3T7MA

Crystal structure of human glycogenin-1 (gyg1) complexed with manganese and udp, in a triclinic closed form
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
263
structure length
263
Chain Sequence
SMTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHPEFLILWWNIFTTNVLPLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycogenin-1
publication title Conformational plasticity of glycogenin and its maltosaccharide substrate during glycogen biogenesis.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 2.4.1.186: Glycogenin glucosyltransferase.
pdb deposition date 2011-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3t7mA00
4HO8A 1TW5A 1R7UA 2RJ9A 4FRMA 2AM3A 4NANA 4HO5A 2V0LA 4D11C 1GX0A 2CU2A 4KNXA 2GGOA 1H5SA 2Y4LA 4XWIA 2FFUA 2Y6PA 3D98A 4C2SA 4EEGA 4M4KA 3F1CA 4B4BA 2RJ4A 1S4OA 2FYDB 5EJ1A 1R7XA 2VS3A 5C1GA 1LL2A 2X60A 1ZJ0A 3DK5A 4Y7TA 3T7MA 4G3SA 2D7RA 3V0QA 2BO8A 5CQOA 3SXDA 2P72A 3D5NA 1HM9A 4ECMA 1QG8A 2WVMA 3V8YA 1H5TB 5FV9A 2ICYA 2X5SA 4HO9A 2FYBA 3U0XA 2PGYA 4D0ZA 2P6WA 5AJNA 3E25A 2YESA 3FOQA 1FXJA 1VZUA 1ZDFA 1ZJ3A 1ZJ2A 4EE4A 3O3PA 1FWYA 1FRWA 5L6VA 1G8OA 3PKQA 3T7NA 2RJ1A 1FOAA 3ZGFA 2WVKA 4D48A 1G1LA 1ZJOA 1G93A 1YP3A 5FUHA 5C38A 4B4GA 3V0OA 1JV1A 2JCJA 1OMZA 4DECA 1LVWA 2AESA 1VGUA 4JISA 3IOHA 5FU8A 4P00A 4FCEA 2JCOA 3USRA 1ZCYA 3HL3A 1GQCA 2I5EA 4HO2A 1HM8A 1MP5A 4FROA 1WT3A 3ZLKA 3U0YA 1HJLA 3SXBA 1INJA 3IOIA 3EE5A 5C4BA 4Y6UA 3SXCA 2JCLA 4LW3A 2YCMA 4EE5A 1FGGA 2YQCA 4FCUA 3U2TA 4FRPA 1V83A 1ZDGA 1H5RB 1OMXA 1VM8A 2RJ8A 1S4PA 1YP2A 4B2WA 2E3DA 2I5KA 4L41C 1I52A 2QGIA 4KC1A 4KPXA 4BQHA 2XMEA 1LZ0A 2YQHA 1VPAA 1ZI1A 5BXCA 1FXOA 2BO7A 2Y4MA 5L6SA 1V84A 1W77A 1OQMB 2VXLA 4MNDA 1VZTA 2BO4A 1G3LA 2FYAA 1H5SC 2PA4A 2OEFA 4CJ8A 1ZJ1A 4B3UA 1WT2A 3I0FA 3SX8A 2ZU7A 3LW6A 4AC3A 2FFVA 3U2WA 4ARWA 1G0RA 1H4CA 1FO9A 3TZTA 4DE7A 1H7HA 5FU0A 2Z87A 5C4EA 4CJCA 3I0GA 3E26A 3IOJA 4FREA 5C49A 1VH3A 2E8BA 4P02A 2WGZA 3SXEA 4ZDQA 4HO3A 5C1HA 2RJ5A 1FR9A 2RJ0A 4NAIA 1VGWA 1H7GA 1NWGB 1VZXA 3OH3A 5CQMX 5CMJA 2O1HA 3D8VA 5CMGX 1NQIB 5C48A 5FYEA 1TZFA 5CMHA 3V0MA 3Q4SA 2W0VA 4KPZA 5CQNX 3PKPA 5FTVA 1MP4A 4Y7FA 3Q80A 4KQLA 5CQPA 4KXOA 1R7YA 2P73A 3CKJA 3I0CA 2W0WA 3SPTA 4Y9XA 4ASYA 4FRLA 1ON8A 2OI5A 1G9RA 1ZIZA 5CMFX 3SX3A 2XWLA 5DDVA 3I0EA 3I0LA 5CMIA 1H7FA 2A8UA 1HM0A 1WT0A 5AJPA 3USQA 1R81A 3OGZA 1KWSA 3OC9A 4J18A 1QGSA 4FRQA 2XWNA 4Y7GA 3ST8A 3I0HA 3OH4A 2YQJA 1GA8A 1H4EA 1S4NA 3JTJA 3R3IA 2AECA 4UEGA 2WEEA 4KNRA 4M2AA 2YC5A 5JQQA 3OH1A 3ZF8A 1H7EA 4KC2A 2MZBA 1ZCTA 1INIA 1JYLA 4EEAA 3K8DA 1H5SB 5HS2A 4Y62A 3SXGA 1O7OA 2Z86A 4B42A 1NMMB 3V91A 1W57A 1JYKA 4K6RA 1LZJA 1HJJA 1R7TA 4Y7VA 4Y7UA 1H7TA 1EZIA 1G2VA 1LL0A 2APCA 5CQLX 3QVBA 1TVYA 3I0DA 2PX7A 3JUKA 3OKRA 2FY7A 1O0RA 4CJBA 1K4VA 2O1GA 3GUEA 2BO6A 2VFZA 2ICXA 1ZHJA 3NGWA 1YROB 3RMWA 4GBPA 1Z90A 1WT1A 3POLA 1ZI5A 1H5TA 2VXMA 5C3DA 3ZLLA 1NHEB 2A8WA 5J49A 1IIMA 2I7BA 3TQDA 1HV9A 4FRDA 4R7PA 1XHBA 2XWMA 2AE7A 3SX5A 4E1KA 5C3BA 4MYBA 4AAWA 3V0LA 3DUVA 4BMAA 2D0JA 3ZGGA 1V82A 4FRHA 4M28A 1VICA 2VS4A 4M2BA 5C4CA 5C3AA 1W55A 4FQWA 1JV3A 2PGVA 1GWWA 3Q7UA 2RJ6A 3U2XA 2Y7AA 4B2XA 2D7IA 3RSBA 1ZCUA 4HOCA 1MC3A 1MP3A 4EEMA 4IRPA 1YP4A 3I0KA 2OI6A 4Y63A 5C4DA 2YQSA 4HG6A 1FGXA 4FRAA 1VGTA 2YC3A 2WE9A 1FZWA 2XMHA 1H3MA 5C36A 1FG5N 1JVGA 4EE3A 3CKNA 1G23A 1PZTA 5C47A 3FWWA 3OAMA 1ZI4A 1O7QA 1R82A 4EEOA 3PNNA 2ZU9A 4D11A 1PZYB 2VD4A 1H5RA 4JD0A 1G95A 2FYCB 3SX7A 3K8EA 1GX4A 4KRVA 5EIYA 2JCKA 4D0TA 3CKQA 3CKVA 1H7QA 3V0NA 4NALA 2OI7A 2AM4A 2Y4JA 2RIXA 2DPWA 3CU0A 2QKXA 3V90A 