4Y63A

Aaglyb in complex with amino-acid analogues
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
282
structure length
282
Chain Sequence
VSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYGGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histo-blood group ABO system transferase
publication title Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 97
structure length 282
sequence length 282
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2015-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03414 Glyco_transf_6 Glycosyltransferase family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4y63A00
3V0QA 1HM0A 3CKVA 2YQCA 4FRAA 1K4VA 5FTSA 1FO8A 1GX0A 4EE4A 4KC4A 4B2XA 4JISA 4EEOA 1QWJA 2P72A 4KXOA 1ZJ0A 4G3PA 1I52A 3R3IA 4KNRA 2ZU9A 5I1FA 1WT0A 3Q7UA 4EEMA 1GWVA 2Z86A 2Y7AA 1H7TA 4P00A 2CU2A 1FXOA 1O0RA 3CU0A 3T7NA 3CKNA 2VFZA 4G87A 2OEGA 3E26A 4B3UA 2VS3A 1R82A 3KIAA 1FRWA 1VZTA 4NANA 2RJ0A 3JUKA 2X5ZA 1VH3A 3ZF8A 5FU8A 5IFYA 2BO8A 3QVBA 5C4CA 4G3SA 4G3QA 5C1HA 3T7OA 4FRBA 4FRLA 4BMAA 1ZI5A 1R80A 1V84A 1WT3A 4P02A 2JCJA 3FWWA 2YQSA 5CQLX 2Z87A 2GGQA 2YCMA 4K6RA 2AM4A 4D48A 1NHEB 2V0KA 5C1LA 1OMZA 2RJ7A 3V91A 4D11C 3K8EA 2BO4A 4KT7A 2O1FA 5C4FA 2XMEA 3IOJA 1ON8A 3NGWA 1R7XA 1INIA 2RITA 1WT1A 4Y7UA 1JYKA 1H4DA 4E1KA 4EEAA 5IDSA 1ZIZA 3E25A 3JUJA 1NF5B 4ARWA 1QGSA 3CGXA 2RJ1A 4YS8A 1H5TA 4B4MA 4LW3A 4FROA 3JTJA 1VGUA 3LW6A 2VSIA 5C3BA 1H5SD 2O1HA 2FFVA 4DECA 3U2XA 4AAWA 2AESA 1R81A 1G9RA 5BXCA 1ZJ2A 2YC3A 2QH5A 1ZCVA 4KPZA 4KRVA 3SXDA 1H5TB 3BCVA 1GWWA 1G1LA 5AJOA 5CMGX 4EE3A 4FCEA 2AH9A 1V83A 5L6SA 1LZJA 2V0IA 4MNDA 2QGIA 2V0JA 1R7TA 5C3DA 4ZDQA 5C47A 3U0YA 1HM8A 4FRHA 1YP2A 2ZU7A 1MP3A 1G0RA 2VS4A 1TW1A 1JV1A 2E3DA 2I7BA 3Q4SA 4GBPA 2RIXA 3R2WA 4KNXA 3SXCA 4D0ZA 1MP5A 4UEGA 3ZLKA 3PNNA 3OC9A 2QKXA 1KWSA 4KQLA 4MYBA 4CJBA 5C3AA 5C4DA 3DJ4A 1G8OA 1V82A 2FY7A 1W55A 3SX7A 1H5SA 3I0KA 1QGQA 4AYLA 3F1CA 3SX8A 1ZCTA 3USRA 1NWGB 2WE9A 3OH1A 1EYRA 2P6WA 4JD0A 1FO9A 3EE5A 4FRPA 3SX5A 1H5SB 1H7GA 1H3MA 2O1GA 2Q4JA 3PKQA 4FREA 2RJ9A 1VGZA 3V0OA 1GA8A 1VZUA 2PGYA 2A8UA 1LZ0A 3SX3A 1INJA 2RJ4A 3OGZA 2YQJA 4LW6A 1HJJA 4DDZA 2A8WA 3TZTA 2D7RA 2Y4JA 3I0JA 4ASYA 2MZBA 1ZCUA 4Y6UA 4EEGA 1EZIA 5FV9A 3Q80A 3USQA 1H7FA 1FZWA 1VH1A 1H5RA 2X60A 3I0IX 4M2AA 4Y64A 1QG8A 3D5NA 4HO2A 5DDTA 5CMFX 4NALA 3DUVA 1IINA 1G97A 3FOQA 4B42A 2UX8A 5IDTA 5C1GA 4BQHA 1G95A 4KC1A 5FUHA 1ZDGA 1VGWA 2AGDA 3T7MA 1G93A 3V90A 1LL2A 1H5RB 4Y7VA 5CQOA 3OAMA 3V0LA 5C38A 5EJZA 1YP4A 4XWIA 2FFUA 1TZFA 3I0FA 2RJ5A 3CKQA 3K8DA 2BO7A 2E8BA 4M2BA 2OI6A 2DPWA 3U2TA 3CKJA 4FRDA 5CQPA 1VICA 4M28A 4Y6NA 5CQMX 2P73A 5C36A 2VD4A 5JQQA 1NQIB 1H4EA 1LZ7A 1LZIA 4EE5A 2RJ8A 4FRMA 4FRQA 1H5SC 3RMVA 5C48A 1H4CA 3CKOA 1MC3A 3SXGA 1ZJ1A 2WVLA 4B4GA 4HO9A 2PA4A 2APCA 1VGTA 1ZI3A 4HO6A 1LL3A 4EVWA 3U2UA 1O23B 4HO0A 1TVYA 2VSHA 2YC5A 3BRKX 5CMIA 1H7EA 2D7IA 2I5EA 2V0LA 3DK5A 3PKPA 4HG6A 4Y63A 1ZJ3A 2W0WA 1VPAA 1ZI4A 3GUEA 4HO8A 3N9WA 2VXMA 1FR9A 1NMMB 2PGVA 2XWMA 1R7VA 2ZU8A 2D0JA 4KC2A 4HCQA 4FCUA 2RJ6A 2RIZA 1G3LA 3D98A 3SPTA 4HO4A 4NAIA 3I0HA 1LVWA 4C2SA 3I0CA 5J49A 1TW5A 1WVCA 4CJ8A 1HV9A 1VZXA 3SXEA 2AM5A 4D0TA 3HL3A 2XMHA 2FYDB 2Y4MA 2ICXA 3IOHA 5CMHA 4FQWA 4B2WA 2ICYA 5EJ1A 4Y7GA 5C4BA 4Y9XA 1OQMB 4IRPA 5DDVA 1FR8A 2XWNA 5AJPA 1ZI1A 3V8YA 1JVDA 1JVGA 1G23A 2JCOA 2WVKA 2BO6A 4ECMA 4J18A 2RIYA 4L41C 1WT2A 1HM9A 2WGZA 1JV3A 3I0DA 1G2VA 1FG5N 2AM3A 4NAKA 4Y7TA 1ZDFA 1WSZA 2GGOA 1FGXA 2OI5A 3D8VA 1HJLA 3OH0A 4ASJA 4AYJA 1LL0A 4M4KA 1GX4A 1GQ9A 3POLA 5FU0A 5FTVA 5EIYA 