A 2WGZA 3ZGFA 1ZCVA 1V82A 2RJ7A 2WVMA 5C8RA 2FYBA 4JISA 3LW6A 4KT7A 3SXEA 2DPWA 4EE3A 1FXJA 3CKNA 3I0DA 3R3IA 4D11A 4EE4A 1GX0A 3SXAA 1SS9A 2Y6PA 4AYJA 2VSHA 5DDTA 2GGQA 1GX4A 5L6SA 1O7QA 2AH9A 4EEAA 4KNXA 1JYLA 2YC5A 4Y7GA 1ZHJA 4Y62A 2O1GA 1G23A 4KRVA 2NXVA 1FO9A 3I0LA 1ZCUA 5I1FA 4EVWA 2FY7A 1H5SC 1XHBA 3OKRA 4G3QA 1K4VA 1JVDA 5CQLX 5AJOA 2RIXA 3I0GA 4KPXA 4KC2A 1ON6A 4Y6NA 1FO8A 3R2WA 4J18A 1GQ9A 1IINA 3V90A 1ZJ2A 4G3SA 1FGGA 4KXOA 5CQOA 2VS3A 2YQCA 2APCA 3ZLKA 5CMJA 1JVGA 5FU8A 1H4EA 5CMIA 1ZI3A 1FG5N 4M2AA 3SXBA 1E5KA 1LL2A 2V0KA 1JV1A 3K8EA 1FOAA 1G2VA 5FU0A 2WE9A 1OQMB 4D0TA 2AM5A 1GA8A 3TQDA 2OI6A 3U0YA 4ASYA 1ZIZA 1R7UA 1G97A 3E25A 2XMEA 3CKJA 3USQA 2A8UA 1LVWA 2AESA 1TZFA 3OC9A 1NKHB 2YQSA 3D5NA 1VH1A 3I0CA 1ZJ0A 4Y7UA 3U2UA 1YROB 1H5TA 2YQJA 1H4DA 1WSZA 1W77A 3V0LA 4UEGA 2Y4JA 4IRQA 2RITA 3CGXA 1FZWA 2FYDB 5C4DA 4HO9A 2Y7AA 2VSIA 4M28A 3OH0A 3E26A 1TW1A 5BXCA 3ZLLA 3K8DA 1NF5B 5CQNX 4CJ8A 3TZTA 3JUJA 3OGZA 3SX8A 4ASJA 4GBPA 5C4EA 2ZU8A 2V0JA 1GWVA 3USRA 2P72A 5EJ1A 1H7HA 2BO8A 4HCQA 2I7BA 2E3DA 4Y7FA 4B5BA 1VGZA 4FRPA 2I5KA 5JQQA 2JCJA 2Y4LA 4YS8A 2D7IA 3BCVA 1JYKA 5EJZA 2QGIA 4HO6A 3OH3A 3V91A 3OH1A 1TW5A 4B42A 5L6VA 1VGTA 1LL0A 3V0QA 1VGUA 1ON8A 4B3UA 4FCEA 4HO0A 4FRAA 4NAKA 1H7QA 2D7RA 2PA4A 4FRDA 4P02A 4Y6UA 1LZ7A 5C36A 2QH5A 1NQIB 4NAIA 4Y64A 1VH3A 4KNRA 3I0JA 5IDTA 1H7TA 2UX8A 3DK5A 2FFVA 1LZJA 2CU2A 3KIAA 1G8OA 1KWSA 3I0KA 1ZI1A 5CMGX 1INIA 3OAMA 4KC4A 4AAWA 4HG6A 5C3DA 3NGWA 3V0MA 1H5TB 1ZJOA 2QKXA 1HM9A 2VS4A 1MC3A 1QWJA 5DDVA 2RIZA 2OEFA 3QVBA 1H4CA 3CKQA 2E8BA 5EIYA 2PGVA 2RJ4A 5C4CA 2PGYA 4JD0A 4ZDQA 4M4KA 2OI5A 1FGXA 1VGWA 5C1LA 3Q4SA 1HJLA 3POLA 3N9WA 2RJ1A 4EEOA 2YC3A 1JV3A 5C49A 5AJPA 1PZTA 1S4NA 3CKVA 4EE5A 1G3LA 1OMZA 1TVYA 1ZJ1A 2O1FA 2P73A 4HOCA 3RSBA 4B2XA 4Y7TA 3SXCA
chains in the Genus database with same CATH superfamily
5C1HA 1WT2A 2RJ6A 2VXLA 1H7FA 1G0RA 5IDSA 1LL3A 1G1LA 1MP3A 1ZDGA 4HO3A 2VXMA 4O6MA 4DE7A 1VZTA 2VS5A 4C2SA 3RMWA 3SXDA 1WT1A 3SX7A 1HM0A 1VICA 4FRLA 2BO4A 3IOHA 2VFZA 3BRKX 3HL3A 5C3AA 5FYEA 5C3BA 2YQHA 3Q80A 1VM8A 4HO4A 2MZBA 1G95A 1G9RA 4Y7VA 4DDZA 1WVCA 3V8YA 4M2BA 1H7GA 2ZU9A 1I52A 2FFUA 3D98A 4FCUA 1VZXA 5FV9A 2XWNA 2O1HA 4FRMA 2X5ZA 2JCKA 2WVKA 1H5SB 3V0NA 1EYRA 2FYAA 3JUKA 1ZJ3A 3JTJA 1LZIA 1R81A 1GWWA 3I0HA 3CKOA 3DJ4A 1WT3A 1FXOA 5J49A 4LW3A 1QGSA 3V0PA 1S4PA 1WT0A 2BO6A 1IIMA 3IOJA 1QGQA 5C4FA 1MP5A 3DUVA 1ZJPA 4FIYA 1R7VA 4FRHA 4FRBA 4IRPA 5FTSA 3V8ZA 5HS2A 1W55A 2RIYA 4KPZA 3U2WA 3GUEA 4K6RA 2YCMA 2Y4MA 5C1GA 2J0AA 3I0FA 1G93A 2JCLA 2RJ9A 4KC1A 4B4MA 2X60A 4E1KA 3T7MA 2J0BA 4G3PA 5C38A 4Q7CA 4CJCA 4HO5A 1ZDFA 2Q4JA 4AYLA 3OH2A 4NALA 4P00A 4EEGA 1VPAA 1R80A 2V0LA 4ECMA 2I5EA 4HO2A 1FR9A 1H5SA 2XMHA 1H5RA 5C4BA 1ZI4A 4D11C 3OH4A 2ICXA 3F1YA 2AECA 5C47A 5C48A 3ZGGA 1VZUA 4LW6A 2AM3A 3I0IX 3PKQA 1H3MA 1NMMB 3SPTA 2X65A 3F1CA 2WVLA 1O0RA 2AGDA 3SXGA 1OMXA 2OEGA 4B4GA 4CJBA 2OI7A 1R82A 1HM8A 1NHEB 1XZ6A 3ZF8A 2AE7A 1H7EA 5CQMX 2P6WA 1O7OA 2W0VA 2YESA 3U0XA 1FRWA 4O6NA 1LZ0A 4D48A 4FRQA 1W57A 1FR8A 2VD4A 3O3PA 2A8WA 2RJ0A 1GQCA 1H5SD 1ZI5A 4FROA 2BO7A 4NANA 3PKPA 3U2VA 1ZCTA 2XWMA 2JCOA 4FREA 2W0WA 4BQHA 2Z86A 1INJA 1FWYA 1NWGB 4FQWA 1V84A 1S4OA 5CMFX 2Z87A 3ST8A 1R7XA 3CU0A 4BMAA 