4HCQA 1GWVA 3SXAA 1WVCA 5IDSA 4FRBA 1LZIA 2X5ZA 2OEGA 4G3PA 3KIAA 4CVHA 1NKHB 1TW1A 1ZI3A 2RITA 3F1YA 2VS5A 2AH9A 3V0PA 1R80A 4KT7A 3JUJA 4EVWA 1ZCVA 1H4DA 1GQ9A 2V0HA 4HO0A 1ON6A 2VSIA 4ASJA 5AJOA 5C4FA 4B4MA 1G97A 3BCVA 2AM5A 5FTSA 4DDZA 5IFYA 2VSHA 2UX8A 1WSZA 4AYLA 4NAKA 3BRKX 4HO4A 4B5BA 3U2UA 1EYRA 4LW6A 2AGDA 1IINA 5IDTA 1ZJPA 4G3QA 1JVDA 1VH1A 3T7OA 2WVLA 1E5KA 2O1FA 5I1FA 5EJZA 3R2WA 3OH2A 2ZU8A 4Y6NA 3RMVA 1O23B 4Y64A 5C8RA 2QH5A 2GGQA 1H7LA 3OH0A 4HO6A 2V0IA 1LZ7A 3V8ZA 1XZ6A 2V0JA 3CGXA 3U2VA 3DJ4A 4IRQA 1H5SD 1SS9A 1VGZA 4AYJA 2Q4JA 2X65A 3I0IX 1QWJA 4G87A 5DDTA 2RIZA 2NXVA 2Y4KA 1NF5B 2RIYA 1QGQA 3I0JA 2V0KA 3CKOA 5C1LA 4KC4A 2WAWA 4YS8A 1LL3A 1R7VA 1FR8A 2RJ7A 1FO8A 3N9WA
chains in the Genus database with same CATH superfamily
4HO8A 1TW5A 1R7UA 2RJ9A 4FRMA 2AM3A 4NANA 4HO5A 2V0LA 4D11C 1GX0A 2CU2A 4KNXA 2GGOA 1H5SA 2Y4LA 4XWIA 2FFUA 2Y6PA 3D98A 4C2SA 4EEGA 4M4KA 3F1CA 4B4BA 2RJ4A 1S4OA 2FYDB 5EJ1A 1R7XA 2VS3A 5C1GA 1LL2A 2X60A 1ZJ0A 3DK5A 4Y7TA 3T7MA 4G3SA 2D7RA 3V0QA 2BO8A 5CQOA 3SXDA 2P72A 3D5NA 1HM9A 4ECMA 1QG8A 2WVMA 3V8YA 1H5TB 5FV9A 2ICYA 2X5SA 4HO9A 2FYBA 3U0XA 2PGYA 4D0ZA 2P6WA 5AJNA 3E25A 2YESA 3FOQA 1FXJA 1VZUA 1ZDFA 2C0NA 1ZJ3A 1ZJ2A 4EE4A 3O3PA 1FWYA 1FRWA 5L6VA 1G8OA 3PKQA 3T7NA 2RJ1A 1FOAA 3ZGFA 2WVKA 4D48A 1G1LA 1ZJOA 1G93A 1YP3A 5FUHA 5C38A 4B4GA 3V0OA 1JV1A 2JCJA 1OMZA 4DECA 1LVWA 5D92A 2AESA 4O6MA 1VGUA 4JISA 3IOHA 5FU8A 4P00A 4FCEA 2JCOA 3USRA 1ZCYA 3HL3A 1GQCA 2I5EA 4HO2A 4MIXA 1HM8A 1MP5A 4FROA 1WT3A 3ZLKA 3U0YA 1HJLA 3SXBA 1INJA 3IOIA 3EE5A 5C4BA 4Y6UA 3SXCA 2JCLA 4LW3A 2YCMA 4EE5A 1FGGA 2YQCA 4FCUA 3U2TA 4FRPA 1V83A 1ZDGA 1H5RB 1OMXA 1VM8A 2RJ8A 1S4PA 1YP2A 4B2WA 2E3DA 2I5KA 4L41C 1I52A 2QGIA 2J0AA 4KC1A 4KPXA 4BQHA 2XMEA 1LZ0A 2YQHA 1VPAA 1ZI1A 5BXCA 1FXOA 2BO7A 2Y4MA 5L6SA 1V84A 1W77A 1OQMB 2VXLA 4MNDA 1VZTA 2BO4A 1G3LA 2FYAA 1H5SC 2PA4A 2OEFA 4CJ8A 1ZJ1A 4B3UA 2J0BA 1WT2A 3I0FA 3SX8A 2ZU7A 3LW6A 4AC3A 2FFVA 3U2WA 4ARWA 1G0RA 1H4CA 1FO9A 3TZTA 4DE7A 1H7HA 5FU0A 2Z87A 5C4EA 4CJCA 3I0GA 3E26A 3IOJA 4FREA 5C49A 1VH3A 2E8BA 4P02A 2WGZA 3SXEA 4ZDQA 4HO3A 5C1HA 2RJ5A 1FR9A 2RJ0A 4NAIA 1VGWA 1H7GA 1NWGB 1VZXA 3OH3A 5CQMX 5CMJA 2O1HA 3D8VA 5CMGX 1NQIB 5C48A 5FYEA 1TZFA 5CMHA 3V0MA 3Q4SA 2W0VA 4KPZA 5CQNX 3PKPA 5FTVA 1MP4A 4Y7FA 3Q80A 4KQLA 5CQPA 4KXOA 1R7YA 2P73A 3CKJA 3I0CA 2W0WA 3SPTA 4Y9XA 4ASYA 4FRLA 1ON8A 2OI5A 1G9RA 1ZIZA 5CMFX 3SX3A 2XWLA 5DDVA 3I0EA 3I0LA 5CMIA 1H7FA 4FIXA 2A8UA 1HM0A 1WT0A 5AJPA 3USQA 1R81A 3OGZA 1KWSA 3OC9A 4J18A 1QGSA 4FRQA 2XWNA 4Y7GA 3ST8A 3I0HA 3OH4A 2YQJA 1GA8A 1H4EA 1S4NA 3JTJA 3R3IA 2AECA 4UEGA 2WEEA 4KNRA 4M2AA 2YC5A 5JQQA 3OH1A 3ZF8A 1H7EA 4KC2A 2MZBA 1ZCTA 1INIA 1JYLA 4EEAA 3K8DA 1H5SB 5HS2A 4Y62A 3SXGA 1O7OA 2Z86A 4B42A 1NMMB 3V91A 1W57A 1JYKA 4K6RA 1LZJA 1HJJA 1R7TA 4Y7VA 4Y7UA 1H7TA 1EZIA 1G2VA 1LL0A 2APCA 5CQLX 3QVBA 1TVYA 3I0DA 2PX7A 3JUKA 3OKRA 2FY7A 1O0RA 4CJBA 1K4VA 2O1GA 3GUEA 2BO6A 2VFZA 2ICXA 1ZHJA 3NGWA 1YROB 3RMWA 4GBPA 1Z90A 1WT1A 3POLA 1ZI5A 1H5TA 2VXMA 5C3DA 3ZLLA 1NHEB 2A8WA 5J49A 1IIMA 2I7BA 3TQDA 1HV9A 4FRDA 4R7PA 1XHBA 2XWMA 2AE7A 3SX5A 4E1KA 5C3BA 4MYBA 4AAWA 3V0LA 3DUVA 4BMAA 2D0JA 3ZGGA 1V82A 4FRHA 4M28A 1VICA 2VS4A 4M2BA 5C4CA 5C3AA 1W55A 4FQWA 1JV3A 2PGVA 1GWWA 3Q7UA 2RJ6A 3U2XA 2Y7AA 4B2XA 2D7IA 3RSBA 1ZCUA 4HOCA 1MC3A 1MP3A 4EEMA 4IRPA 1YP4A 3I0KA 2OI6A 4Y63A 5C4DA 2YQSA 4HG6A 1FGXA 4FIYA 4FRAA 1VGTA 2YC3A 2WE9A 1FZWA 2XMHA 1H3MA 5C36A 1FG5N 5D91A 1JVGA 4EE3A 3CKNA 1G23A 1PZTA 5C47A 3FWWA 3OAMA 1ZI4A 1O7QA 1R82A 4EEOA 3PNNA 2ZU9A 