3IOIA

Crystal structure of the fucosylgalactoside alpha n-acetylgalactosaminyltransferase (gta, cisab mutant l266g, g268a) in complex with a novel udp-gal derived inhibitor (1gw)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
282
structure length
274
Chain Sequence
SLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYGGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histo-blood group ABO system transferase
publication title Structural and mechanistic basis for a new mode of glycosyltransferase inhibition.
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 274
sequence length 282
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2009-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3ioiA00
4ASJA 5IDTA 1I52A 4KNXA 3I0KA 1HM0A 1QGSA 2DPWA 1E5KA 4Y6NA 1OMXA 4M2BA 1ZJOA 1GWVA 1W55A 1LL3A 3RMWA 3IOJA 3CU0A 2D7IA 2I5EA 2XWLA 2Z86A 5C48A 1KWSA 1OQMB 2XMEA 3O3PA 4M4KA 5AJNA 1FOAA 4Y7VA 1GQ9A 2RIXA 3OH0A 2FFVA 4KQLA 2Y7AA 3I0LA 4P02A 2YQSA 3Q7UA 1JYLA 1TZFA 1ZI1A 5AJPA 2BO4A 1S4NA 5FV9A 1H7HA 1WT2A 1ZI5A 4NALA 1R7TA 1HM9A 1TW1A 1QGQA 4M2AA 1S4OA 1FGGA 2ZU7A 1MP4A 4FRMA 4HO3A 4EVWA 1GX0A 3Q4SA 2Y4KA 2ZU8A 3GUEA 1VPAA 3USQA 4KC1A 3V8YA 5HS2A 3DK5A 1V84A 2WE9A 4G3SA 4B4GA 1QG8A 3Q80A 1WT3A 3K8EA 5L6VA 1H3MA 2P6WA 4IRPA 3RSBA 3FOQA 4HO8A 2BO6A 1H7EA 4MNDA 2QGIA 1FWYA 1HM8A 5CMHA 2GGOA 3D8VA 2VXLA 1G23A 4NANA 1H5SA 2YCMA 3RMVA 3PKQA 3OKRA 2I7BA 2E3DA 2O1GA 2AESA 2RJ1A 4EE5A 1JV3A 1ZDFA 4FRLA 3ZLKA 5C49A 2PGVA 2AM5A 3EE5A 3BRKX 4XWIA 2WVKA 4B42A 1NWGB 5FU8A 2V0LA 2WVLA 5C4EA 1FO8A 1ZDGA 2YQHA 3ZGFA 1YP4A 5C8RA 5CMJA 5EIYA 3V90A 3T7OA 1H5TB 3U2XA 1G2VA 2FYAA 4HO9A 3OH1A 2PGYA 4EEAA 1WT1A 1H7GA 3D5NA 4Y9XA 5CQLX 2D0JA 3BCVA 3SX3A 3V91A 1H5SB 3D98A 2V0IA 3OGZA 4Y7UA 4KRVA 2Y6PA 3SXCA 4G87A 5FTSA 2OEGA 4KC2A 3TZTA 1GWWA 4EEOA 4KPXA 2XWMA 1SS9A 2A8WA 4B3UA 1OMZA 1FXOA 1LZJA 1R80A 4KPZA 2RJ5A 2RJ9A 4B2WA 1VH1A 1G93A 1LZ0A 1W57A 2X65A 4HG6A 4AYJA 2JCJA 4FCUA 4B5BA 1R7UA 2OEFA 3U2VA 1VGTA 4NAIA 1R7XA 1YP2A 2FYDB 2RJ6A 1H5SD 2X5ZA 4KXOA 3E26A 2RJ7A 5C4DA 1ZJ2A 5DDTA 1JV1A 1H5RA 5EJZA 1LL0A 1IIMA 2O1HA 5I1FA 2ZU9A 2OI7A 2V0HA 4D11C 5J49A 3K8DA 2FY7A 2VSHA 3USRA 2YQCA 5JQQA 1FRWA 2Z87A 1R7YA 1PZTA 1ZJ1A 1ZCTA 1GX4A 3R3IA 2YC5A 5C38A 2FYBA 3I0GA 3POLA 4AYLA 4Y6UA 1WVCA 1FGXA 2QH5A 2WAWA 3IOHA 3PNNA 2APCA 4JD0A 1VICA 3E25A 4D48A 2AM3A 4FROA 5FTVA 1H7TA 3V0NA 2VSIA 3OH4A 3FWWA 2AM4A 4FRHA 1H5RB 4ARWA 2JCOA 4FRBA 2RITA 3CKQA 1ZJPA 3CKVA 2QKXA 4NAKA 1G95A 5CMIA 3SPTA 3SXAA 3DUVA 1JVDA 4KT7A 4Y64A 4BQHA 5IDSA 4FREA 3LW6A 2V0KA 4C2SA 3PKPA 4Y62A 5EJ1A 3U2WA 5CQNX 1IINA 1ZCUA 5C1GA 1ZI4A 2WVMA 1LVWA 1VZXA 2PA4A 