1R7YA 1YP2A 3Q7UA 1EZIA 2V0HA 5FUHA 1ZCYA 4MNDA 3D8VA 1R7TA 3V0OA 3T7OA 4MYBA 1QG8A 2WEEA 3IOIA 4D0ZA 2XWLA 2FYCB 1MP4A 4B4BA 3SX3A 3FWWA 2GGOA 1V83A 4Y9XA 1YP4A 3RMVA 2AM4A 5CMHA 1HJJA 2C0NA 5CQPA 4L41C 2RJ8A 2V0IA 2RJ5A 1H5RB 2Y4KA 3FOQA 1O23B 5IFYA 1PZYB 2ICYA 1Z90A 2ZU7A 2D0JA 4G87A 1HV9A 3U2TA 1H7LA 3I0EA 3T7NA 4HO8A 4CVHA 5D92A 2WAWA 4ARWA 3EE5A 3SX5A 4EEMA 5AJNA 4DECA 4AC3A 3PNNA 4R7PA 1YP3A 2PX7A 2X5SA 4B2WA 3U2XA 5FTVA 4XWIA 4KQLA 4Y63A 2WGZA 3ZGFA 1ZCVA 1V82A 2RJ7A 2WVMA 5C8RA 2FYBA 4JISA 3LW6A 4KT7A 3SXEA 2DPWA 4EE3A 1FXJA 3CKNA 3I0DA 3R3IA 4D11A 4EE4A 1GX0A 3SXAA 1SS9A 2Y6PA 4AYJA 2VSHA 5DDTA 2GGQA 1GX4A 5L6SA 1O7QA 2AH9A 4EEAA 4KNXA 1JYLA 2YC5A 4Y7GA 1ZHJA 4Y62A 2O1GA 1G23A 4KRVA 2NXVA 1FO9A 2VK9A 3I0LA 1ZCUA 5I1FA 4EVWA 2FY7A 1H5SC 1XHBA 3OKRA 4G3QA 1K4VA 1JVDA 5CQLX 5AJOA 2RIXA 3I0GA 4KPXA 4KC2A 1ON6A 4Y6NA 1FO8A 3R2WA 4J18A 1GQ9A 1IINA 3V90A 1ZJ2A 4G3SA 1FGGA 4KXOA 5CQOA 2VS3A 2YQCA 2APCA 3ZLKA 5CMJA 1JVGA 5FU8A 1H4EA 5CMIA 1ZI3A 1FG5N 4M2AA 3SXBA 1E5KA 1LL2A 2V0KA 1JV1A 3K8EA 1FOAA 1G2VA 5FU0A 5D91A 2WE9A 1OQMB 4D0TA 2AM5A 1GA8A 3TQDA 2OI6A 3U0YA 4ASYA 1ZIZA 1R7UA 1G97A 3E25A 2XMEA 3CKJA 3USQA 2A8UA 1LVWA 2AESA 1TZFA 3OC9A 1NKHB 2YQSA 3D5NA 1VH1A 3I0CA 1ZJ0A 4Y7UA 3U2UA 1YROB 1H5TA 2YQJA 1H4DA 1WSZA 1W77A 3V0LA 4UEGA 2Y4JA 4IRQA 2RITA 3CGXA 1FZWA 2FYDB 5C4DA 4HO9A 2Y7AA 2VSIA 4M28A 3OH0A 3E26A 1TW1A 5BXCA 3ZLLA 3K8DA 1NF5B 5CQNX 4CJ8A 3TZTA 3JUJA 3OGZA 3SX8A 4ASJA 4GBPA 5C4EA 2ZU8A 2V0JA 1GWVA 3USRA 2P72A 5EJ1A 1H7HA 2BO8A 4HCQA 2I7BA 2E3DA 4Y7FA 4B5BA 1VGZA 4FRPA 2I5KA 5JQQA 2JCJA 2Y4LA 4YS8A 2D7IA 3BCVA 1JYKA 5EJZA 2QGIA 4HO6A 3OH3A 3V91A 3OH1A 1TW5A 4B42A 5L6VA 1VGTA 1LL0A 3V0QA 1VGUA 1ON8A 4B3UA 4FCEA 4HO0A 4FRAA 4NAKA 1H7QA 2D7RA 2PA4A 4FRDA 4P02A 4Y6UA 1LZ7A 5C36A 2QH5A 1NQIB 4NAIA 4Y64A 1VH3A 4KNRA 3I0JA 5IDTA 1H7TA 2UX8A 3DK5A 2FFVA 1LZJA 2CU2A 3KIAA 1G8OA 1KWSA 3I0KA 1ZI1A 5CMGX 1INIA 3OAMA 4KC4A 4AAWA 4HG6A 5C3DA 3NGWA 3V0MA 1H5TB 1ZJOA 2QKXA 1HM9A 2VS4A 1MC3A 1QWJA 5DDVA 2RIZA 2OEFA 3QVBA 1H4CA 3CKQA 2E8BA 5EIYA 2PGVA 2RJ4A 5C4CA 2PGYA 4JD0A 4ZDQA 4M4KA 2OI5A 1FGXA 1VGWA 5C1LA 3Q4SA 1HJLA 3POLA 3N9WA 2RJ1A 4EEOA 2YC3A 1JV3A 5C49A 4FIXA 5AJPA 1PZTA 1S4NA 3CKVA 4EE5A 1G3LA 4MIXA 1OMZA 1TVYA 1ZJ1A 2O1FA 2P73A 4HOCA 3RSBA 4B2XA 4Y7TA 3SXCA
chains in the Genus database with same CATH topology
5C1HA 1WT2A 2RJ6A 2VXLA 1H7FA 1G0RA 5IDSA 1LL3A 1G1LA 1MP3A 1ZDGA 4HO3A 2VXMA 4O6MA 4DE7A 1VZTA 2VS5A 4C2SA 3RMWA 3SXDA 1WT1A 3SX7A 1HM0A 1VICA 4FRLA 2BO4A 3IOHA 2VFZA 3BRKX 3HL3A 5C3AA 5FYEA 5C3BA 2YQHA 3Q80A 1VM8A 4HO4A 2MZBA 1G95A 1G9RA 4Y7VA 4DDZA 1WVCA 3V8YA 4M2BA 1H7GA 2ZU9A 1I52A 2FFUA 3D98A 4FCUA 1VZXA 5FV9A 2XWNA 2O1HA 4FRMA 2X5ZA 2JCKA 2WVKA 1H5SB 3V0NA 1EYRA 2FYAA 3JUKA 1ZJ3A 3JTJA 1LZIA 1R81A 1GWWA 3I0HA 3CKOA 3DJ4A 1WT3A 1FXOA 5J49A 4LW3A 1QGSA 3V0PA 1S4PA 1WT0A 2BO6A 1IIMA 3IOJA 1QGQA 5C4FA 1MP5A 3DUVA 1ZJPA 4FIYA 1R7VA 4FRHA 4FRBA 4IRPA 5FTSA 3V8ZA 5HS2A 1W55A 2RIYA 4KPZA 3U2WA 3GUEA 4K6RA 2YCMA 2Y4MA 5C1GA 2J0AA 3I0FA 1G93A 2JCLA 2RJ9A 4KC1A 4B4MA 2X60A 4E1KA 3T7MA 2J0BA 4G3PA 5C38A 4Q7CA 4CJCA 4HO5A 1ZDFA 2Q4JA 4AYLA 3OH2A 4NALA 4P00A 4EEGA 1VPAA 1R80A 2V0LA 4ECMA 2I5EA 4HO2A 1FR9A 1H5SA 2XMHA 1H5RA 5C4BA 1ZI4A 