4D11A 1PZYB 2VD4A 1H5RA 4JD0A 1G95A 2FYCB 3SX7A 3K8EA 1GX4A 4KRVA 5EIYA 2JCKA 4D0TA 3CKQA 3CKVA 1H7QA 3V0NA 4NALA 2OI7A 2AM4A 2Y4JA 2RIXA 2DPWA 3CU0A 2QKXA 3V90A 4HCQA 1GWVA 3SXAA 1WVCA 5IDSA 4FRBA 1LZIA 2X5ZA 2OEGA 4G3PA 3KIAA 4CVHA 1NKHB 1TW1A 1ZI3A 2RITA 3F1YA 2VS5A 2AH9A 3V0PA 1R80A 2VK9A 4KT7A 3JUJA 4EVWA 1ZCVA 4Q7CA 1H4DA 1GQ9A 2V0HA 4HO0A 1ON6A 2VSIA 4ASJA 5AJOA 5C4FA 4B4MA 1G97A 3BCVA 2AM5A 5FTSA 4DDZA 5IFYA 2VSHA 2UX8A 1WSZA 4AYLA 4NAKA 3BRKX 4HO4A 4B5BA 3U2UA 1EYRA 4LW6A 2AGDA 1IINA 5IDTA 1ZJPA 4G3QA 1JVDA 1VH1A 3T7OA 2WVLA 1E5KA 2O1FA 5I1FA 5EJZA 3R2WA 3OH2A 2ZU8A 4O6NA 4Y6NA 3RMVA 1O23B 4Y64A 5C8RA 2QH5A 2GGQA 1H7LA 3OH0A 4HO6A 2V0IA 1LZ7A 3V8ZA 1XZ6A 2V0JA 3CGXA 3U2VA 3DJ4A 4IRQA 1H5SD 1SS9A 1VGZA 4AYJA 2Q4JA 2X65A 3I0IX 1QWJA 4G87A 5DDTA 2RIZA 2NXVA 2Y4KA 1NF5B 2RIYA 1QGQA 3I0JA 2V0KA 3CKOA 5C1LA 4KC4A 2WAWA 4YS8A 1LL3A 1R7VA 1FR8A 2RJ7A 1FO8A 3N9WA
chains in the Genus database with same CATH topology
4HO8A 1TW5A 1R7UA 2RJ9A 4FRMA 2AM3A 4NANA 4HO5A 2V0LA 4D11C 1GX0A 2CU2A 4KNXA 2GGOA 1H5SA 2Y4LA 4XWIA 2FFUA 2Y6PA 3D98A 4C2SA 4EEGA 4M4KA 3F1CA 4B4BA 2RJ4A 1S4OA 2FYDB 5EJ1A 1R7XA 2VS3A 5C1GA 1LL2A 2X60A 1ZJ0A 3DK5A 4Y7TA 3T7MA 4G3SA 2D7RA 3V0QA 2BO8A 5CQOA 3SXDA 2P72A 3D5NA 1HM9A 4ECMA 1QG8A 2WVMA 3V8YA 1H5TB 5FV9A 2ICYA 2X5SA 4HO9A 2FYBA 3U0XA 2PGYA 4D0ZA 2P6WA 5AJNA 3E25A 2YESA 3FOQA 1FXJA 1VZUA 1ZDFA 2C0NA 1ZJ3A 1ZJ2A 4EE4A 3O3PA 1FWYA 1FRWA 5L6VA 1G8OA 3PKQA 3T7NA 2RJ1A 1FOAA 3ZGFA 2WVKA 4D48A 1G1LA 1ZJOA 1G93A 1YP3A 5FUHA 5C38A 4B4GA 3V0OA 1JV1A 2JCJA 1OMZA 4DECA 1LVWA 5D92A 2AESA 4O6MA 1VGUA 4JISA 3IOHA 5FU8A 4P00A 4FCEA 2JCOA 3USRA 1ZCYA 3HL3A 1GQCA 2I5EA 4HO2A 4MIXA 1HM8A 1MP5A 4FROA 1WT3A 3ZLKA 3U0YA 1HJLA 3SXBA 1INJA 3IOIA 3EE5A 5C4BA 4Y6UA 3SXCA 2JCLA 4LW3A 2YCMA 4EE5A 1FGGA 2YQCA 4FCUA 3U2TA 4FRPA 1V83A 1ZDGA 1H5RB 1OMXA 1VM8A 2RJ8A 1S4PA 1YP2A 4B2WA 2E3DA 2I5KA 4L41C 1I52A 2QGIA 2J0AA 4KC1A 4KPXA 4BQHA 2XMEA 1LZ0A 2YQHA 1VPAA 1ZI1A 5BXCA 1FXOA 2BO7A 2Y4MA 5L6SA 1V84A 1W77A 1OQMB 2VXLA 4MNDA 1VZTA 2BO4A 1G3LA 2FYAA 1H5SC 2PA4A 2OEFA 4CJ8A 1ZJ1A 4B3UA 2J0BA 1WT2A 3I0FA 3SX8A 2ZU7A 3LW6A 4AC3A 2FFVA 3U2WA 4ARWA 1G0RA 1H4CA 1FO9A 3TZTA 4DE7A 1H7HA 5FU0A 2Z87A 5C4EA 4CJCA 3I0GA 3E26A 3IOJA 4FREA 5C49A 1VH3A 2E8BA 4P02A 2WGZA 3SXEA 4ZDQA 4HO3A 5C1HA 2RJ5A 1FR9A 2RJ0A 4NAIA 1VGWA 1H7GA 1NWGB 1VZXA 3OH3A 5CQMX 5CMJA 2O1HA 3D8VA 5CMGX 1NQIB 5C48A 5FYEA 1TZFA 5CMHA 3V0MA 3Q4SA 2W0VA 4KPZA 5CQNX 3PKPA 5FTVA 1MP4A 4Y7FA 3Q80A 4KQLA 5CQPA 4KXOA 1R7YA 2P73A 3CKJA 3I0CA 2W0WA 3SPTA 4Y9XA 4ASYA 4FRLA 1ON8A 2OI5A 1G9RA 1ZIZA 5CMFX 3SX3A 2XWLA 5DDVA 3I0EA 3I0LA 5CMIA 1H7FA 4FIXA 2A8UA 1HM0A 1WT0A 5AJPA 3USQA 1R81A 3OGZA 1KWSA 3OC9A 4J18A 1QGSA 4FRQA 2XWNA 4Y7GA 3ST8A 3I0HA 3OH4A 2YQJA 1GA8A 1H4EA 1S4NA 3JTJA 3R3IA 2AECA 4UEGA 2WEEA 4KNRA 4M2AA 2YC5A 5JQQA 3OH1A 3ZF8A 1H7EA 4KC2A 2MZBA 1ZCTA 1INIA 1JYLA 4EEAA 3K8DA 1H5SB 5HS2A 4Y62A 3SXGA 1O7OA 2Z86A 4B42A 1NMMB 3V91A 1W57A 1JYKA 4K6RA 1LZJA 1HJJA 1R7TA 4Y7VA 4Y7UA 1H7TA 1EZIA 1G2VA 1LL0A 2APCA 5CQLX 3QVBA 1TVYA 3I0DA 2PX7A 3JUKA 3OKRA 2FY7A 1O0RA 4CJBA 1K4VA 2O1GA 3GUEA 2BO6A 2VFZA 2ICXA 1ZHJA 3NGWA 1YROB 3RMWA 4GBPA 1Z90A 1WT1A 3POLA 1ZI5A 1H5TA 2VXMA 5C3DA 3ZLLA 1NHEB 2A8WA 5J49A 1IIMA 2I7BA 3TQDA 1HV9A 4FRDA 4R7PA 1XHBA 2XWMA 2AE7A 3SX5A 4E1KA 5C3BA 4MYBA 4AAWA 3V0LA 3DUVA 4BMAA 2D0JA 3ZGGA 1V82A 4FRHA 4M28A 1VICA 2VS4A 4M2BA 5C4CA 5C3AA 1W55A 4FQWA 1JV3A 2PGVA 1GWWA 3Q7UA 2RJ6A 3U2XA 2Y7AA 4B2XA 2D7IA 3RSBA 1ZCUA 4HOCA 1MC3A 1MP3A 4EEMA 4IRPA 1YP4A 3I0KA 2OI6A 4Y63A 