2OEFA 2WAWA 1NKHB 1H7HA 1S4NA 5C4EA 2X65A 4HOCA 1FWYA 4HO5A 3RMWA 3V0MA 3I0GA 1ZJPA 2WVMA 1XZ6A 1MP4A 1H7QA 4CJCA 2V0HA 2Y6PA 5C8RA 1PZTA 4HO3A 5L6VA 2YESA 2WEEA 3V0PA 3U2WA 1IIMA 1Z90A 5C49A 1XHBA 4KPXA 1ON6A 3TQDA 1R7UA 5CMJA 2PX7A 3OH3A 3OH4A 3V0NA 2I5KA 5FYEA 1OMXA 2FYAA 2JCLA 1SS9A 2NXVA 1FXJA 1VM8A 2VS5A 1R7YA 1H7LA 3ZGFA 3SXAA 1O7QA 2YQHA 1FOAA 2XWLA 5AJNA 3ST8A 1E5KA 1GQCA 1JYLA 2FYCB 3ZLLA 3OH2A 4Y7FA 4Y62A 2VXLA 1S4OA 1PZYB 4AC3A 3F1YA 1S4PA 1ZCYA 3U2VA 2AE7A 2FYBA 5CQNX 5HS2A 3U0XA 1FGGA 3IOIA 2Y4LA 3I0LA 1W57A 2AECA 3SXBA 4CVHA 3O3PA 4R7PA 2X5SA 2JCKA 1YP3A 3ZGGA 2Y4KA 4IRQA 4D11A 1O7OA 2OI7A 3I0EA 4DE7A 1YROB 3OKRA 2W0VA 1ZJOA 3V8ZA 4B4BA 4B5BA 3RSBA 1W77A 1ZHJA
chains in the Genus database with same CATH superfamily
3V0QA 1HM0A 3CKVA 2YQCA 4FRAA 1K4VA 5FTSA 1FO8A 1GX0A 4EE4A 4KC4A 4B2XA 4JISA 4EEOA 1QWJA 2P72A 4KXOA 1ZJ0A 4G3PA 1I52A 3R3IA 4KNRA 2ZU9A 5I1FA 1WT0A 3Q7UA 4EEMA 1GWVA 2Z86A 2Y7AA 1H7TA 4P00A 2CU2A 1FXOA 1O0RA 3CU0A 5D92A 3T7NA 3CKNA 2VFZA 4G87A 2OEGA 3E26A 4B3UA 2VS3A 1R82A 3KIAA 1FRWA 1VZTA 4NANA 2RJ0A 3JUKA 2X5ZA 1VH3A 3ZF8A 5FU8A 5IFYA 2BO8A 3QVBA 5C4CA 4G3SA 4G3QA 5C1HA 3T7OA 4FRBA 4FRLA 4BMAA 1ZI5A 1R80A 1V84A 1WT3A 4P02A 2JCJA 3FWWA 2YQSA 5CQLX 2Z87A 2GGQA 2YCMA 4K6RA 2AM4A 4D48A 1NHEB 2V0KA 5C1LA 1OMZA 2RJ7A 3V91A 4D11C 3K8EA 2BO4A 4KT7A 2O1FA 5C4FA 2XMEA 3IOJA 1ON8A 3NGWA 1R7XA 1INIA 2RITA 1WT1A 4Y7UA 1JYKA 1H4DA 4E1KA 4EEAA 5IDSA 1ZIZA 3E25A 3JUJA 1NF5B 4ARWA 1QGSA 3CGXA 2RJ1A 4YS8A 1H5TA 4B4MA 4LW3A 4FROA 3JTJA 1VGUA 3LW6A 2VSIA 5C3BA 1H5SD 2O1HA 2FFVA 4DECA 3U2XA 4AAWA 2AESA 1R81A 1G9RA 5BXCA 1ZJ2A 2YC3A 2QH5A 1ZCVA 4KPZA 4KRVA 3SXDA 1H5TB 3BCVA 1GWWA 1G1LA 5AJOA 5CMGX 4EE3A 4FCEA 2AH9A 1V83A 5L6SA 1LZJA 2V0IA 4MNDA 2QGIA 2V0JA 1R7TA 5C3DA 4ZDQA 5C47A 3U0YA 1HM8A 4FRHA 1YP2A 2ZU7A 1MP3A 1G0RA 2VS4A 1TW1A 1JV1A 2E3DA 2I7BA 3Q4SA 4GBPA 2RIXA 3R2WA 4KNXA 5D91A 3SXCA 4D0ZA 1MP5A 4UEGA 3ZLKA 3PNNA 3OC9A 2VK9A 2QKXA 1KWSA 4KQLA 4MYBA 4CJBA 5C3AA 5C4DA 4MIXA 3DJ4A 1G8OA 1V82A 2FY7A 1W55A 3SX7A 1H5SA 3I0KA 1QGQA 4AYLA 3F1CA 3SX8A 1ZCTA 3USRA 1NWGB 2WE9A 3OH1A 1EYRA 2P6WA 4JD0A 1FO9A 3EE5A 4FRPA 3SX5A 1H5SB 1H7GA 1H3MA 2O1GA 4Q7CA 2Q4JA 3PKQA 4FREA 2RJ9A 1VGZA 3V0OA 1GA8A 1VZUA 2PGYA 2A8UA 1LZ0A 3SX3A 1INJA 2RJ4A 3OGZA 2YQJA 4LW6A 1HJJA 4DDZA 2A8WA 3TZTA 2D7RA 4O6NA 2Y4JA 3I0JA 4ASYA 2MZBA 1ZCUA 4Y6UA 4EEGA 1EZIA 5FV9A 3Q80A 3USQA 1H7FA 1FZWA 1VH1A 1H5RA 2X60A 3I0IX 4M2AA 4Y64A 1QG8A 3D5NA 4HO2A 5DDTA 5CMFX 4NALA 3DUVA 1IINA 1G97A 4O6MA 3FOQA 4B42A 2UX8A 5IDTA 5C1GA 4BQHA 1G95A 4KC1A 5FUHA 1ZDGA 1VGWA 2AGDA 2C0NA 3T7MA 1G93A 3V90A 1LL2A 1H5RB 4Y7VA 5CQOA 3OAMA 3V0LA 5C38A 5EJZA 1YP4A 4XWIA 2FFUA 1TZFA 3I0FA 2RJ5A 4FIXA 3CKQA 3K8DA 2BO7A 2E8BA 4M2BA 2OI6A 2DPWA 3U2TA 3CKJA 4FRDA 5CQPA 1VICA 4M28A 4Y6NA 5CQMX 2P73A 5C36A 2VD4A 5JQQA 1NQIB 1H4EA 1LZ7A 2J0AA 1LZIA 4EE5A 2J0BA 2RJ8A 4FRMA 4FRQA 1H5SC 3RMVA 5C48A 1H4CA 3CKOA 1MC3A 3SXGA 1ZJ1A 2WVLA 4B4GA 4HO9A 2PA4A 2APCA 1VGTA 1ZI3A 4HO6A 1LL3A 4EVWA 3U2UA 1O23B 4HO0A 1TVYA 2VSHA 2YC5A 3BRKX 5CMIA 1H7EA 2D7IA 2I5EA 2V0LA 3DK5A 3PKPA 4HG6A 4Y63A 1ZJ3A 4FIYA 2W0WA 1VPAA 1ZI4A 3GUEA 4HO8A 3N9WA 2VXMA 1FR9A 1NMMB 2PGVA 2XWMA 1R7VA 2ZU8A 2D0JA 4KC2A 4HCQA 4FCUA 2RJ6A 2RIZA 1G3LA 3D98A 3SPTA 4HO4A 4NAIA 3I0HA 1LVWA 4C2SA 3I0CA 5J49A 1TW5A 1WVCA 4CJ8A 1HV9A 1VZXA 3SXEA 2AM5A 4D0TA 3HL3A 2XMHA 2FYDB 2Y4MA 2ICXA 3IOHA 5CMHA 4FQWA 4B2WA 2ICYA 5EJ1A 4Y7GA 5C4BA 4Y9XA 1OQMB 4IRPA 5DDVA 1FR8A 2XWNA 5AJPA 1ZI1A 3V8YA 1JVDA 1JVGA 1G23A 2JCOA 2WVKA 2BO6A 4ECMA 4J18A 