4D11C 3OH4A 2ICXA 3F1YA 2AECA 5C47A 5C48A 3ZGGA 1VZUA 4LW6A 2AM3A 3I0IX 3PKQA 1H3MA 1NMMB 3SPTA 2X65A 3F1CA 2WVLA 1O0RA 2AGDA 3SXGA 1OMXA 2OEGA 4B4GA 4CJBA 2OI7A 1R82A 1HM8A 1NHEB 1XZ6A 3ZF8A 2AE7A 1H7EA 5CQMX 2P6WA 1O7OA 2W0VA 2YESA 3U0XA 1FRWA 4O6NA 1LZ0A 4D48A 4FRQA 1W57A 1FR8A 2VD4A 3O3PA 2A8WA 2RJ0A 1GQCA 1H5SD 1ZI5A 4FROA 2BO7A 4NANA 3PKPA 3U2VA 1ZCTA 2XWMA 2JCOA 4FREA 2W0WA 4BQHA 2Z86A 1INJA 1FWYA 1NWGB 4FQWA 1V84A 1S4OA 5CMFX 2Z87A 3ST8A 1R7XA 3CU0A 4BMAA 1R7YA 1YP2A 3Q7UA 1EZIA 2V0HA 5FUHA 1ZCYA 4MNDA 3D8VA 1R7TA 3V0OA 3T7OA 4MYBA 1QG8A 2WEEA 3IOIA 4D0ZA 2XWLA 2FYCB 1MP4A 4B4BA 3SX3A 3FWWA 2GGOA 1V83A 4Y9XA 1YP4A 3RMVA 2AM4A 5CMHA 1HJJA 2C0NA 5CQPA 4L41C 2RJ8A 2V0IA 2RJ5A 1H5RB 2Y4KA 3FOQA 1O23B 5IFYA 1PZYB 2ICYA 1Z90A 2ZU7A 2D0JA 4G87A 1HV9A 3U2TA 1H7LA 3I0EA 3T7NA 4HO8A 4CVHA 5D92A 2WAWA 4ARWA 3EE5A 3SX5A 4EEMA 5AJNA 4DECA 4AC3A 3PNNA 4R7PA 1YP3A 2PX7A 2X5SA 4B2WA 3U2XA 5FTVA 4XWIA 4KQLA 4Y63A 2WGZA 3ZGFA 1ZCVA 1V82A 2RJ7A 2WVMA 5C8RA 2FYBA 4JISA 3LW6A 4KT7A 3SXEA 2DPWA 4EE3A 1FXJA 3CKNA 3I0DA 3R3IA 4D11A 4EE4A 1GX0A 3SXAA 1SS9A 2Y6PA 4AYJA 2VSHA 5DDTA 2GGQA 1GX4A 5L6SA 1O7QA 2AH9A 4EEAA 4KNXA 1JYLA 2YC5A 4Y7GA 1ZHJA 4Y62A 2O1GA 1G23A 4KRVA 2NXVA 1FO9A 2VK9A 3I0LA 1ZCUA 5I1FA 4EVWA 2FY7A 1H5SC 1XHBA 3OKRA 4G3QA 1K4VA 1JVDA 5CQLX 5AJOA 2RIXA 3I0GA 4KPXA 4KC2A 1ON6A 4Y6NA 1FO8A 3R2WA 4J18A 1GQ9A 1IINA 3V90A 1ZJ2A 4G3SA 1FGGA 4KXOA 5CQOA 2VS3A 2YQCA 2APCA 3ZLKA 5CMJA 1JVGA 5FU8A 1H4EA 5CMIA 1ZI3A 1FG5N 4M2AA 3SXBA 1E5KA 1LL2A 2V0KA 1JV1A 3K8EA 1FOAA 1G2VA 5FU0A 5D91A 2WE9A 1OQMB 4D0TA 2AM5A 1GA8A 3TQDA 2OI6A 3U0YA 4ASYA 1ZIZA 1R7UA 1G97A 3E25A 2XMEA 3CKJA 3USQA 2A8UA 1LVWA 2AESA 1TZFA 3OC9A 1NKHB 2YQSA 3D5NA 1VH1A 3I0CA 1ZJ0A 4Y7UA 3U2UA 1YROB 1H5TA 2YQJA 1H4DA 1WSZA 1W77A 3V0LA 4UEGA 2Y4JA 4IRQA 2RITA 3CGXA 1FZWA 2FYDB 5C4DA 4HO9A 2Y7AA 2VSIA 4M28A 3OH0A 3E26A 1TW1A 5BXCA 3ZLLA 3K8DA 1NF5B 5CQNX 4CJ8A 3TZTA 3JUJA 3OGZA 3SX8A 4ASJA 4GBPA 5C4EA 2ZU8A 2V0JA 1GWVA 3USRA 2P72A 5EJ1A 1H7HA 2BO8A 4HCQA 2I7BA 2E3DA 4Y7FA 4B5BA 1VGZA 4FRPA 2I5KA 5JQQA 2JCJA 2Y4LA 4YS8A 2D7IA 3BCVA 1JYKA 5EJZA 2QGIA 4HO6A 3OH3A 3V91A 3OH1A 1TW5A 4B42A 5L6VA 1VGTA 1LL0A 3V0QA 1VGUA 1ON8A 4B3UA 4FCEA 4HO0A 4FRAA 4NAKA 1H7QA 2D7RA 2PA4A 4FRDA 4P02A 4Y6UA 1LZ7A 5C36A 2QH5A 1NQIB 4NAIA 4Y64A 1VH3A 4KNRA 3I0JA 5IDTA 1H7TA 2UX8A 3DK5A 2FFVA 1LZJA 2CU2A 3KIAA 1G8OA 1KWSA 3I0KA 1ZI1A 5CMGX 1INIA 3OAMA 4KC4A 4AAWA 4HG6A 5C3DA 3NGWA 3V0MA 1H5TB 1ZJOA 2QKXA 1HM9A 2VS4A 1MC3A 1QWJA 5DDVA 2RIZA 2OEFA 3QVBA 1H4CA 3CKQA 2E8BA 5EIYA 2PGVA 2RJ4A 5C4CA 2PGYA 4JD0A 4ZDQA 4M4KA 2OI5A 1FGXA 1VGWA 5C1LA 3Q4SA 1HJLA 3POLA 3N9WA 2RJ1A 4EEOA 2YC3A 1JV3A 5C49A 4FIXA 5AJPA 1PZTA 1S4NA 3CKVA 4EE5A 1G3LA 4MIXA 1OMZA 1TVYA 1ZJ1A 2O1FA 2P73A 4HOCA 3RSBA 4B2XA 4Y7TA 3SXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C1H A;  1WT2 A;  2RJ6 A;  2VXL A;  1H7F A;  1G0R A;  5IDS A;  1LL3 A;  1G1L A;  1MP3 A;  1ZDG A;  4HO3 A;  2VXM A;  4DE7 A;  1VZT A;  2VS5 A;  4C2S A;  3RMW A;  3SXD A;  1WT1 A;  3SX7 A;  1HM0 A;  1VIC A;  4FRL A;  2BO4 A;  3IOH A;  2VFZ A;  3BRK X;  3HL3 A;  5C3A A;  5FYE A;  5C3B A;  2YQH A;  3Q80 A;  1VM8 A;  4HO4 A;  2MZB A;  1G95 A;  1G9R A;  4Y7V A;  4DDZ A;  1WVC