5C4DA 2YQSA 4HG6A 1FGXA 4FIYA 4FRAA 1VGTA 2YC3A 2WE9A 1FZWA 2XMHA 1H3MA 5C36A 1FG5N 5D91A 1JVGA 4EE3A 3CKNA 1G23A 1PZTA 5C47A 3FWWA 3OAMA 1ZI4A 1O7QA 1R82A 4EEOA 3PNNA 2ZU9A 4D11A 1PZYB 2VD4A 1H5RA 4JD0A 1G95A 2FYCB 3SX7A 3K8EA 1GX4A 4KRVA 5EIYA 2JCKA 4D0TA 3CKQA 3CKVA 1H7QA 3V0NA 4NALA 2OI7A 2AM4A 2Y4JA 2RIXA 2DPWA 3CU0A 2QKXA 3V90A 4HCQA 1GWVA 3SXAA 1WVCA 5IDSA 4FRBA 1LZIA 2X5ZA 2OEGA 4G3PA 3KIAA 4CVHA 1NKHB 1TW1A 1ZI3A 2RITA 3F1YA 2VS5A 2AH9A 3V0PA 1R80A 2VK9A 4KT7A 3JUJA 4EVWA 1ZCVA 4Q7CA 1H4DA 1GQ9A 2V0HA 4HO0A 1ON6A 2VSIA 4ASJA 5AJOA 5C4FA 4B4MA 1G97A 3BCVA 2AM5A 5FTSA 4DDZA 5IFYA 2VSHA 2UX8A 1WSZA 4AYLA 4NAKA 3BRKX 4HO4A 4B5BA 3U2UA 1EYRA 4LW6A 2AGDA 1IINA 5IDTA 1ZJPA 4G3QA 1JVDA 1VH1A 3T7OA 2WVLA 1E5KA 2O1FA 5I1FA 5EJZA 3R2WA 3OH2A 2ZU8A 4O6NA 4Y6NA 3RMVA 1O23B 4Y64A 5C8RA 2QH5A 2GGQA 1H7LA 3OH0A 4HO6A 2V0IA 1LZ7A 3V8ZA 1XZ6A 2V0JA 3CGXA 3U2VA 3DJ4A 4IRQA 1H5SD 1SS9A 1VGZA 4AYJA 2Q4JA 2X65A 3I0IX 1QWJA 4G87A 5DDTA 2RIZA 2NXVA 2Y4KA 1NF5B 2RIYA 1QGQA 3I0JA 2V0KA 3CKOA 5C1LA 4KC4A 2WAWA 4YS8A 1LL3A 1R7VA 1FR8A 2RJ7A 1FO8A 3N9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HO8 A;  1TW5 A;  1R7U A;  2RJ9 A;  4FRM A;  2AM3 A;  4NAN A;  4HO5 A;  2V0L A;  4D11 C;  1GX0 A;  2CU2 A;  4KNX A;  2GGO A;  1H5S A;  2Y4L A;  4XWI A;  2FFU A;  2Y6P A;  3D98 A;  4C2S A;  4EEG A;  4M4K A;  3F1C A;  4B4B A;  2RJ4 A;  1S4O A;  2FYD B;  5EJ1 A;  1R7X A;  2VS3 A;  5C1G A;  1LL2 A;  2X60 A;  1ZJ0 A;  3DK5 A;  4Y7T A;  3T7M A;  4G3S A;  2D7R A;  3V0Q A;  2BO8 A;  5CQO A;  3SXD A;  2P72 A;  3D5N A;  1HM9 A;  4ECM A;  1QG8 A;  2WVM A;  3V8Y A;  1H5T B;  5FV9 A;  2ICY A;  2X5S A;  4HO9 A;  2FYB A;  3U0X A;  2PGY A;  4D0Z A;  2P6W A;  5AJN A;  3E25 A;  2YES A;  3FOQ A;  1FXJ A;  1VZU A;  1ZDF A;  1ZJ3 A;  1ZJ2 A;  4EE4 A;  3O3P A;  1FWY A;  1FRW A;  5L6V A;  1G8O A;  3PKQ A;  3T7N A;  2RJ1 A;  1FOA A;  3ZGF A;  2WVK A;  4D48 A;  1G1L A;  1ZJO A;  1G93 A;  1YP3 A;  5FUH A;  5C38 A;  4B4G A;  3V0O A;  1JV1 A;  2JCJ A;  1OMZ A;  4DEC A;  1LVW A;  2AES A;  1VGU A;  4JIS A;  3IOH A;  5FU8 A;  4P00 A;  4FCE A;  2JCO A;  3USR A;  1ZCY A;  3HL3 A;  1GQC A;  2I5E A;  4HO2 A;  1HM8 A;  1MP5 A;  4FRO A;  1WT3 A;  3ZLK A;  3U0Y A;  1HJL A;  3SXB A;  1INJ A;  3IOI A;  3EE5 A;  5C4B A;  4Y6U A;  3SXC A;  2JCL A;  4LW3 A;  2YCM A;  4EE5 A;  1FGG A;  2YQC A;  4FCU A;  3U2T A;  4FRP A;  1V83 A;  1ZDG A;  1H5R B;  1OMX A;  1VM8 A;  2RJ8 A;  1S4P A;  1YP2 A;  4B2W A;  2E3D A;  2I5K A;  4L41 C;  1I52 A;  2QGI A;  4KC1 A;  4KPX A;  4BQH A;  2XME A;  1LZ0 A;  2YQH A;  1VPA A;  1ZI1 A;  5BXC A;  1FXO A;  2BO7 A;  2Y4M A;  5L6S A;  1V84 A;  1W77 A;  1OQM B;  2VXL A;  4MND A;  1VZT A;  2BO4 A;  1G3L A;  2FYA A;  1H5S C;  2PA4 A;  2OEF A;  4CJ8 A;  1ZJ1 A;  4B3U A;  1WT2 A;  3I0F A;  3SX8 A;  2ZU7 A;  3LW6 A;  4AC3 A;  2FFV A;  3U2W A;  4ARW A;  1G0R A;  1H4C A;  1FO9 A;  3TZT A;  4DE7 A;  1H7H A;  5FU0 A;  2Z87 A;  5C4E A;  4CJC A;  3I0G A;  3E26 A;  3IOJ A;  4FRE A;  5C49 A;  1VH3 A;  2E8B A;  4P02 A;  2WGZ A;  3SXE A;  4ZDQ A;  4HO3 A;  5C1H A;  2RJ5 A;  1FR9 A;  2RJ0 A;  4NAI A;  1VGW A;  1H7G A;  1NWG B;  1VZX A;  3OH3 A;  5CQM X;  5CMJ A;  2O1H A;  3D8V A;  5CMG X;  1NQI B;  5C48 A;  5FYE A;  1TZF A;  5CMH A;  3V0M A;  3Q4S A;  2W0V A;  4KPZ A;  5CQN X;  3PKP A;  5FTV A;  1MP4 A;  4Y7F A;  3Q80 A;  4KQL A;  5CQP A;  4KXO A;  1R7Y A;  2P73 A;  3CKJ A;  3I0C A;  2W0W A;  3SPT A;  4Y9X A;  4ASY A;  4FRL A;  1ON8 A;  2OI5 A;  1G9R A;  1ZIZ A;  5CMF X;  3SX3 A;  2XWL