2RIYA 4L41C 1WT2A 1HM9A 2WGZA 1JV3A 3I0DA 1G2VA 1FG5N 2AM3A 4NAKA 4Y7TA 1ZDFA 1WSZA 2GGOA 1FGXA 2OI5A 3D8VA 1HJLA 3OH0A 4ASJA 4AYJA 1LL0A 4M4KA 1GX4A 1GQ9A 3POLA 5FU0A 5FTVA 5EIYA 2OEFA 2WAWA 1NKHB 1H7HA 1S4NA 5C4EA 2X65A 4HOCA 1FWYA 4HO5A 3RMWA 3V0MA 3I0GA 1ZJPA 2WVMA 1XZ6A 1MP4A 1H7QA 4CJCA 2V0HA 2Y6PA 5C8RA 1PZTA 4HO3A 5L6VA 2YESA 2WEEA 3V0PA 3U2WA 1IIMA 1Z90A 5C49A 1XHBA 4KPXA 1ON6A 3TQDA 1R7UA 5CMJA 2PX7A 3OH3A 3OH4A 3V0NA 2I5KA 5FYEA 1OMXA 2FYAA 2JCLA 1SS9A 2NXVA 1FXJA 1VM8A 2VS5A 1R7YA 1H7LA 3ZGFA 3SXAA 1O7QA 2YQHA 1FOAA 2XWLA 5AJNA 3ST8A 1E5KA 1GQCA 1JYLA 2FYCB 3ZLLA 3OH2A 4Y7FA 4Y62A 2VXLA 1S4OA 1PZYB 4AC3A 3F1YA 1S4PA 1ZCYA 3U2VA 2AE7A 2FYBA 5CQNX 5HS2A 3U0XA 1FGGA 3IOIA 2Y4LA 3I0LA 1W57A 2AECA 3SXBA 4CVHA 3O3PA 4R7PA 2X5SA 2JCKA 1YP3A 3ZGGA 2Y4KA 4IRQA 4D11A 1O7OA 2OI7A 3I0EA 4DE7A 1YROB 3OKRA 2W0VA 1ZJOA 3V8ZA 4B4BA 4B5BA 3RSBA 1W77A 1ZHJA
chains in the Genus database with same CATH topology
3V0QA 1HM0A 3CKVA 2YQCA 4FRAA 1K4VA 5FTSA 1FO8A 1GX0A 4EE4A 4KC4A 4B2XA 4JISA 4EEOA 1QWJA 2P72A 4KXOA 1ZJ0A 4G3PA 1I52A 3R3IA 4KNRA 2ZU9A 5I1FA 1WT0A 3Q7UA 4EEMA 1GWVA 2Z86A 2Y7AA 1H7TA 4P00A 2CU2A 1FXOA 1O0RA 3CU0A 5D92A 3T7NA 3CKNA 2VFZA 4G87A 2OEGA 3E26A 4B3UA 2VS3A 1R82A 3KIAA 1FRWA 1VZTA 4NANA 2RJ0A 3JUKA 2X5ZA 1VH3A 3ZF8A 5FU8A 5IFYA 2BO8A 3QVBA 5C4CA 4G3SA 4G3QA 5C1HA 3T7OA 4FRBA 4FRLA 4BMAA 1ZI5A 1R80A 1V84A 1WT3A 4P02A 2JCJA 3FWWA 2YQSA 5CQLX 2Z87A 2GGQA 2YCMA 4K6RA 2AM4A 4D48A 1NHEB 2V0KA 5C1LA 1OMZA 2RJ7A 3V91A 4D11C 3K8EA 2BO4A 4KT7A 2O1FA 5C4FA 2XMEA 3IOJA 1ON8A 3NGWA 1R7XA 1INIA 2RITA 1WT1A 4Y7UA 1JYKA 1H4DA 4E1KA 4EEAA 5IDSA 1ZIZA 3E25A 3JUJA 1NF5B 4ARWA 1QGSA 3CGXA 2RJ1A 4YS8A 1H5TA 4B4MA 4LW3A 4FROA 3JTJA 1VGUA 3LW6A 2VSIA 5C3BA 1H5SD 2O1HA 2FFVA 4DECA 3U2XA 4AAWA 2AESA 1R81A 1G9RA 5BXCA 1ZJ2A 2YC3A 2QH5A 1ZCVA 4KPZA 4KRVA 3SXDA 1H5TB 3BCVA 1GWWA 1G1LA 5AJOA 5CMGX 4EE3A 4FCEA 2AH9A 1V83A 5L6SA 1LZJA 2V0IA 4MNDA 2QGIA 2V0JA 1R7TA 5C3DA 4ZDQA 5C47A 3U0YA 1HM8A 4FRHA 1YP2A 2ZU7A 1MP3A 1G0RA 2VS4A 1TW1A 1JV1A 2E3DA 2I7BA 3Q4SA 4GBPA 2RIXA 3R2WA 4KNXA 5D91A 3SXCA 4D0ZA 1MP5A 4UEGA 3ZLKA 3PNNA 3OC9A 2VK9A 2QKXA 1KWSA 4KQLA 4MYBA 4CJBA 5C3AA 5C4DA 4MIXA 3DJ4A 1G8OA 1V82A 2FY7A 1W55A 3SX7A 1H5SA 3I0KA 1QGQA 4AYLA 3F1CA 3SX8A 1ZCTA 3USRA 1NWGB 2WE9A 3OH1A 1EYRA 2P6WA 4JD0A 1FO9A 3EE5A 4FRPA 3SX5A 1H5SB 1H7GA 1H3MA 2O1GA 4Q7CA 2Q4JA 3PKQA 4FREA 2RJ9A 1VGZA 3V0OA 1GA8A 1VZUA 2PGYA 2A8UA 1LZ0A 3SX3A 1INJA 2RJ4A 3OGZA 2YQJA 4LW6A 1HJJA 4DDZA 2A8WA 3TZTA 2D7RA 4O6NA 2Y4JA 3I0JA 4ASYA 2MZBA 1ZCUA 4Y6UA 4EEGA 1EZIA 5FV9A 3Q80A 3USQA 1H7FA 1FZWA 1VH1A 1H5RA 2X60A 3I0IX 4M2AA 4Y64A 1QG8A 3D5NA 4HO2A 5DDTA 5CMFX 4NALA 3DUVA 1IINA 1G97A 4O6MA 3FOQA 4B42A 2UX8A 5IDTA 5C1GA 4BQHA 1G95A 4KC1A 5FUHA 1ZDGA 1VGWA 2AGDA 2C0NA 3T7MA 1G93A 3V90A 1LL2A 1H5RB 4Y7VA 5CQOA 3OAMA 3V0LA 5C38A 5EJZA 1YP4A 4XWIA 2FFUA 1TZFA 3I0FA 2RJ5A 4FIXA 3CKQA 3K8DA 2BO7A 2E8BA 4M2BA 2OI6A 2DPWA 3U2TA 3CKJA 4FRDA 5CQPA 1VICA 4M28A 4Y6NA 5CQMX 2P73A 5C36A 2VD4A 5JQQA 1NQIB 1H4EA 1LZ7A 2J0AA 1LZIA 4EE5A 2J0BA 2RJ8A 4FRMA 4FRQA 1H5SC 3RMVA 5C48A 1H4CA 3CKOA 1MC3A 3SXGA 1ZJ1A 2WVLA 4B4GA 4HO9A 2PA4A 2APCA 1VGTA 1ZI3A 4HO6A 1LL3A 4EVWA 3U2UA 1O23B 4HO0A 1TVYA 2VSHA 2YC5A 3BRKX 5CMIA 1H7EA 2D7IA 2I5EA 2V0LA 3DK5A 3PKPA 4HG6A 4Y63A 1ZJ3A 4FIYA 2W0WA 1VPAA 1ZI4A 3GUEA 4HO8A 3N9WA 2VXMA 1FR9A 1NMMB 2PGVA 2XWMA 1R7VA 2ZU8A 2D0JA 4KC2A 4HCQA 4FCUA 2RJ6A 2RIZA 1G3LA 3D98A 3SPTA 4HO4A 4NAIA 3I0HA 1LVWA 4C2SA 3I0CA 5J49A 1TW5A 1WVCA 4CJ8A 1HV9A 1VZXA 3SXEA 2AM5A 4D0TA 3HL3A 