A;  3V8Y A;  4M2B A;  1H7G A;  2ZU9 A;  1I52 A;  2FFU A;  3D98 A;  4FCU A;  1VZX A;  5FV9 A;  2XWN A;  2O1H A;  4FRM A;  2X5Z A;  2JCK A;  2WVK A;  1H5S B;  3V0N A;  1EYR A;  2FYA A;  3JUK A;  1ZJ3 A;  3JTJ A;  1LZI A;  1R81 A;  1GWW A;  3I0H A;  3CKO A;  3DJ4 A;  1WT3 A;  1FXO A;  5J49 A;  4LW3 A;  1QGS A;  3V0P A;  1S4P A;  1WT0 A;  2BO6 A;  1IIM A;  3IOJ A;  1QGQ A;  5C4F A;  1MP5 A;  3DUV A;  1ZJP A;  4FRH A;  1R7V A;  4FRB A;  5FTS A;  4IRP A;  3V8Z A;  5HS2 A;  1W55 A;  2RIY A;  4KPZ A;  3U2W A;  3GUE A;  4K6R A;  2YCM A;  2Y4M A;  5C1G A;  3I0F A;  1G93 A;  2JCL A;  2RJ9 A;  4KC1 A;  4B4M A;  2X60 A;  4E1K A;  3T7M A;  4G3P A;  5C38 A;  4CJC A;  4HO5 A;  1ZDF A;  2Q4J A;  4AYL A;  3OH2 A;  4NAL A;  4P00 A;  4EEG A;  1VPA A;  1R80 A;  2V0L A;  4ECM A;  2I5E A;  4HO2 A;  1FR9 A;  1H5S A;  2XMH A;  1H5R A;  5C4B A;  1ZI4 A;  4D11 C;  3OH4 A;  2ICX A;  3F1Y A;  2AEC A;  5C47 A;  5C48 A;  3ZGG A;  1VZU A;  4LW6 A;  2AM3 A;  3I0I X;  3PKQ A;  1H3M A;  1NMM B;  3SPT A;  2X65 A;  3F1C A;  2WVL A;  1O0R A;  2AGD A;  3SXG A;  1OMX A;  2OEG A;  4B4G A;  4CJB A;  2OI7 A;  1R82 A;  1HM8 A;  1NHE B;  1XZ6 A;  3ZF8 A;  2AE7 A;  1H7E A;  5CQM X;  2P6W A;  1O7O A;  2W0V A;  2YES A;  3U0X A;  1FRW A;  1LZ0 A;  4D48 A;  4FRQ A;  1W57 A;  1FR8 A;  2VD4 A;  3O3P A;  2A8W A;  2RJ0 A;  1GQC A;  1H5S D;  1ZI5 A;  4FRO A;  2BO7 A;  4NAN A;  3PKP A;  3U2V A;  1ZCT A;  2XWM A;  2JCO A;  4FRE A;  2W0W A;  4BQH A;  2Z86 A;  1INJ A;  1FWY A;  1NWG B;  4FQW A;  1V84 A;  1S4O A;  5CMF X;  2Z87 A;  3ST8 A;  1R7X A;  3CU0 A;  4BMA A;  1R7Y A;  1YP2 A;  3Q7U A;  1EZI A;  2V0H A;  5FUH A;  1ZCY A;  4MND A;  3D8V A;  1R7T A;  3V0O A;  3T7O A;  4MYB A;  1QG8 A;  2WEE A;  3IOI A;  4D0Z A;  2XWL A;  2FYC B;  1MP4 A;  4B4B A;  3SX3 A;  3FWW A;  2GGO A;  1V83 A;  4Y9X A;  1YP4 A;  3RMV A;  2AM4 A;  5CMH A;  1HJJ A;  5CQP A;  4L41 C;  2RJ8 A;  2V0I A;  2RJ5 A;  1H5R B;  2Y4K A;  3FOQ A;  1O23 B;  5IFY A;  1PZY B;  2ICY A;  1Z90 A;  2ZU7 A;  2D0J A;  4G87 A;  1HV9 A;  3U2T A;  1H7L A;  3I0E A;  3T7N A;  4HO8 A;  4CVH A;  2WAW A;  4ARW A;  3EE5 A;  3SX5 A;  4EEM A;  5AJN A;  4DEC A;  4AC3 A;  3PNN A;  4R7P A;  1YP3 A;  2PX7 A;  2X5S A;  4B2W A;  3U2X A;  5FTV A;  4XWI A;  4KQL A;  4Y63 A;  2WGZ A;  3ZGF A;  1ZCV A;  1V82 A;  2RJ7 A;  2WVM A;  5C8R A;  2FYB A;  4JIS A;  3LW6 A;  4KT7 A;  3SXE A;  2DPW A;  4EE3 A;  1FXJ A;  3CKN A;  3I0D A;  3R3I A;  4D11 A;  4EE4 A;  1GX0 A;  3SXA A;  1SS9 A;  2Y6P A;  4AYJ A;  2VSH A;  5DDT A;  2GGQ A;  1GX4 A;  5L6S A;  1O7Q A;  2AH9 A;  4EEA A;  4KNX A;  1JYL A;  2YC5 A;  4Y7G A;  1ZHJ A;  4Y62 A;  2O1G A;  1G23 A;  4KRV A;  2NXV A;  1FO9 A;  3I0L A;  1ZCU A;  5I1F A;  4EVW A;  2FY7 A;  1H5S C;  1XHB A;  3OKR A;  4G3Q A;  1K4V A;  1JVD A;  5CQL X;  5AJO A;  2RIX A;  3I0G A;  4KPX A;  4KC2 A;  1ON6 A;  4Y6N A;  1FO8 A;  3R2W A;  4J18 A;  1GQ9 A;  1IIN A;  3V90 A;  1ZJ2 A;  4G3S A;  1FGG A;  4KXO A;  5CQO A;  2VS3 A;  2YQC A;  2APC A;  3ZLK A;  5CMJ A;  1JVG A;  5FU8 A;  1H4E A;  5CMI A;  1ZI3 A;  1FG5 N;  4M2A A;  3SXB A;  1E5K A;  1LL2 A;  2V0K A;  1JV1 A;  3K8E A;  1FOA A;  1G2V A;  5FU0 A;  2WE9 A;  1OQM B;  4D0T A;  2AM5 A;  1GA8 A;  3TQD