A;  5DDV A;  3I0E A;  3I0L A;  5CMI A;  1H7F A;  2A8U A;  1HM0 A;  1WT0 A;  5AJP A;  3USQ A;  1R81 A;  3OGZ A;  1KWS A;  3OC9 A;  4J18 A;  1QGS A;  4FRQ A;  2XWN A;  4Y7G A;  3ST8 A;  3I0H A;  3OH4 A;  2YQJ A;  1GA8 A;  1H4E A;  1S4N A;  3JTJ A;  3R3I A;  2AEC A;  4UEG A;  2WEE A;  4KNR A;  4M2A A;  2YC5 A;  5JQQ A;  3OH1 A;  3ZF8 A;  1H7E A;  4KC2 A;  2MZB A;  1ZCT A;  1INI A;  1JYL A;  4EEA A;  3K8D A;  1H5S B;  5HS2 A;  4Y62 A;  3SXG A;  1O7O A;  2Z86 A;  4B42 A;  1NMM B;  3V91 A;  1W57 A;  1JYK A;  4K6R A;  1LZJ A;  1HJJ A;  1R7T A;  4Y7V A;  4Y7U A;  1H7T A;  1EZI A;  1G2V A;  1LL0 A;  2APC A;  5CQL X;  3QVB A;  1TVY A;  3I0D A;  2PX7 A;  3JUK A;  3OKR A;  2FY7 A;  1O0R A;  4CJB A;  1K4V A;  2O1G A;  3GUE A;  2BO6 A;  2VFZ A;  2ICX A;  1ZHJ A;  3NGW A;  1YRO B;  3RMW A;  4GBP A;  1Z90 A;  1WT1 A;  3POL A;  1ZI5 A;  1H5T A;  2VXM A;  5C3D A;  3ZLL A;  1NHE B;  2A8W A;  5J49 A;  1IIM A;  2I7B A;  3TQD A;  1HV9 A;  4FRD A;  4R7P A;  1XHB A;  2XWM A;  2AE7 A;  3SX5 A;  4E1K A;  5C3B A;  4MYB A;  4AAW A;  3V0L A;  3DUV A;  4BMA A;  2D0J A;  3ZGG A;  1V82 A;  4FRH A;  4M28 A;  1VIC A;  2VS4 A;  4M2B A;  5C4C A;  5C3A A;  1W55 A;  4FQW A;  1JV3 A;  2PGV A;  1GWW A;  3Q7U A;  2RJ6 A;  3U2X A;  2Y7A A;  4B2X A;  2D7I A;  3RSB A;  1ZCU A;  4HOC A;  1MC3 A;  1MP3 A;  4EEM A;  4IRP A;  1YP4 A;  3I0K A;  2OI6 A;  4Y63 A;  5C4D A;  2YQS A;  4HG6 A;  1FGX A;  4FRA A;  1VGT A;  2YC3 A;  2WE9 A;  1FZW A;  2XMH A;  1H3M A;  5C36 A;  1FG5 N;  1JVG A;  4EE3 A;  3CKN A;  1G23 A;  1PZT A;  5C47 A;  3FWW A;  3OAM A;  1ZI4 A;  1O7Q A;  1R82 A;  4EEO A;  3PNN A;  2ZU9 A;  4D11 A;  1PZY B;  2VD4 A;  1H5R A;  4JD0 A;  1G95 A;  2FYC B;  3SX7 A;  3K8E A;  1GX4 A;  4KRV A;  5EIY A;  2JCK A;  4D0T A;  3CKQ A;  3CKV A;  1H7Q A;  3V0N A;  4NAL A;  2OI7 A;  2AM4 A;  2Y4J A;  2RIX A;  2DPW A;  3CU0 A;  2QKX A;  3V90 A;  4HCQ A;  1GWV A;  3SXA A;  1WVC A;  5IDS A;  4FRB A;  1LZI A;  2X5Z A;  2OEG A;  4G3P A;  3KIA A;  4CVH A;  1NKH B;  1TW1 A;  1ZI3 A;  2RIT A;  3F1Y A;  2VS5 A;  2AH9 A;  3V0P A;  1R80 A;  4KT7 A;  3JUJ A;  4EVW A;  1ZCV A;  1H4D A;  1GQ9 A;  2V0H A;  4HO0 A;  1ON6 A;  2VSI A;  4ASJ A;  5AJO A;  5C4F A;  4B4M A;  1G97 A;  3BCV A;  2AM5 A;  5FTS A;  4DDZ A;  5IFY A;  2VSH A;  2UX8 A;  1WSZ A;  4AYL A;  4NAK A;  3BRK X;  4HO4 A;  4B5B A;  3U2U A;  1EYR A;  4LW6 A;  2AGD A;  1IIN A;  5IDT A;  1ZJP A;  4G3Q A;  1JVD A;  1VH1 A;  3T7O A;  2WVL A;  1E5K A;  2O1F A;  5I1F A;  5EJZ A;  3R2W A;  3OH2 A;  2ZU8 A;  4Y6N A;  3RMV A;  1O23 B;  4Y64 A;  5C8R A;  2QH5 A;  2GGQ A;  1H7L A;  3OH0 A;  4HO6 A;  2V0I A;  1LZ7 A;  3V8Z A;  1XZ6 A;  2V0J A;  3CGX A;  3U2V A;  3DJ4 A;  4IRQ A;  1H5S D;  1SS9 A;  1VGZ A;  4AYJ A;  2Q4J A;  2X65 A;  3I0I X;  1QWJ A;  4G87 A;  5DDT A;  2RIZ A;  2NXV A;  2Y4K A;  1NF5 B;  2RIY A;  1QGQ A;  3I0J A;  2V0K A;  3CKO A;  5C1L A;  4KC4 A;  2WAW A;  4YS8 A;  1LL3 A;  1R7V A;  1FR8 A;  2RJ7 A;  1FO8 A;  3N9W A; 
#chains in the Genus database with same CATH topology