2XMHA 2FYDB 2Y4MA 2ICXA 3IOHA 5CMHA 4FQWA 4B2WA 2ICYA 5EJ1A 4Y7GA 5C4BA 4Y9XA 1OQMB 4IRPA 5DDVA 1FR8A 2XWNA 5AJPA 1ZI1A 3V8YA 1JVDA 1JVGA 1G23A 2JCOA 2WVKA 2BO6A 4ECMA 4J18A 2RIYA 4L41C 1WT2A 1HM9A 2WGZA 1JV3A 3I0DA 1G2VA 1FG5N 2AM3A 4NAKA 4Y7TA 1ZDFA 1WSZA 2GGOA 1FGXA 2OI5A 3D8VA 1HJLA 3OH0A 4ASJA 4AYJA 1LL0A 4M4KA 1GX4A 1GQ9A 3POLA 5FU0A 5FTVA 5EIYA 2OEFA 2WAWA 1NKHB 1H7HA 1S4NA 5C4EA 2X65A 4HOCA 1FWYA 4HO5A 3RMWA 3V0MA 3I0GA 1ZJPA 2WVMA 1XZ6A 1MP4A 1H7QA 4CJCA 2V0HA 2Y6PA 5C8RA 1PZTA 4HO3A 5L6VA 2YESA 2WEEA 3V0PA 3U2WA 1IIMA 1Z90A 5C49A 1XHBA 4KPXA 1ON6A 3TQDA 1R7UA 5CMJA 2PX7A 3OH3A 3OH4A 3V0NA 2I5KA 5FYEA 1OMXA 2FYAA 2JCLA 1SS9A 2NXVA 1FXJA 1VM8A 2VS5A 1R7YA 1H7LA 3ZGFA 3SXAA 1O7QA 2YQHA 1FOAA 2XWLA 5AJNA 3ST8A 1E5KA 1GQCA 1JYLA 2FYCB 3ZLLA 3OH2A 4Y7FA 4Y62A 2VXLA 1S4OA 1PZYB 4AC3A 3F1YA 1S4PA 1ZCYA 3U2VA 2AE7A 2FYBA 5CQNX 5HS2A 3U0XA 1FGGA 3IOIA 2Y4LA 3I0LA 1W57A 2AECA 3SXBA 4CVHA 3O3PA 4R7PA 2X5SA 2JCKA 1YP3A 3ZGGA 2Y4KA 4IRQA 4D11A 1O7OA 2OI7A 3I0EA 4DE7A 1YROB 3OKRA 2W0VA 1ZJOA 3V8ZA 4B4BA 4B5BA 3RSBA 1W77A 1ZHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V0Q A;  1HM0 A;  3CKV A;  2YQC A;  4FRA A;  1K4V A;  5FTS A;  1FO8 A;  1GX0 A;  4EE4 A;  4KC4 A;  4B2X A;  4JIS A;  4EEO A;  1QWJ A;  2P72 A;  4KXO A;  1ZJ0 A;  4G3P A;  1I52 A;  3R3I A;  4KNR A;  2ZU9 A;  5I1F A;  1WT0 A;  3Q7U A;  4EEM A;  1GWV A;  2Z86 A;  2Y7A A;  1H7T A;  4P00 A;  2CU2 A;  1FXO A;  1O0R A;  3CU0 A;  3T7N A;  3CKN A;  2VFZ A;  4G87 A;  2OEG A;  3E26 A;  4B3U A;  2VS3 A;  1R82 A;  3KIA A;  1FRW A;  1VZT A;  4NAN A;  2RJ0 A;  3JUK A;  2X5Z A;  1VH3 A;  3ZF8 A;  5FU8 A;  5IFY A;  2BO8 A;  3QVB A;  5C4C A;  4G3S A;  4G3Q A;  5C1H A;  3T7O A;  4FRB A;  4FRL A;  4BMA A;  1ZI5 A;  1R80 A;  1V84 A;  1WT3 A;  4P02 A;  2JCJ A;  3FWW A;  2YQS A;  5CQL X;  2Z87 A;  2GGQ A;  2YCM A;  4K6R A;  2AM4 A;  4D48 A;  1NHE B;  2V0K A;  5C1L A;  1OMZ A;  2RJ7 A;  3V91 A;  4D11 C;  3K8E A;  2BO4 A;  4KT7 A;  2O1F A;  5C4F A;  2XME A;  3IOJ A;  1ON8 A;  3NGW A;  1R7X A;  1INI A;  2RIT A;  1WT1 A;  4Y7U A;  1JYK A;  1H4D A;  4E1K A;  4EEA A;  5IDS A;  1ZIZ A;  3E25 A;  3JUJ A;  1NF5 B;  4ARW A;  1QGS A;  3CGX A;  2RJ1 A;  4YS8 A;  1H5T A;  4B4M A;  4LW3 A;  4FRO A;  3JTJ A;  1VGU A;  3LW6 A;  2VSI A;  5C3B A;  1H5S D;  2O1H A;  2FFV A;  4DEC A;  3U2X A;  4AAW A;  2AES A;  1R81 A;  1G9R A;  5BXC A;  1ZJ2 A;  2YC3 A;  2QH5 A;  1ZCV A;  4KPZ A;  4KRV A;  3SXD A;  1H5T B;  3BCV A;  1GWW A;  1G1L A;  5AJO A;  5CMG X;  4EE3 A;  4FCE A;  2AH9 A;  1V83 A;  5L6S A;  1LZJ A;  2V0I A;  4MND A;  2QGI A;  2V0J A;  1R7T A;  5C3D A;  4ZDQ A;  5C47 A;  3U0Y A;  1HM8 A;  4FRH A;  1YP2 A;  2ZU7 A;  1MP3 A;  1G0R A;  2VS4 A;  1TW1 A;  1JV1 A;  2E3D A;  2I7B A;  3Q4S A;  4GBP A;  2RIX A;  3R2W A;  4KNX A;  3SXC A;  4D0Z A;  1MP5 A;  4UEG A;  3ZLK A;  3PNN A;  3OC9 A;  2QKX A;  1KWS A;  4KQL A;  4MYB A;  4CJB A;  5C3A A;  5C4D A;  3DJ4 A;  1G8O A;  1V82 A;  2FY7 A;  1W55 A;  3SX7 A;  1H5S A;  3I0K A;  1QGQ A;  4AYL A;  3F1C A;  3SX8 A;  1ZCT A;  3USR A;  1NWG B;  2WE9 A;  3OH1 A;  1EYR A;  2P6W A;  4JD0 A;  1FO9 A;  3EE5 A;  4FRP A;  3SX5 A;  1H5S B;  1H7G A;  1H3M A;  2O1G A;  2Q4J A;  3PKQ A;  4FRE A;  2RJ9 A;  1VGZ A;  3V0O A;  1GA8 A;  1VZU A;  2PGY A;  2A8U A;  1LZ0 A;  3SX3 A;  1INJ A;  2RJ4 A;  3OGZ A;  2YQJ A;  4LW6 A;  1HJJ A;  4DDZ A;  2A8W A;  3TZT A;  2D7R A;  2Y4J A;  3I0J A;  4ASY A;  2MZB A;  1ZCU A;  4Y6U A;  4EEG A;  1EZI A;  5FV9 A;  3Q80 A;  3USQ A;  1H7F A;  1FZW