A;  2OI6 A;  3U0Y A;  4ASY A;  1ZIZ A;  1R7U A;  1G97 A;  3E25 A;  2XME A;  3CKJ A;  3USQ A;  2A8U A;  1LVW A;  2AES A;  1TZF A;  3OC9 A;  1NKH B;  2YQS A;  3D5N A;  1VH1 A;  3I0C A;  1ZJ0 A;  4Y7U A;  3U2U A;  1YRO B;  1H5T A;  2YQJ A;  1H4D A;  1WSZ A;  1W77 A;  3V0L A;  4UEG A;  2Y4J A;  4IRQ A;  2RIT A;  3CGX A;  1FZW A;  2FYD B;  5C4D A;  4HO9 A;  2Y7A A;  2VSI A;  4M28 A;  3OH0 A;  3E26 A;  1TW1 A;  5BXC A;  3ZLL A;  3K8D A;  1NF5 B;  5CQN X;  4CJ8 A;  3TZT A;  3JUJ A;  3OGZ A;  3SX8 A;  4ASJ A;  4GBP A;  5C4E A;  2ZU8 A;  2V0J A;  1GWV A;  3USR A;  2P72 A;  5EJ1 A;  1H7H A;  2BO8 A;  4HCQ A;  2I7B A;  2E3D A;  4Y7F A;  4B5B A;  1VGZ A;  4FRP A;  2I5K A;  5JQQ A;  2JCJ A;  2Y4L A;  4YS8 A;  2D7I A;  3BCV A;  1JYK A;  5EJZ A;  2QGI A;  4HO6 A;  3OH3 A;  3V91 A;  3OH1 A;  1TW5 A;  4B42 A;  5L6V A;  1VGT A;  1LL0 A;  3V0Q A;  1VGU A;  1ON8 A;  4B3U A;  4FCE A;  4HO0 A;  4FRA A;  4NAK A;  1H7Q A;  2D7R A;  2PA4 A;  4FRD A;  4P02 A;  4Y6U A;  1LZ7 A;  5C36 A;  2QH5 A;  1NQI B;  4NAI A;  4Y64 A;  1VH3 A;  4KNR A;  3I0J A;  5IDT A;  1H7T A;  2UX8 A;  3DK5 A;  2FFV A;  1LZJ A;  2CU2 A;  3KIA A;  1G8O A;  1KWS A;  3I0K A;  1ZI1 A;  5CMG X;  1INI A;  3OAM A;  4KC4 A;  4AAW A;  4HG6 A;  5C3D A;  3NGW A;  3V0M A;  1H5T B;  1ZJO A;  2QKX A;  1HM9 A;  2VS4 A;  1MC3 A;  1QWJ A;  5DDV A;  2RIZ A;  2OEF A;  3QVB A;  1H4C A;  3CKQ A;  2E8B A;  5EIY A;  2PGV A;  2RJ4 A;  5C4C A;  2PGY A;  4JD0 A;  4ZDQ A;  4M4K A;  2OI5 A;  1FGX A;  1VGW A;  5C1L A;  3Q4S A;  1HJL A;  3POL A;  3N9W A;  2RJ1 A;  4EEO A;  2YC3 A;  1JV3 A;  5C49 A;  5AJP A;  1PZT A;  1S4N A;  3CKV A;  4EE5 A;  1G3L A;  1OMZ A;  1TVY A;  1ZJ1 A;  2O1F A;  2P73 A;  4HOC A;  3RSB A;  4B2X A;  4Y7T A;  3SXC A; 
#chains in the Genus database with same CATH topology
 5C1H A;  1WT2 A;  2RJ6 A;  2VXL A;  1H7F A;  1G0R A;  5IDS A;  1LL3 A;  1G1L A;  1MP3 A;  1ZDG A;  4HO3 A;  2VXM A;  4O6M A;  4DE7 A;  1VZT A;  2VS5 A;  4C2S A;  3RMW A;  3SXD A;  1WT1 A;  3SX7 A;  1HM0 A;  1VIC A;  4FRL A;  2BO4 A;  3IOH A;  2VFZ A;  3BRK X;  3HL3 A;  5C3A A;  5FYE A;  5C3B A;  2YQH A;  3Q80 A;  1VM8 A;  4HO4 A;  2MZB A;  1G95 A;  1G9R A;  4Y7V A;  4DDZ A;  1WVC A;  3V8Y A;  4M2B A;  1H7G A;  2ZU9 A;  1I52 A;  2FFU A;  3D98 A;  4FCU A;  1VZX A;  5FV9 A;  2XWN A;  2O1H A;  4FRM A;  2X5Z A;  2JCK A;  2WVK A;  1H5S B;  3V0N A;  1EYR A;  2FYA A;  3JUK A;  1ZJ3 A;  3JTJ A;  1LZI A;  1R81 A;  1GWW A;  3I0H A;  3CKO A;  3DJ4 A;  1WT3 A;  1FXO A;  5J49 A;  4LW3 A;  1QGS A;  3V0P A;  1S4P A;  1WT0 A;  2BO6 A;  1IIM A;  3IOJ A;  1QGQ A;  5C4F A;  1MP5 A;  3DUV A;  1ZJP A;  4FIY A;  1R7V A;  4FRH A;  4FRB A;  4IRP A;  5FTS A;  3V8Z A;  5HS2 A;  1W55 A;  2RIY A;  4KPZ A;  3U2W A;  3GUE A;  4K6R A;  2YCM A;  2Y4M A;  5C1G A;  2J0A A;  3I0F A;  1G93 A;  2JCL A;  2RJ9 A;  4KC1 A;  4B4M A;  2X60 A;  4E1K A;  3T7M A;  2J0B A;  4G3P A;  5C38 A;  4Q7C A;  4CJC A;  4HO5 A;  1ZDF A;  2Q4J A;  4AYL A;  3OH2 A;  4NAL A;  4P00 A;  4EEG A;  1VPA A;  1R80 A;  2V0L A;  4ECM A;  2I5E A;  4HO2 A;  1FR9 A;  1H5S A;  2XMH A;  1H5R A;  5C4B A;  1ZI4 A;  4D11 C;  3OH4 A;  2ICX A;  3F1Y A;  2AEC A;  5C47 A;  5C48 A;  3ZGG A;  1VZU A;  4LW6 A;  