 4HO8 A;  1TW5 A;  1R7U A;  2RJ9 A;  4FRM A;  2AM3 A;  4NAN A;  4HO5 A;  2V0L A;  4D11 C;  1GX0 A;  2CU2 A;  4KNX A;  2GGO A;  1H5S A;  2Y4L A;  4XWI A;  2FFU A;  2Y6P A;  3D98 A;  4C2S A;  4EEG A;  4M4K A;  3F1C A;  4B4B A;  2RJ4 A;  1S4O A;  2FYD B;  5EJ1 A;  1R7X A;  2VS3 A;  5C1G A;  1LL2 A;  2X60 A;  1ZJ0 A;  3DK5 A;  4Y7T A;  3T7M A;  4G3S A;  2D7R A;  3V0Q A;  2BO8 A;  5CQO A;  3SXD A;  2P72 A;  3D5N A;  1HM9 A;  4ECM A;  1QG8 A;  2WVM A;  3V8Y A;  1H5T B;  5FV9 A;  2ICY A;  2X5S A;  4HO9 A;  2FYB A;  3U0X A;  2PGY A;  4D0Z A;  2P6W A;  5AJN A;  3E25 A;  2YES A;  3FOQ A;  1FXJ A;  1VZU A;  1ZDF A;  2C0N A;  1ZJ3 A;  1ZJ2 A;  4EE4 A;  3O3P A;  1FWY A;  1FRW A;  5L6V A;  1G8O A;  3PKQ A;  3T7N A;  2RJ1 A;  1FOA A;  3ZGF A;  2WVK A;  4D48 A;  1G1L A;  1ZJO A;  1G93 A;  1YP3 A;  5FUH A;  5C38 A;  4B4G A;  3V0O A;  1JV1 A;  2JCJ A;  1OMZ A;  4DEC A;  1LVW A;  5D92 A;  2AES A;  4O6M A;  1VGU A;  4JIS A;  3IOH A;  5FU8 A;  4P00 A;  4FCE A;  2JCO A;  3USR A;  1ZCY A;  3HL3 A;  1GQC A;  2I5E A;  4HO2 A;  4MIX A;  1HM8 A;  1MP5 A;  4FRO A;  1WT3 A;  3ZLK A;  3U0Y A;  1HJL A;  3SXB A;  1INJ A;  3IOI A;  3EE5 A;  5C4B A;  4Y6U A;  3SXC A;  2JCL A;  4LW3 A;  2YCM A;  4EE5 A;  1FGG A;  2YQC A;  4FCU A;  3U2T A;  4FRP A;  1V83 A;  1ZDG A;  1H5R B;  1OMX A;  1VM8 A;  2RJ8 A;  1S4P A;  1YP2 A;  4B2W A;  2E3D A;  2I5K A;  4L41 C;  1I52 A;  2QGI A;  2J0A A;  4KC1 A;  4KPX A;  4BQH A;  2XME A;  1LZ0 A;  2YQH A;  1VPA A;  1ZI1 A;  5BXC A;  1FXO A;  2BO7 A;  2Y4M A;  5L6S A;  1V84 A;  1W77 A;  1OQM B;  2VXL A;  4MND A;  1VZT A;  2BO4 A;  1G3L A;  2FYA A;  1H5S C;  2PA4 A;  2OEF A;  4CJ8 A;  1ZJ1 A;  4B3U A;  2J0B A;  1WT2 A;  3I0F A;  3SX8 A;  2ZU7 A;  3LW6 A;  4AC3 A;  2FFV A;  3U2W A;  4ARW A;  1G0R A;  1H4C A;  1FO9 A;  3TZT A;  4DE7 A;  1H7H A;  5FU0 A;  2Z87 A;  5C4E A;  4CJC A;  3I0G A;  3E26 A;  3IOJ A;  4FRE A;  5C49 A;  1VH3 A;  2E8B A;  4P02 A;  2WGZ A;  3SXE A;  4ZDQ A;  4HO3 A;  5C1H A;  2RJ5 A;  1FR9 A;  2RJ0 A;  4NAI A;  1VGW A;  1H7G A;  1NWG B;  1VZX A;  3OH3 A;  5CQM X;  5CMJ A;  2O1H A;  3D8V A;  5CMG X;  1NQI B;  5C48 A;  5FYE A;  1TZF A;  5CMH A;  3V0M A;  3Q4S A;  2W0V A;  4KPZ A;  5CQN X;  3PKP A;  5FTV A;  1MP4 A;  4Y7F A;  3Q80 A;  4KQL A;  5CQP A;  4KXO A;  1R7Y A;  2P73 A;  3CKJ A;  3I0C A;  2W0W A;  3SPT A;  4Y9X A;  4ASY A;  4FRL A;  1ON8 A;  2OI5 A;  1G9R A;  1ZIZ A;  5CMF X;  3SX3 A;  2XWL A;  5DDV A;  3I0E A;  3I0L A;  5CMI A;  1H7F A;  4FIX A;  2A8U A;  1HM0 A;  1WT0 A;  5AJP A;  3USQ A;  1R81 A;  3OGZ A;  1KWS A;  3OC9 A;  4J18 A;  1QGS A;  4FRQ A;  2XWN A;  4Y7G A;  3ST8 A;  3I0H A;  3OH4 A;  2YQJ A;  1GA8 A;  1H4E A;  1S4N A;  3JTJ A;  3R3I A;  2AEC A;  4UEG A;  2WEE A;  4KNR A;  4M2A A;  2YC5 A;  5JQQ A;  3OH1 A;  3ZF8 A;  1H7E A;  4KC2 A;  2MZB A;  1ZCT A;  1INI A;  1JYL A;  4EEA A;  3K8D A;  1H5S B;  5HS2 A;  4Y62 A;  3SXG A;  1O7O A;  2Z86 A;  4B42 A;  1NMM B;  3V91 A;  1W57 A;  1JYK A;  4K6R A;  1LZJ A;  1HJJ A;  1R7T A;  4Y7V A;  4Y7U A;  1H7T A;  1EZI A;  1G2V A;  1LL0 A;  2APC A;  5CQL X;  3QVB A;  1TVY A;  3I0D A;  2PX7 A;  3JUK A;  3OKR A;  2FY7 A;  1O0R A;  4CJB A;  1K4V A;  2O1G A;  3GUE A;  2BO6 A;  2VFZ A;  2ICX A;  1ZHJ A;  3NGW A;  1YRO B;  3RMW A;  4GBP A;  1Z90 A;  1WT1 A;  3POL A;  1ZI5 A;  1H5T A;  2VXM A;  5C3D A;  3ZLL A;  1NHE B;  2A8W A;  5J49 A;  1IIM A;  2I7B A;  3TQD A;  1HV9 A;  4FRD A;  4R7P A;  1XHB A;  2XWM A;  2AE7 A;  3SX5 A;  4E1K A;  5C3B A;  4MYB A;  4AAW A;  3V0L A;  3DUV A;  4BMA A;  2D0J A;  3ZGG A;  1V82 A;  4FRH A;  4M28 A;  1VIC A;  2VS4 A;  4M2B A;  5C4C A;  5C3A A;  1W55 A;  4FQW A;  1JV3 A;  2PGV A;  1GWW A;  3Q7U A;  2RJ6 A;  3U2X A;  2Y7A A;  4B2X A;  2D7I A;  3RSB A;  1ZCU A;  4HOC A;  1MC3 A;  1MP3 A;  4EEM A;  4IRP A;  1YP4 A;  3I0K A;  2OI6 A;  4Y63 A;  5C4D A;  2YQS A;  4HG6 A;  1FGX A;  4FIY A;  4FRA A;  1VGT A;  2YC3 A;  2WE9 A;  1FZW A;  2XMH A;  1H3M A;  5C36 A;  1FG5 N;  5D91 A;  1JVG A;  4EE3 A;  3CKN A;  1G23 