A;  1VH1 A;  1H5R A;  2X60 A;  3I0I X;  4M2A A;  4Y64 A;  1QG8 A;  3D5N A;  4HO2 A;  5DDT A;  5CMF X;  4NAL A;  3DUV A;  1IIN A;  1G97 A;  3FOQ A;  4B42 A;  2UX8 A;  5IDT A;  5C1G A;  4BQH A;  1G95 A;  4KC1 A;  5FUH A;  1ZDG A;  1VGW A;  2AGD A;  3T7M A;  1G93 A;  3V90 A;  1LL2 A;  1H5R B;  4Y7V A;  5CQO A;  3OAM A;  3V0L A;  5C38 A;  5EJZ A;  1YP4 A;  4XWI A;  2FFU A;  1TZF A;  3I0F A;  2RJ5 A;  3CKQ A;  3K8D A;  2BO7 A;  2E8B A;  4M2B A;  2OI6 A;  2DPW A;  3U2T A;  3CKJ A;  4FRD A;  5CQP A;  1VIC A;  4M28 A;  4Y6N A;  5CQM X;  2P73 A;  5C36 A;  2VD4 A;  5JQQ A;  1NQI B;  1H4E A;  1LZ7 A;  1LZI A;  4EE5 A;  2RJ8 A;  4FRM A;  4FRQ A;  1H5S C;  3RMV A;  5C48 A;  1H4C A;  3CKO A;  1MC3 A;  3SXG A;  1ZJ1 A;  2WVL A;  4B4G A;  4HO9 A;  2PA4 A;  2APC A;  1VGT A;  1ZI3 A;  4HO6 A;  1LL3 A;  4EVW A;  3U2U A;  1O23 B;  4HO0 A;  1TVY A;  2VSH A;  2YC5 A;  3BRK X;  5CMI A;  1H7E A;  2D7I A;  2I5E A;  2V0L A;  3DK5 A;  3PKP A;  4HG6 A;  4Y63 A;  1ZJ3 A;  2W0W A;  1VPA A;  1ZI4 A;  3GUE A;  4HO8 A;  3N9W A;  2VXM A;  1FR9 A;  1NMM B;  2PGV A;  2XWM A;  1R7V A;  2ZU8 A;  2D0J A;  4KC2 A;  4HCQ A;  4FCU A;  2RJ6 A;  2RIZ A;  1G3L A;  3D98 A;  3SPT A;  4HO4 A;  4NAI A;  3I0H A;  1LVW A;  4C2S A;  3I0C A;  5J49 A;  1TW5 A;  1WVC A;  4CJ8 A;  1HV9 A;  1VZX A;  3SXE A;  2AM5 A;  4D0T A;  3HL3 A;  2XMH A;  2FYD B;  2Y4M A;  2ICX A;  3IOH A;  5CMH A;  4FQW A;  4B2W A;  2ICY A;  5EJ1 A;  4Y7G A;  5C4B A;  4Y9X A;  1OQM B;  4IRP A;  5DDV A;  1FR8 A;  2XWN A;  5AJP A;  1ZI1 A;  3V8Y A;  1JVD A;  1JVG A;  1G23 A;  2JCO A;  2WVK A;  2BO6 A;  4ECM A;  4J18 A;  2RIY A;  4L41 C;  1WT2 A;  1HM9 A;  2WGZ A;  1JV3 A;  3I0D A;  1G2V A;  1FG5 N;  2AM3 A;  4NAK A;  4Y7T A;  1ZDF A;  1WSZ A;  2GGO A;  1FGX A;  2OI5 A;  3D8V A;  1HJL A;  3OH0 A;  4ASJ A;  4AYJ A;  1LL0 A;  4M4K A;  1GX4 A;  1GQ9 A;  3POL A;  5FU0 A;  5FTV A;  5EIY A;  2OEF A;  2WAW A;  1NKH B;  1H7H A;  1S4N A;  5C4E A;  2X65 A;  4HOC A;  1FWY A;  4HO5 A;  3RMW A;  3V0M A;  3I0G A;  1ZJP A;  2WVM A;  1XZ6 A;  1MP4 A;  1H7Q A;  4CJC A;  2V0H A;  2Y6P A;  5C8R A;  1PZT A;  4HO3 A;  5L6V A;  2YES A;  2WEE A;  3V0P A;  3U2W A;  1IIM A;  1Z90 A;  5C49 A;  1XHB A;  4KPX A;  1ON6 A;  3TQD A;  1R7U A;  5CMJ A;  2PX7 A;  3OH3 A;  3OH4 A;  3V0N A;  2I5K A;  5FYE A;  1OMX A;  2FYA A;  2JCL A;  1SS9 A;  2NXV A;  1FXJ A;  1VM8 A;  2VS5 A;  1R7Y A;  1H7L A;  3ZGF A;  3SXA A;  1O7Q A;  2YQH A;  1FOA A;  2XWL A;  5AJN A;  3ST8 A;  1E5K A;  1GQC A;  1JYL A;  2FYC B;  3ZLL A;  3OH2 A;  4Y7F A;  4Y62 A;  2VXL A;  1S4O A;  1PZY B;  4AC3 A;  3F1Y A;  1S4P A;  1ZCY A;  3U2V A;  2AE7 A;  2FYB A;  5CQN X;  5HS2 A;  3U0X A;  1FGG A;  3IOI A;  2Y4L A;  3I0L A;  1W57 A;  2AEC A;  3SXB A;  4CVH A;  3O3P A;  4R7P A;  2X5S A;  2JCK A;  1YP3 A;  3ZGG A;  2Y4K A;  4IRQ A;  4D11 A;  1O7O A;  2OI7 A;  3I0E A;  4DE7 A;  1YRO B;  3OKR A;  2W0V A;  1ZJO A;  3V8Z A;  4B4B A;  4B5B A;  3RSB A;  1W77 A;  1ZHJ A; 
#chains in the Genus database with same CATH topology