2AM3 A;  3I0I X;  3PKQ A;  1H3M A;  1NMM B;  3SPT A;  2X65 A;  3F1C A;  2WVL A;  1O0R A;  2AGD A;  3SXG A;  1OMX A;  2OEG A;  4B4G A;  4CJB A;  2OI7 A;  1R82 A;  1HM8 A;  1NHE B;  1XZ6 A;  3ZF8 A;  2AE7 A;  1H7E A;  5CQM X;  2P6W A;  1O7O A;  2W0V A;  2YES A;  3U0X A;  1FRW A;  4O6N A;  1LZ0 A;  4D48 A;  4FRQ A;  1W57 A;  1FR8 A;  2VD4 A;  3O3P A;  2A8W A;  2RJ0 A;  1GQC A;  1H5S D;  1ZI5 A;  4FRO A;  2BO7 A;  4NAN A;  3PKP A;  3U2V A;  1ZCT A;  2XWM A;  2JCO A;  4FRE A;  2W0W A;  4BQH A;  2Z86 A;  1INJ A;  1FWY A;  1NWG B;  4FQW A;  1V84 A;  1S4O A;  5CMF X;  2Z87 A;  3ST8 A;  1R7X A;  3CU0 A;  4BMA A;  1R7Y A;  1YP2 A;  3Q7U A;  1EZI A;  2V0H A;  5FUH A;  1ZCY A;  4MND A;  3D8V A;  1R7T A;  3V0O A;  3T7O A;  4MYB A;  1QG8 A;  2WEE A;  3IOI A;  4D0Z A;  2XWL A;  2FYC B;  1MP4 A;  4B4B A;  3SX3 A;  3FWW A;  2GGO A;  1V83 A;  4Y9X A;  1YP4 A;  3RMV A;  2AM4 A;  5CMH A;  1HJJ A;  2C0N A;  5CQP A;  4L41 C;  2RJ8 A;  2V0I A;  2RJ5 A;  1H5R B;  2Y4K A;  3FOQ A;  1O23 B;  5IFY A;  1PZY B;  2ICY A;  1Z90 A;  2ZU7 A;  2D0J A;  4G87 A;  1HV9 A;  3U2T A;  1H7L A;  3I0E A;  3T7N A;  4HO8 A;  4CVH A;  5D92 A;  2WAW A;  4ARW A;  3EE5 A;  3SX5 A;  4EEM A;  5AJN A;  4DEC A;  4AC3 A;  3PNN A;  4R7P A;  1YP3 A;  2PX7 A;  2X5S A;  4B2W A;  3U2X A;  5FTV A;  4XWI A;  4KQL A;  4Y63 A;  2WGZ A;  3ZGF A;  1ZCV A;  1V82 A;  2RJ7 A;  2WVM A;  5C8R A;  2FYB A;  4JIS A;  3LW6 A;  4KT7 A;  3SXE A;  2DPW A;  4EE3 A;  1FXJ A;  3CKN A;  3I0D A;  3R3I A;  4D11 A;  4EE4 A;  1GX0 A;  3SXA A;  1SS9 A;  2Y6P A;  4AYJ A;  2VSH A;  5DDT A;  2GGQ A;  1GX4 A;  5L6S A;  1O7Q A;  2AH9 A;  4EEA A;  4KNX A;  1JYL A;  2YC5 A;  4Y7G A;  1ZHJ A;  4Y62 A;  2O1G A;  1G23 A;  4KRV A;  2NXV A;  1FO9 A;  2VK9 A;  3I0L A;  1ZCU A;  5I1F A;  4EVW A;  2FY7 A;  1H5S C;  1XHB A;  3OKR A;  4G3Q A;  1K4V A;  1JVD A;  5CQL X;  5AJO A;  2RIX A;  3I0G A;  4KPX A;  4KC2 A;  1ON6 A;  4Y6N A;  1FO8 A;  3R2W A;  4J18 A;  1GQ9 A;  1IIN A;  3V90 A;  1ZJ2 A;  4G3S A;  1FGG A;  4KXO A;  5CQO A;  2VS3 A;  2YQC A;  2APC A;  3ZLK A;  5CMJ A;  1JVG A;  5FU8 A;  1H4E A;  5CMI A;  1ZI3 A;  1FG5 N;  4M2A A;  3SXB A;  1E5K A;  1LL2 A;  2V0K A;  1JV1 A;  3K8E A;  1FOA A;  1G2V A;  5FU0 A;  5D91 A;  2WE9 A;  1OQM B;  4D0T A;  2AM5 A;  1GA8 A;  3TQD A;  2OI6 A;  3U0Y A;  4ASY A;  1ZIZ A;  1R7U A;  1G97 A;  3E25 A;  2XME A;  3CKJ A;  3USQ A;  2A8U A;  1LVW A;  2AES A;  1TZF A;  3OC9 A;  1NKH B;  2YQS A;  3D5N A;  1VH1 A;  3I0C A;  1ZJ0 A;  4Y7U A;  3U2U A;  1YRO B;  1H5T A;  2YQJ A;  1H4D A;  1WSZ A;  1W77 A;  3V0L A;  4UEG A;  2Y4J A;  4IRQ A;  2RIT A;  3CGX A;  1FZW A;  2FYD B;  5C4D A;  4HO9 A;  2Y7A A;  2VSI A;  4M28 A;  3OH0 A;  3E26 A;  1TW1 A;  5BXC A;  3ZLL A;  3K8D A;  1NF5 B;  5CQN X;  4CJ8 A;  3TZT A;  3JUJ A;  3OGZ A;  3SX8 A;  4ASJ A;  4GBP A;  5C4E A;  2ZU8 A;  2V0J A;  1GWV A;  3USR A;  2P72 A;  5EJ1 A;  1H7H A;  2BO8 A;  4HCQ A;  2I7B A;  2E3D A;  4Y7F A;  4B5B A;  1VGZ A;  4FRP A;  2I5K A;  5JQQ A;  2JCJ A;  2Y4L A;  4YS8 A;  2D7I A;  3BCV A;  1JYK A;  5EJZ A;  2QGI A;  4HO6 A;  3OH3 A;  3V91 A;  3OH1 A;  1TW5 A;  4B42 A;  5L6V A;  1VGT A;  1LL0 A;  3V0Q A;  1VGU A;  1ON8 A;  4B3U A;  4FCE A;  4HO0 A;  