A;  1PZT A;  5C47 A;  3FWW A;  3OAM A;  1ZI4 A;  1O7Q A;  1R82 A;  4EEO A;  3PNN A;  2ZU9 A;  4D11 A;  1PZY B;  2VD4 A;  1H5R A;  4JD0 A;  1G95 A;  2FYC B;  3SX7 A;  3K8E A;  1GX4 A;  4KRV A;  5EIY A;  2JCK A;  4D0T A;  3CKQ A;  3CKV A;  1H7Q A;  3V0N A;  4NAL A;  2OI7 A;  2AM4 A;  2Y4J A;  2RIX A;  2DPW A;  3CU0 A;  2QKX A;  3V90 A;  4HCQ A;  1GWV A;  3SXA A;  1WVC A;  5IDS A;  4FRB A;  1LZI A;  2X5Z A;  2OEG A;  4G3P A;  3KIA A;  4CVH A;  1NKH B;  1TW1 A;  1ZI3 A;  2RIT A;  3F1Y A;  2VS5 A;  2AH9 A;  3V0P A;  1R80 A;  2VK9 A;  4KT7 A;  3JUJ A;  4EVW A;  1ZCV A;  4Q7C A;  1H4D A;  1GQ9 A;  2V0H A;  4HO0 A;  1ON6 A;  2VSI A;  4ASJ A;  5AJO A;  5C4F A;  4B4M A;  1G97 A;  3BCV A;  2AM5 A;  5FTS A;  4DDZ A;  5IFY A;  2VSH A;  2UX8 A;  1WSZ A;  4AYL A;  4NAK A;  3BRK X;  4HO4 A;  4B5B A;  3U2U A;  1EYR A;  4LW6 A;  2AGD A;  1IIN A;  5IDT A;  1ZJP A;  4G3Q A;  1JVD A;  1VH1 A;  3T7O A;  2WVL A;  1E5K A;  2O1F A;  5I1F A;  5EJZ A;  3R2W A;  3OH2 A;  2ZU8 A;  4O6N A;  4Y6N A;  3RMV A;  1O23 B;  4Y64 A;  5C8R A;  2QH5 A;  2GGQ A;  1H7L A;  3OH0 A;  4HO6 A;  2V0I A;  1LZ7 A;  3V8Z A;  1XZ6 A;  2V0J A;  3CGX A;  3U2V A;  3DJ4 A;  4IRQ A;  1H5S D;  1SS9 A;  1VGZ A;  4AYJ A;  2Q4J A;  2X65 A;  3I0I X;  1QWJ A;  4G87 A;  5DDT A;  2RIZ A;  2NXV A;  2Y4K A;  1NF5 B;  2RIY A;  1QGQ A;  3I0J A;  2V0K A;  3CKO A;  5C1L A;  4KC4 A;  2WAW A;  4YS8 A;  1LL3 A;  1R7V A;  1FR8 A;  2RJ7 A;  1FO8 A;  3N9W A; 
#chains in the Genus database with same CATH homology
 4HO8 A;  1TW5 A;  1R7U A;  2RJ9 A;  4FRM A;  2AM3 A;  4NAN A;  4HO5 A;  2V0L A;  4D11 C;  1GX0 A;  2CU2 A;  4KNX A;  2GGO A;  1H5S A;  2Y4L A;  4XWI A;  2FFU A;  2Y6P A;  3D98 A;  4C2S A;  4EEG A;  4M4K A;  3F1C A;  4B4B A;  2RJ4 A;  1S4O A;  2FYD B;  5EJ1 A;  1R7X A;  2VS3 A;  5C1G A;  1LL2 A;  2X60 A;  1ZJ0 A;  3DK5 A;  4Y7T A;  3T7M A;  4G3S A;  2D7R A;  3V0Q A;  2BO8 A;  5CQO A;  3SXD A;  2P72 A;  3D5N A;  1HM9 A;  4ECM A;  1QG8 A;  2WVM A;  3V8Y A;  1H5T B;  5FV9 A;  2ICY A;  2X5S A;  4HO9 A;  2FYB A;  3U0X A;  2PGY A;  4D0Z A;  2P6W A;  5AJN A;  3E25 A;  2YES A;  3FOQ A;  1FXJ A;  1VZU A;  1ZDF A;  2C0N A;  1ZJ3 A;  1ZJ2 A;  4EE4 A;  3O3P A;  1FWY A;  1FRW A;  5L6V A;  1G8O A;  3PKQ A;  3T7N A;  2RJ1 A;  1FOA A;  3ZGF A;  2WVK A;  4D48 A;  1G1L A;  1ZJO A;  1G93 A;  1YP3 A;  5FUH A;  5C38 A;  4B4G A;  3V0O A;  1JV1 A;  2JCJ A;  1OMZ A;  4DEC A;  1LVW A;  5D92 A;  2AES A;  4O6M A;  1VGU A;  4JIS A;  3IOH A;  5FU8 A;  4P00 A;  4FCE A;  2JCO A;  3USR A;  1ZCY A;  3HL3 A;  1GQC A;  2I5E A;  4HO2 A;  4MIX A;  1HM8 A;  1MP5 A;  4FRO A;  1WT3 A;  3ZLK A;  3U0Y A;  1HJL A;  3SXB A;  1INJ A;  3IOI A;  3EE5 A;  5C4B A;  4Y6U A;  3SXC A;  2JCL A;  4LW3 A;  2YCM A;  4EE5 A;  1FGG A;  2YQC A;  4FCU A;  3U2T A;  4FRP A;  1V83 A;  1ZDG A;  1H5R B;  1OMX A;  1VM8 A;  2RJ8 A;  1S4P A;  1YP2 A;  4B2W A;  2E3D A;  2I5K A;  4L41 C;  1I52 A;  2QGI A;  2J0A A;  4KC1 A;  4KPX A;  4BQH A;  2XME A;  1LZ0 A;  2YQH A;  1VPA A;  1ZI1 A;  5BXC A;  1FXO A;  2BO7 A;  2Y4M A;  5L6S A;  1V84 A;  1W77 A;  1OQM B;  2VXL A;  4MND A;  1VZT A;  2BO4 A;  1G3L A;  2FYA A;  1H5S C;  2PA4 A;  2OEF A;  4CJ8 A;  1ZJ1 A;  4B3U A;  2J0B A;  1WT2 A;  3I0F A;  3SX8 A;  2ZU7 A;  3LW6 A;  4AC3 A;  2FFV A;  3U2W A;  4ARW A;  1G0R A;  1H4C A;  1FO9 A;  3TZT A;  4DE7 A;  1H7H A;  5FU0 A;  2Z87 A;  5C4E A;  4CJC A;  3I0G A;  3E26 A;  3IOJ A;  4FRE A;  5C49 A;  1VH3 A;  2E8B A;  4P02 A;  2WGZ A;  3SXE A;  4ZDQ A;  4HO3 A;  5C1H A;  2RJ5 A;  