 3V0Q A;  1HM0 A;  3CKV A;  2YQC A;  4FRA A;  1K4V A;  5FTS A;  1FO8 A;  1GX0 A;  4EE4 A;  4KC4 A;  4B2X A;  4JIS A;  4EEO A;  1QWJ A;  2P72 A;  4KXO A;  1ZJ0 A;  4G3P A;  1I52 A;  3R3I A;  4KNR A;  2ZU9 A;  5I1F A;  1WT0 A;  3Q7U A;  4EEM A;  1GWV A;  2Z86 A;  2Y7A A;  1H7T A;  4P00 A;  2CU2 A;  1FXO A;  1O0R A;  3CU0 A;  5D92 A;  3T7N A;  3CKN A;  2VFZ A;  4G87 A;  2OEG A;  3E26 A;  4B3U A;  2VS3 A;  1R82 A;  3KIA A;  1FRW A;  1VZT A;  4NAN A;  2RJ0 A;  3JUK A;  2X5Z A;  1VH3 A;  3ZF8 A;  5FU8 A;  5IFY A;  2BO8 A;  3QVB A;  5C4C A;  4G3S A;  4G3Q A;  5C1H A;  3T7O A;  4FRB A;  4FRL A;  4BMA A;  1ZI5 A;  1R80 A;  1V84 A;  1WT3 A;  4P02 A;  2JCJ A;  3FWW A;  2YQS A;  5CQL X;  2Z87 A;  2GGQ A;  2YCM A;  4K6R A;  2AM4 A;  4D48 A;  1NHE B;  2V0K A;  5C1L A;  1OMZ A;  2RJ7 A;  3V91 A;  4D11 C;  3K8E A;  2BO4 A;  4KT7 A;  2O1F A;  5C4F A;  2XME A;  3IOJ A;  1ON8 A;  3NGW A;  1R7X A;  1INI A;  2RIT A;  1WT1 A;  4Y7U A;  1JYK A;  1H4D A;  4E1K A;  4EEA A;  5IDS A;  1ZIZ A;  3E25 A;  3JUJ A;  1NF5 B;  4ARW A;  1QGS A;  3CGX A;  2RJ1 A;  4YS8 A;  1H5T A;  4B4M A;  4LW3 A;  4FRO A;  3JTJ A;  1VGU A;  3LW6 A;  2VSI A;  5C3B A;  1H5S D;  2O1H A;  2FFV A;  4DEC A;  3U2X A;  4AAW A;  2AES A;  1R81 A;  1G9R A;  5BXC A;  1ZJ2 A;  2YC3 A;  2QH5 A;  1ZCV A;  4KPZ A;  4KRV A;  3SXD A;  1H5T B;  3BCV A;  1GWW A;  1G1L A;  5AJO A;  5CMG X;  4EE3 A;  4FCE A;  2AH9 A;  1V83 A;  5L6S A;  1LZJ A;  2V0I A;  4MND A;  2QGI A;  2V0J A;  1R7T A;  5C3D A;  4ZDQ A;  5C47 A;  3U0Y A;  1HM8 A;  4FRH A;  1YP2 A;  2ZU7 A;  1MP3 A;  1G0R A;  2VS4 A;  1TW1 A;  1JV1 A;  2E3D A;  2I7B A;  3Q4S A;  4GBP A;  2RIX A;  3R2W A;  4KNX A;  5D91 A;  3SXC A;  4D0Z A;  1MP5 A;  4UEG A;  3ZLK A;  3PNN A;  3OC9 A;  2VK9 A;  2QKX A;  1KWS A;  4KQL A;  4MYB A;  4CJB A;  5C3A A;  5C4D A;  4MIX A;  3DJ4 A;  1G8O A;  1V82 A;  2FY7 A;  1W55 A;  3SX7 A;  1H5S A;  3I0K A;  1QGQ A;  4AYL A;  3F1C A;  3SX8 A;  1ZCT A;  3USR A;  1NWG B;  2WE9 A;  3OH1 A;  1EYR A;  2P6W A;  4JD0 A;  1FO9 A;  3EE5 A;  4FRP A;  3SX5 A;  1H5S B;  1H7G A;  1H3M A;  2O1G A;  4Q7C A;  2Q4J A;  3PKQ A;  4FRE A;  2RJ9 A;  1VGZ A;  3V0O A;  1GA8 A;  1VZU A;  2PGY A;  2A8U A;  1LZ0 A;  3SX3 A;  1INJ A;  2RJ4 A;  3OGZ A;  2YQJ A;  4LW6 A;  1HJJ A;  4DDZ A;  2A8W A;  3TZT A;  2D7R A;  4O6N A;  2Y4J A;  3I0J A;  4ASY A;  2MZB A;  1ZCU A;  4Y6U A;  4EEG A;  1EZI A;  5FV9 A;  3Q80 A;  3USQ A;  1H7F A;  1FZW A;  1VH1 A;  1H5R A;  2X60 A;  3I0I X;  4M2A A;  4Y64 A;  1QG8 A;  3D5N A;  4HO2 A;  5DDT A;  5CMF X;  4NAL A;  3DUV A;  1IIN A;  1G97 A;  4O6M A;  3FOQ A;  4B42 A;  2UX8 A;  5IDT A;  5C1G A;  4BQH A;  1G95 A;  4KC1 A;  5FUH A;  1ZDG A;  1VGW A;  2AGD A;  2C0N A;  3T7M A;  1G93 A;  3V90 A;  1LL2 A;  1H5R B;  4Y7V A;  5CQO A;  3OAM A;  3V0L A;  5C38 A;  5EJZ A;  1YP4 A;  4XWI A;  2FFU A;  1TZF A;  3I0F A;  2RJ5 A;  4FIX A;  3CKQ A;  3K8D A;  2BO7 A;  2E8B A;  4M2B A;  2OI6 A;  2DPW A;  3U2T A;  3CKJ A;  4FRD A;  5CQP A;  1VIC A;  4M28 A;  4Y6N A;  5CQM X;  2P73 A;  5C36 A;  2VD4 A;  5JQQ A;  1NQI B;  1H4E A;  1LZ7 A;  2J0A A;  1LZI A;  4EE5 A;  2J0B A;  2RJ8 A;  4FRM A;  4FRQ A;  1H5S C;  3RMV A;  5C48 A;  1H4C A;  3CKO A;  1MC3 A;  3SXG A;  1ZJ1 A;  2WVL A;  4B4G A;  4HO9 A;  2PA4 A;  2APC A;  1VGT A;  1ZI3 A;  4HO6 A;  1LL3 A;  4EVW A;  3U2U A;  1O23 B;  4HO0 A;  1TVY A;  2VSH A;  2YC5 A;  3BRK X;  5CMI A;  1H7E A;  2D7I A;  2I5E A;  2V0L A;  3DK5 A;  3PKP A;  4HG6 A;  4Y63 A;  1ZJ3 A;  4FIY A;  2W0W A;  1VPA A;  1ZI4 A;  3GUE A;  4HO8 A;  3N9W A;  2VXM A;  1FR9 A;  1NMM B;  2PGV A;  2XWM A;  1R7V A;  2ZU8 A;  2D0J A;  4KC2 A;  4HCQ A;  4FCU A;  2RJ6 A;  2RIZ A;  1G3L A;  3D98 A;  3SPT A;  4HO4 A;  4NAI A;  3I0H A;  1LVW A;  4C2S A;  3I0C A;  5J49 A;  1TW5 A;  1WVC A;  4CJ8 A;  1HV9 A;  1VZX A;  3SXE A;  2AM5 A;  4D0T A;  3HL3 A;  2XMH A;  2FYD B;  2Y4M A;  2ICX A;  3IOH A;  5CMH A;  4FQW A;  4B2W A;  2ICY A;  5EJ1 A;  4Y7G A;  5C4B A;  4Y9X A;  1OQM B;  4IRP A;  5DDV A;  1FR8 A;  