4FRA A;  4NAK A;  1H7Q A;  2D7R A;  2PA4 A;  4FRD A;  4P02 A;  4Y6U A;  1LZ7 A;  5C36 A;  2QH5 A;  1NQI B;  4NAI A;  4Y64 A;  1VH3 A;  4KNR A;  3I0J A;  5IDT A;  1H7T A;  2UX8 A;  3DK5 A;  2FFV A;  1LZJ A;  2CU2 A;  3KIA A;  1G8O A;  1KWS A;  3I0K A;  1ZI1 A;  5CMG X;  1INI A;  3OAM A;  4KC4 A;  4AAW A;  4HG6 A;  5C3D A;  3NGW A;  3V0M A;  1H5T B;  1ZJO A;  2QKX A;  1HM9 A;  2VS4 A;  1MC3 A;  1QWJ A;  5DDV A;  2RIZ A;  2OEF A;  3QVB A;  1H4C A;  3CKQ A;  2E8B A;  5EIY A;  2PGV A;  2RJ4 A;  5C4C A;  2PGY A;  4JD0 A;  4ZDQ A;  4M4K A;  2OI5 A;  1FGX A;  1VGW A;  5C1L A;  3Q4S A;  1HJL A;  3POL A;  3N9W A;  2RJ1 A;  4EEO A;  2YC3 A;  1JV3 A;  5C49 A;  4FIX A;  5AJP A;  1PZT A;  1S4N A;  3CKV A;  4EE5 A;  1G3L A;  4MIX A;  1OMZ A;  1TVY A;  1ZJ1 A;  2O1F A;  2P73 A;  4HOC A;  3RSB A;  4B2X A;  4Y7T A;  3SXC A; 
#chains in the Genus database with same CATH homology
 5C1H A;  1WT2 A;  2RJ6 A;  2VXL A;  1H7F A;  1G0R A;  5IDS A;  1LL3 A;  1G1L A;  1MP3 A;  1ZDG A;  4HO3 A;  2VXM A;  4O6M A;  4DE7 A;  1VZT A;  2VS5 A;  4C2S A;  3RMW A;  3SXD A;  1WT1 A;  3SX7 A;  1HM0 A;  1VIC A;  4FRL A;  2BO4 A;  3IOH A;  2VFZ A;  3BRK X;  3HL3 A;  5C3A A;  5FYE A;  5C3B A;  2YQH A;  3Q80 A;  1VM8 A;  4HO4 A;  2MZB A;  1G95 A;  1G9R A;  4Y7V A;  4DDZ A;  1WVC A;  3V8Y A;  4M2B A;  1H7G A;  2ZU9 A;  1I52 A;  2FFU A;  3D98 A;  4FCU A;  1VZX A;  5FV9 A;  2XWN A;  2O1H A;  4FRM A;  2X5Z A;  2JCK A;  2WVK A;  1H5S B;  3V0N A;  1EYR A;  2FYA A;  3JUK A;  1ZJ3 A;  3JTJ A;  1LZI A;  1R81 A;  1GWW A;  3I0H A;  3CKO A;  3DJ4 A;  1WT3 A;  1FXO A;  5J49 A;  4LW3 A;  1QGS A;  3V0P A;  1S4P A;  1WT0 A;  2BO6 A;  1IIM A;  3IOJ A;  1QGQ A;  5C4F A;  1MP5 A;  3DUV A;  1ZJP A;  4FIY A;  1R7V A;  4FRH A;  4FRB A;  4IRP A;  5FTS A;  3V8Z A;  5HS2 A;  1W55 A;  2RIY A;  4KPZ A;  3U2W A;  3GUE A;  4K6R A;  2YCM A;  2Y4M A;  5C1G A;  2J0A A;  3I0F A;  1G93 A;  2JCL A;  2RJ9 A;  4KC1 A;  4B4M A;  2X60 A;  4E1K A;  3T7M A;  2J0B A;  4G3P A;  5C38 A;  4Q7C A;  4CJC A;  4HO5 A;  1ZDF A;  2Q4J A;  4AYL A;  3OH2 A;  4NAL A;  4P00 A;  4EEG A;  1VPA A;  1R80 A;  2V0L A;  4ECM A;  2I5E A;  4HO2 A;  1FR9 A;  1H5S A;  2XMH A;  1H5R A;  5C4B A;  1ZI4 A;  4D11 C;  3OH4 A;  2ICX A;  3F1Y A;  2AEC A;  5C47 A;  5C48 A;  3ZGG A;  1VZU A;  4LW6 A;  2AM3 A;  3I0I X;  3PKQ A;  1H3M A;  1NMM B;  3SPT A;  2X65 A;  3F1C A;  2WVL A;  1O0R A;  2AGD A;  3SXG A;  1OMX A;  2OEG A;  4B4G A;  4CJB A;  2OI7 A;  1R82 A;  1HM8 A;  1NHE B;  1XZ6 A;  3ZF8 A;  2AE7 A;  1H7E A;  5CQM X;  2P6W A;  1O7O A;  2W0V A;  2YES A;  3U0X A;  1FRW A;  4O6N A;  1LZ0 A;  4D48 A;  4FRQ A;  1W57 A;  1FR8 A;  2VD4 A;  3O3P A;  2A8W A;  2RJ0 A;  1GQC A;  1H5S D;  1ZI5 A;  4FRO A;  2BO7 A;  4NAN A;  3PKP A;  3U2V A;  1ZCT A;  2XWM A;  2JCO A;  4FRE A;  2W0W A;  4BQH A;  2Z86 A;  1INJ A;  1FWY A;  1NWG B;  4FQW A;  1V84 A;  1S4O A;  5CMF X;  2Z87 A;  3ST8 A;  1R7X A;  3CU0 A;  4BMA A;  1R7Y A;  1YP2 A;  3Q7U A;  1EZI A;  2V0H A;  5FUH A;  1ZCY A;  4MND A;  3D8V A;  1R7T A;  3V0O A;  3T7O A;  4MYB A;  1QG8 A;  2WEE A;  3IOI A;  4D0Z A;  2XWL A;  2FYC B;  1MP4 A;  4B4B A;  3SX3 A;  3FWW A;  2GGO A;  1V83 A;  4Y9X A;  1YP4 A;  3RMV A;  2AM4 