1FR9 A;  2RJ0 A;  4NAI A;  1VGW A;  1H7G A;  1NWG B;  1VZX A;  3OH3 A;  5CQM X;  5CMJ A;  2O1H A;  3D8V A;  5CMG X;  1NQI B;  5C48 A;  5FYE A;  1TZF A;  5CMH A;  3V0M A;  3Q4S A;  2W0V A;  4KPZ A;  5CQN X;  3PKP A;  5FTV A;  1MP4 A;  4Y7F A;  3Q80 A;  4KQL A;  5CQP A;  4KXO A;  1R7Y A;  2P73 A;  3CKJ A;  3I0C A;  2W0W A;  3SPT A;  4Y9X A;  4ASY A;  4FRL A;  1ON8 A;  2OI5 A;  1G9R A;  1ZIZ A;  5CMF X;  3SX3 A;  2XWL A;  5DDV A;  3I0E A;  3I0L A;  5CMI A;  1H7F A;  4FIX A;  2A8U A;  1HM0 A;  1WT0 A;  5AJP A;  3USQ A;  1R81 A;  3OGZ A;  1KWS A;  3OC9 A;  4J18 A;  1QGS A;  4FRQ A;  2XWN A;  4Y7G A;  3ST8 A;  3I0H A;  3OH4 A;  2YQJ A;  1GA8 A;  1H4E A;  1S4N A;  3JTJ A;  3R3I A;  2AEC A;  4UEG A;  2WEE A;  4KNR A;  4M2A A;  2YC5 A;  5JQQ A;  3OH1 A;  3ZF8 A;  1H7E A;  4KC2 A;  2MZB A;  1ZCT A;  1INI A;  1JYL A;  4EEA A;  3K8D A;  1H5S B;  5HS2 A;  4Y62 A;  3SXG A;  1O7O A;  2Z86 A;  4B42 A;  1NMM B;  3V91 A;  1W57 A;  1JYK A;  4K6R A;  1LZJ A;  1HJJ A;  1R7T A;  4Y7V A;  4Y7U A;  1H7T A;  1EZI A;  1G2V A;  1LL0 A;  2APC A;  5CQL X;  3QVB A;  1TVY A;  3I0D A;  2PX7 A;  3JUK A;  3OKR A;  2FY7 A;  1O0R A;  4CJB A;  1K4V A;  2O1G A;  3GUE A;  2BO6 A;  2VFZ A;  2ICX A;  1ZHJ A;  3NGW A;  1YRO B;  3RMW A;  4GBP A;  1Z90 A;  1WT1 A;  3POL A;  1ZI5 A;  1H5T A;  2VXM A;  5C3D A;  3ZLL A;  1NHE B;  2A8W A;  5J49 A;  1IIM A;  2I7B A;  3TQD A;  1HV9 A;  4FRD A;  4R7P A;  1XHB A;  2XWM A;  2AE7 A;  3SX5 A;  4E1K A;  5C3B A;  4MYB A;  4AAW A;  3V0L A;  3DUV A;  4BMA A;  2D0J A;  3ZGG A;  1V82 A;  4FRH A;  4M28 A;  1VIC A;  2VS4 A;  4M2B A;  5C4C A;  5C3A A;  1W55 A;  4FQW A;  1JV3 A;  2PGV A;  1GWW A;  3Q7U A;  2RJ6 A;  3U2X A;  2Y7A A;  4B2X A;  2D7I A;  3RSB A;  1ZCU A;  4HOC A;  1MC3 A;  1MP3 A;  4EEM A;  4IRP A;  1YP4 A;  3I0K A;  2OI6 A;  4Y63 A;  5C4D A;  2YQS A;  4HG6 A;  1FGX A;  4FIY A;  4FRA A;  1VGT A;  2YC3 A;  2WE9 A;  1FZW A;  2XMH A;  1H3M A;  5C36 A;  1FG5 N;  5D91 A;  1JVG A;  4EE3 A;  3CKN A;  1G23 A;  1PZT A;  5C47 A;  3FWW A;  3OAM A;  1ZI4 A;  1O7Q A;  1R82 A;  4EEO A;  3PNN A;  2ZU9 A;  4D11 A;  1PZY B;  2VD4 A;  1H5R A;  4JD0 A;  1G95 A;  2FYC B;  3SX7 A;  3K8E A;  1GX4 A;  4KRV A;  5EIY A;  2JCK A;  4D0T A;  3CKQ A;  3CKV A;  1H7Q A;  3V0N A;  4NAL A;  2OI7 A;  2AM4 A;  2Y4J A;  2RIX A;  2DPW A;  3CU0 A;  2QKX A;  3V90 A;  4HCQ A;  1GWV A;  3SXA A;  1WVC A;  5IDS A;  4FRB A;  1LZI A;  2X5Z A;  2OEG A;  4G3P A;  3KIA A;  4CVH A;  1NKH B;  1TW1 A;  1ZI3 A;  2RIT A;  3F1Y A;  2VS5 A;  2AH9 A;  3V0P A;  1R80 A;  2VK9 A;  4KT7 A;  3JUJ A;  4EVW A;  1ZCV A;  4Q7C A;  1H4D A;  1GQ9 A;  2V0H A;  4HO0 A;  1ON6 A;  2VSI A;  4ASJ A;  5AJO A;  5C4F A;  4B4M A;  1G97 A;  3BCV A;  2AM5 A;  5FTS A;  4DDZ A;  5IFY A;  2VSH A;  2UX8 A;  1WSZ A;  4AYL A;  4NAK A;  3BRK X;  4HO4 A;  4B5B A;  3U2U A;  1EYR A;  4LW6 A;  2AGD A;  1IIN A;  5IDT A;  1ZJP A;  4G3Q A;  1JVD A;  1VH1 A;  3T7O A;  2WVL A;  1E5K A;  2O1F A;  5I1F A;  5EJZ A;  3R2W A;  3OH2 A;  2ZU8 A;  4O6N A;  4Y6N A;  3RMV A;  1O23 B;  4Y64 A;  5C8R A;  2QH5 A;  2GGQ A;  1H7L A;  3OH0 A;  4HO6 A;  2V0I A;  1LZ7 A;  3V8Z A;  1XZ6 A;  2V0J A;  3CGX A;  3U2V A;  3DJ4 A;  4IRQ A;  1H5S D;  1SS9 A;  1VGZ A;  4AYJ A;  2Q4J A;  2X65 A;  3I0I X;  1QWJ A;  4G87 A;  5DDT A;  2RIZ A;  2NXV A;  2Y4K A;  1NF5 B;  2RIY A;  1QGQ A;  3I0J A;  2V0K A;  3CKO A;  5C1L A;  4KC4 A;  2WAW A;  4YS8 A;  1LL3 A;  1R7V A;  1FR8 A;  2RJ7 A;  1FO8 A;  3N9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...