2XWN A;  5AJP A;  1ZI1 A;  3V8Y A;  1JVD A;  1JVG A;  1G23 A;  2JCO A;  2WVK A;  2BO6 A;  4ECM A;  4J18 A;  2RIY A;  4L41 C;  1WT2 A;  1HM9 A;  2WGZ A;  1JV3 A;  3I0D A;  1G2V A;  1FG5 N;  2AM3 A;  4NAK A;  4Y7T A;  1ZDF A;  1WSZ A;  2GGO A;  1FGX A;  2OI5 A;  3D8V A;  1HJL A;  3OH0 A;  4ASJ A;  4AYJ A;  1LL0 A;  4M4K A;  1GX4 A;  1GQ9 A;  3POL A;  5FU0 A;  5FTV A;  5EIY A;  2OEF A;  2WAW A;  1NKH B;  1H7H A;  1S4N A;  5C4E A;  2X65 A;  4HOC A;  1FWY A;  4HO5 A;  3RMW A;  3V0M A;  3I0G A;  1ZJP A;  2WVM A;  1XZ6 A;  1MP4 A;  1H7Q A;  4CJC A;  2V0H A;  2Y6P A;  5C8R A;  1PZT A;  4HO3 A;  5L6V A;  2YES A;  2WEE A;  3V0P A;  3U2W A;  1IIM A;  1Z90 A;  5C49 A;  1XHB A;  4KPX A;  1ON6 A;  3TQD A;  1R7U A;  5CMJ A;  2PX7 A;  3OH3 A;  3OH4 A;  3V0N A;  2I5K A;  5FYE A;  1OMX A;  2FYA A;  2JCL A;  1SS9 A;  2NXV A;  1FXJ A;  1VM8 A;  2VS5 A;  1R7Y A;  1H7L A;  3ZGF A;  3SXA A;  1O7Q A;  2YQH A;  1FOA A;  2XWL A;  5AJN A;  3ST8 A;  1E5K A;  1GQC A;  1JYL A;  2FYC B;  3ZLL A;  3OH2 A;  4Y7F A;  4Y62 A;  2VXL A;  1S4O A;  1PZY B;  4AC3 A;  3F1Y A;  1S4P A;  1ZCY A;  3U2V A;  2AE7 A;  2FYB A;  5CQN X;  5HS2 A;  3U0X A;  1FGG A;  3IOI A;  2Y4L A;  3I0L A;  1W57 A;  2AEC A;  3SXB A;  4CVH A;  3O3P A;  4R7P A;  2X5S A;  2JCK A;  1YP3 A;  3ZGG A;  2Y4K A;  4IRQ A;  4D11 A;  1O7O A;  2OI7 A;  3I0E A;  4DE7 A;  1YRO B;  3OKR A;  2W0V A;  1ZJO A;  3V8Z A;  4B4B A;  4B5B A;  3RSB A;  1W77 A;  1ZHJ A; 
#chains in the Genus database with same CATH homology
 3V0Q A;  1HM0 A;  3CKV A;  2YQC A;  4FRA A;  1K4V A;  5FTS A;  1FO8 A;  1GX0 A;  4EE4 A;  4KC4 A;  4B2X A;  4JIS A;  4EEO A;  1QWJ A;  2P72 A;  4KXO A;  1ZJ0 A;  4G3P A;  1I52 A;  3R3I A;  4KNR A;  2ZU9 A;  5I1F A;  1WT0 A;  3Q7U A;  4EEM A;  1GWV A;  2Z86 A;  2Y7A A;  1H7T A;  4P00 A;  2CU2 A;  1FXO A;  1O0R A;  3CU0 A;  5D92 A;  3T7N A;  3CKN A;  2VFZ A;  4G87 A;  2OEG A;  3E26 A;  4B3U A;  2VS3 A;  1R82 A;  3KIA A;  1FRW A;  1VZT A;  4NAN A;  2RJ0 A;  3JUK A;  2X5Z A;  1VH3 A;  3ZF8 A;  5FU8 A;  5IFY A;  2BO8 A;  3QVB A;  5C4C A;  4G3S A;  4G3Q A;  5C1H A;  3T7O A;  4FRB A;  4FRL A;  4BMA A;  1ZI5 A;  1R80 A;  1V84 A;  1WT3 A;  4P02 A;  2JCJ A;  3FWW A;  2YQS A;  5CQL X;  2Z87 A;  2GGQ A;  2YCM A;  4K6R A;  2AM4 A;  4D48 A;  1NHE B;  2V0K A;  5C1L A;  1OMZ A;  2RJ7 A;  3V91 A;  4D11 C;  3K8E A;  2BO4 A;  4KT7 A;  2O1F A;  5C4F A;  2XME A;  3IOJ A;  1ON8 A;  3NGW A;  1R7X A;  1INI A;  2RIT A;  1WT1 A;  4Y7U A;  1JYK A;  1H4D A;  4E1K A;  4EEA A;  5IDS A;  1ZIZ A;  3E25 A;  3JUJ A;  1NF5 B;  4ARW A;  1QGS A;  3CGX A;  2RJ1 A;  4YS8 A;  1H5T A;  4B4M A;  4LW3 A;  4FRO A;  3JTJ A;  1VGU A;  3LW6 A;  2VSI A;  5C3B A;  1H5S D;  2O1H A;  2FFV A;  4DEC A;  3U2X A;  4AAW A;  2AES A;  1R81 A;  1G9R A;  5BXC A;  1ZJ2 A;  2YC3 A;  2QH5 A;  1ZCV A;  4KPZ A;  4KRV A;  3SXD A;  1H5T B;  3BCV A;  1GWW A;  1G1L A;  5AJO A;  5CMG X;  4EE3 A;  4FCE A;  2AH9 A;  1V83 A;  5L6S A;  1LZJ A;  2V0I A;  4MND A;  2QGI A;  2V0J A;  1R7T A;  5C3D A;  4ZDQ A;  5C47 A;  3U0Y A;  1HM8 A;  4FRH A;  1YP2 A;  2ZU7 A;  1MP3 A;  1G0R A;  2VS4 A;  1TW1 A;  1JV1 A;  2E3D A;  2I7B A;  3Q4S A;  4GBP A;  2RIX A;  3R2W A;  4KNX A;  5D91 A;  3SXC A;  4D0Z A;  1MP5 A;  4UEG A;  3ZLK A;  3PNN A;  3OC9 A;  2VK9 A;  2QKX A;  1KWS A;  4KQL A;  4MYB A;  4CJB A;  5C3A A;  5C4D A;  4MIX A;  3DJ4 A;  1G8O A;  1V82 A;  2FY7 A;  1W55 A;  3SX7 A;  1H5S A;  3I0K A;  1QGQ A;  4AYL A;  3F1C A;  3SX8 A;  1ZCT A;  3USR A;  1NWG B;  2WE9 A;  3OH1 A;  