A;  5CMH A;  1HJJ A;  2C0N A;  5CQP A;  4L41 C;  2RJ8 A;  2V0I A;  2RJ5 A;  1H5R B;  2Y4K A;  3FOQ A;  1O23 B;  5IFY A;  1PZY B;  2ICY A;  1Z90 A;  2ZU7 A;  2D0J A;  4G87 A;  1HV9 A;  3U2T A;  1H7L A;  3I0E A;  3T7N A;  4HO8 A;  4CVH A;  5D92 A;  2WAW A;  4ARW A;  3EE5 A;  3SX5 A;  4EEM A;  5AJN A;  4DEC A;  4AC3 A;  3PNN A;  4R7P A;  1YP3 A;  2PX7 A;  2X5S A;  4B2W A;  3U2X A;  5FTV A;  4XWI A;  4KQL A;  4Y63 A;  2WGZ A;  3ZGF A;  1ZCV A;  1V82 A;  2RJ7 A;  2WVM A;  5C8R A;  2FYB A;  4JIS A;  3LW6 A;  4KT7 A;  3SXE A;  2DPW A;  4EE3 A;  1FXJ A;  3CKN A;  3I0D A;  3R3I A;  4D11 A;  4EE4 A;  1GX0 A;  3SXA A;  1SS9 A;  2Y6P A;  4AYJ A;  2VSH A;  5DDT A;  2GGQ A;  1GX4 A;  5L6S A;  1O7Q A;  2AH9 A;  4EEA A;  4KNX A;  1JYL A;  2YC5 A;  4Y7G A;  1ZHJ A;  4Y62 A;  2O1G A;  1G23 A;  4KRV A;  2NXV A;  1FO9 A;  2VK9 A;  3I0L A;  1ZCU A;  5I1F A;  4EVW A;  2FY7 A;  1H5S C;  1XHB A;  3OKR A;  4G3Q A;  1K4V A;  1JVD A;  5CQL X;  5AJO A;  2RIX A;  3I0G A;  4KPX A;  4KC2 A;  1ON6 A;  4Y6N A;  1FO8 A;  3R2W A;  4J18 A;  1GQ9 A;  1IIN A;  3V90 A;  1ZJ2 A;  4G3S A;  1FGG A;  4KXO A;  5CQO A;  2VS3 A;  2YQC A;  2APC A;  3ZLK A;  5CMJ A;  1JVG A;  5FU8 A;  1H4E A;  5CMI A;  1ZI3 A;  1FG5 N;  4M2A A;  3SXB A;  1E5K A;  1LL2 A;  2V0K A;  1JV1 A;  3K8E A;  1FOA A;  1G2V A;  5FU0 A;  5D91 A;  2WE9 A;  1OQM B;  4D0T A;  2AM5 A;  1GA8 A;  3TQD A;  2OI6 A;  3U0Y A;  4ASY A;  1ZIZ A;  1R7U A;  1G97 A;  3E25 A;  2XME A;  3CKJ A;  3USQ A;  2A8U A;  1LVW A;  2AES A;  1TZF A;  3OC9 A;  1NKH B;  2YQS A;  3D5N A;  1VH1 A;  3I0C A;  1ZJ0 A;  4Y7U A;  3U2U A;  1YRO B;  1H5T A;  2YQJ A;  1H4D A;  1WSZ A;  1W77 A;  3V0L A;  4UEG A;  2Y4J A;  4IRQ A;  2RIT A;  3CGX A;  1FZW A;  2FYD B;  5C4D A;  4HO9 A;  2Y7A A;  2VSI A;  4M28 A;  3OH0 A;  3E26 A;  1TW1 A;  5BXC A;  3ZLL A;  3K8D A;  1NF5 B;  5CQN X;  4CJ8 A;  3TZT A;  3JUJ A;  3OGZ A;  3SX8 A;  4ASJ A;  4GBP A;  5C4E A;  2ZU8 A;  2V0J A;  1GWV A;  3USR A;  2P72 A;  5EJ1 A;  1H7H A;  2BO8 A;  4HCQ A;  2I7B A;  2E3D A;  4Y7F A;  4B5B A;  1VGZ A;  4FRP A;  2I5K A;  5JQQ A;  2JCJ A;  2Y4L A;  4YS8 A;  2D7I A;  3BCV A;  1JYK A;  5EJZ A;  2QGI A;  4HO6 A;  3OH3 A;  3V91 A;  3OH1 A;  1TW5 A;  4B42 A;  5L6V A;  1VGT A;  1LL0 A;  3V0Q A;  1VGU A;  1ON8 A;  4B3U A;  4FCE A;  4HO0 A;  4FRA A;  4NAK A;  1H7Q A;  2D7R A;  2PA4 A;  4FRD A;  4P02 A;  4Y6U A;  1LZ7 A;  5C36 A;  2QH5 A;  1NQI B;  4NAI A;  4Y64 A;  1VH3 A;  4KNR A;  3I0J A;  5IDT A;  1H7T A;  2UX8 A;  3DK5 A;  2FFV A;  1LZJ A;  2CU2 A;  3KIA A;  1G8O A;  1KWS A;  3I0K A;  1ZI1 A;  5CMG X;  1INI A;  3OAM A;  4KC4 A;  4AAW A;  4HG6 A;  5C3D A;  3NGW A;  3V0M A;  1H5T B;  1ZJO A;  2QKX A;  1HM9 A;  2VS4 A;  1MC3 A;  1QWJ A;  5DDV A;  2RIZ A;  2OEF A;  3QVB A;  1H4C A;  3CKQ A;  2E8B A;  5EIY A;  2PGV A;  2RJ4 A;  5C4C A;  2PGY A;  4JD0 A;  4ZDQ A;  4M4K A;  2OI5 A;  1FGX A;  1VGW A;  5C1L A;  3Q4S A;  1HJL A;  3POL A;  3N9W A;  2RJ1 A;  4EEO A;  2YC3 A;  1JV3 A;  5C49 A;  4FIX A;  5AJP A;  1PZT A;  1S4N A;  3CKV A;  4EE5 A;  1G3L A;  4MIX A;  1OMZ A;  1TVY A;  1ZJ1 A;  2O1F A;  2P73 A;  4HOC A;  3RSB A;  4B2X A;  4Y7T A;  3SXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...