1EYR A;  2P6W A;  4JD0 A;  1FO9 A;  3EE5 A;  4FRP A;  3SX5 A;  1H5S B;  1H7G A;  1H3M A;  2O1G A;  4Q7C A;  2Q4J A;  3PKQ A;  4FRE A;  2RJ9 A;  1VGZ A;  3V0O A;  1GA8 A;  1VZU A;  2PGY A;  2A8U A;  1LZ0 A;  3SX3 A;  1INJ A;  2RJ4 A;  3OGZ A;  2YQJ A;  4LW6 A;  1HJJ A;  4DDZ A;  2A8W A;  3TZT A;  2D7R A;  4O6N A;  2Y4J A;  3I0J A;  4ASY A;  2MZB A;  1ZCU A;  4Y6U A;  4EEG A;  1EZI A;  5FV9 A;  3Q80 A;  3USQ A;  1H7F A;  1FZW A;  1VH1 A;  1H5R A;  2X60 A;  3I0I X;  4M2A A;  4Y64 A;  1QG8 A;  3D5N A;  4HO2 A;  5DDT A;  5CMF X;  4NAL A;  3DUV A;  1IIN A;  1G97 A;  4O6M A;  3FOQ A;  4B42 A;  2UX8 A;  5IDT A;  5C1G A;  4BQH A;  1G95 A;  4KC1 A;  5FUH A;  1ZDG A;  1VGW A;  2AGD A;  2C0N A;  3T7M A;  1G93 A;  3V90 A;  1LL2 A;  1H5R B;  4Y7V A;  5CQO A;  3OAM A;  3V0L A;  5C38 A;  5EJZ A;  1YP4 A;  4XWI A;  2FFU A;  1TZF A;  3I0F A;  2RJ5 A;  4FIX A;  3CKQ A;  3K8D A;  2BO7 A;  2E8B A;  4M2B A;  2OI6 A;  2DPW A;  3U2T A;  3CKJ A;  4FRD A;  5CQP A;  1VIC A;  4M28 A;  4Y6N A;  5CQM X;  2P73 A;  5C36 A;  2VD4 A;  5JQQ A;  1NQI B;  1H4E A;  1LZ7 A;  2J0A A;  1LZI A;  4EE5 A;  2J0B A;  2RJ8 A;  4FRM A;  4FRQ A;  1H5S C;  3RMV A;  5C48 A;  1H4C A;  3CKO A;  1MC3 A;  3SXG A;  1ZJ1 A;  2WVL A;  4B4G A;  4HO9 A;  2PA4 A;  2APC A;  1VGT A;  1ZI3 A;  4HO6 A;  1LL3 A;  4EVW A;  3U2U A;  1O23 B;  4HO0 A;  1TVY A;  2VSH A;  2YC5 A;  3BRK X;  5CMI A;  1H7E A;  2D7I A;  2I5E A;  2V0L A;  3DK5 A;  3PKP A;  4HG6 A;  4Y63 A;  1ZJ3 A;  4FIY A;  2W0W A;  1VPA A;  1ZI4 A;  3GUE A;  4HO8 A;  3N9W A;  2VXM A;  1FR9 A;  1NMM B;  2PGV A;  2XWM A;  1R7V A;  2ZU8 A;  2D0J A;  4KC2 A;  4HCQ A;  4FCU A;  2RJ6 A;  2RIZ A;  1G3L A;  3D98 A;  3SPT A;  4HO4 A;  4NAI A;  3I0H A;  1LVW A;  4C2S A;  3I0C A;  5J49 A;  1TW5 A;  1WVC A;  4CJ8 A;  1HV9 A;  1VZX A;  3SXE A;  2AM5 A;  4D0T A;  3HL3 A;  2XMH A;  2FYD B;  2Y4M A;  2ICX A;  3IOH A;  5CMH A;  4FQW A;  4B2W A;  2ICY A;  5EJ1 A;  4Y7G A;  5C4B A;  4Y9X A;  1OQM B;  4IRP A;  5DDV A;  1FR8 A;  2XWN A;  5AJP A;  1ZI1 A;  3V8Y A;  1JVD A;  1JVG A;  1G23 A;  2JCO A;  2WVK A;  2BO6 A;  4ECM A;  4J18 A;  2RIY A;  4L41 C;  1WT2 A;  1HM9 A;  2WGZ A;  1JV3 A;  3I0D A;  1G2V A;  1FG5 N;  2AM3 A;  4NAK A;  4Y7T A;  1ZDF A;  1WSZ A;  2GGO A;  1FGX A;  2OI5 A;  3D8V A;  1HJL A;  3OH0 A;  4ASJ A;  4AYJ A;  1LL0 A;  4M4K A;  1GX4 A;  1GQ9 A;  3POL A;  5FU0 A;  5FTV A;  5EIY A;  2OEF A;  2WAW A;  1NKH B;  1H7H A;  1S4N A;  5C4E A;  2X65 A;  4HOC A;  1FWY A;  4HO5 A;  3RMW A;  3V0M A;  3I0G A;  1ZJP A;  2WVM A;  1XZ6 A;  1MP4 A;  1H7Q A;  4CJC A;  2V0H A;  2Y6P A;  5C8R A;  1PZT A;  4HO3 A;  5L6V A;  2YES A;  2WEE A;  3V0P A;  3U2W A;  1IIM A;  1Z90 A;  5C49 A;  1XHB A;  4KPX A;  1ON6 A;  3TQD A;  1R7U A;  5CMJ A;  2PX7 A;  3OH3 A;  3OH4 A;  3V0N A;  2I5K A;  5FYE A;  1OMX A;  2FYA A;  2JCL A;  1SS9 A;  2NXV A;  1FXJ A;  1VM8 A;  2VS5 A;  1R7Y A;  1H7L A;  3ZGF A;  3SXA A;  1O7Q A;  2YQH A;  1FOA A;  2XWL A;  5AJN A;  3ST8 A;  1E5K A;  1GQC A;  1JYL A;  2FYC B;  3ZLL A;  3OH2 A;  4Y7F A;  4Y62 A;  2VXL A;  1S4O A;  1PZY B;  4AC3 A;  3F1Y A;  1S4P A;  1ZCY A;  3U2V A;  2AE7 A;  2FYB A;  5CQN X;  5HS2 A;  3U0X A;  1FGG A;  3IOI A;  2Y4L A;  3I0L A;  1W57 A;  2AEC A;  3SXB A;  4CVH A;  3O3P A;  4R7P A;  2X5S A;  2JCK A;  1YP3 A;  3ZGG A;  2Y4K A;  4IRQ A;  4D11 A;  1O7O A;  2OI7 A;  3I0E A;  4DE7 A;  1YRO B;  3OKR A;  2W0V A;  1ZJO A;  3V8Z A;  4B4B A;  4B5B A;  3RSB A;  1W77 A;  1ZHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...