3JUJA 2WGZA 4HO4A 4Y63A 4CJBA 1ON6A 5FUHA 1XZ6A 1VGZA 2BO7A 1JVGA 4P00A 1K4VA 3KIAA 5FU0A 4DDZA 4LW3A 1ZCVA 1HV9A 1FR8A 3OH2A 3JTJA 1YROB 5FYEA 5C36A 1INIA 1O23B 2V0JA 2RJ0A 4HO5A 3F1YA 2RIZA 1W77A 3U0YA 3ST8A 4AAWA 1ZHJA 1VZTA 3ZGGA 4B4BA 4KNRA 3SXEA 5C4CA 1MC3A 3ZF8A 3N9WA 1G0RA 1H4CA 1O7OA 3T7MA 1FO9A 4G3PA 2Y4LA 4M28A 1H5SC 4KC4A 4B2XA 2BO8A 2FFUA 3QVBA 5C3DA 4R7PA 4YS8A 2JCLA 2E8BA 2GGQA 4FRDA 3I0FA 5CQMX 4Y7FA 1G97A 4Y7GA 3HL3A 4FRQA 4GBPA 2AE7A 1R81A 2CU2A 4BMAA 1EYRA 1MP3A 2RIYA 3SXDA 3F1CA 4AC3A 3I0EA 1QWJA 1G3LA 2UX8A 2P73A 3I0HA 1WSZA 1NQIB 4HO2A 3V0MA 4E1KA 1O0RA 4EEGA 1H4EA 4ZDQA 3U2TA 5BXCA 4CJ8A 4DE7A 2YESA 1TVYA 2X5SA 1VH3A 1O7QA 1LZ7A 2OI6A 4G3QA 3SX5A 1H7LA 1EZIA 5CQPA 2O1FA 3IOIA 2ICYA 1Z90A 1VGUA 4LW6A 3CGXA 5C3AA 1R82A 1S4PA 3NGWA 2JCKA 5CMGX 4HO6A 4UEGA 1XHBA 5CQOA 2P72A 1GQCA 1H4DA 3JUKA 3TQDA 1FZWA 1H7FA 2VS5A 2AGDA 1HJJA 4DECA 1WT0A 2X60A 3OAMA 1NF5B 1NKHB 1FG5N 4FQWA 2I5KA 4FRPA 1FXJA 1ZIZA 3DJ4A 2VS3A 1NMMB 2A8UA 3SX7A 2OI5A 2W0WA 2Q4JA 4ECMA 1GA8A 1G9RA 2RJ4A 4FRAA 2XWNA 4EEMA 1G8OA 3V0LA 3I0DA 2YQJA 1ZJ0A 4J18A 1H7QA 3U0XA 1H5TA 1PZYB 1NHEB 4MYBA 2Y4MA 3U2UA 1ON8A 4B4MA 2XMHA 1VZUA 2RJ8A 3CKJA 4FCEA 4Y7TA 1TW5A 5C1HA 1LZIA 1INJA 3I0CA 3CKOA 2VS4A 5C1LA 2NXVA 2AH9A 2WEEA 3OH3A 3CKNA 4CJCA 5CMFX 2YC3A 1V82A 5C47A 1YP3A 3I0JA 1MP5A 2D7RA 4ASYA 1R7VA 4L41C 4EE3A 4CVHA 4K6RA 2W0VA 5L6SA 2MZBA 3V0PA 3V8ZA 2VFZA 4JISA 2VXMA 1ZCYA 1G1LA 3I0IX 5IFYA 1LL2A 3ZLLA 5DDVA 5AJOA 1ZJ3A 3SXBA 2FYCB 1FR9A 4D0ZA 3R2WA 2VD4A 1HJLA 3SXGA 1JYKA 3OC9A 4IRQA 1VM8A 4D0TA 4HOCA 4D11A 2AECA 1V83A 2Y4JA 3V0QA 3V0OA 3SX8A 4EE4A 5C3BA 3T7NA 4HCQA 5C4FA 5C4BA 1ZI3A 2PX7A 4HO0A 2ICXA 1VGWA
chains in the Genus database with same CATH superfamily
4ASJA 5IDTA 1I52A 4KNXA 3I0KA 1HM0A 1QGSA 2DPWA 1E5KA 4Y6NA 1OMXA 4M2BA 1ZJOA 1GWVA 1W55A 1LL3A 3RMWA 3IOJA 3CU0A 2D7IA 2I5EA 2XWLA 2Z86A 5C48A 1KWSA 1OQMB 2XMEA 3O3PA 4M4KA 5AJNA 1FOAA 4Y7VA 1GQ9A 2RIXA 3OH0A 2FFVA 4KQLA 2Y7AA 3I0LA 4P02A 2YQSA 3Q7UA 1JYLA 1TZFA 1ZI1A 5D91A 5AJPA 2BO4A 1S4NA 5FV9A 1H7HA 1WT2A 1ZI5A 4NALA 1R7TA 1HM9A 1TW1A 1QGQA 4M2AA 1S4OA 1FGGA 2ZU7A 1MP4A 4FRMA 4HO3A 4EVWA 1GX0A 3Q4SA 2Y4KA 2ZU8A 3GUEA 1VPAA 3USQA 4KC1A 3V8YA 5HS2A 3DK5A 1V84A 2WE9A 4G3SA 4B4GA 1QG8A 3Q80A 1WT3A 3K8EA 5L6VA 1H3MA 2P6WA 4IRPA 3RSBA 3FOQA 4HO8A 2BO6A 1H7EA 4MNDA 2QGIA 1FWYA 1HM8A 4O6NA 5CMHA 2GGOA 3D8VA 2VXLA 1G23A 4NANA 1H5SA 2YCMA 3RMVA 3PKQA 3OKRA 2I7BA 2E3DA 2O1GA 2AESA 2RJ1A 5D92A 4EE5A 1JV3A 1ZDFA 4FRLA 3ZLKA 5C49A 2PGVA 2AM5A 3EE5A 3BRKX 4XWIA 2WVKA 4B42A 1NWGB 5FU8A 2V0LA 2WVLA 5C4EA 1FO8A 1ZDGA 2YQHA 3ZGFA 1YP4A 5C8RA 5CMJA 5EIYA 3V90A 3T7OA 1H5TB 3U2XA 1G2VA 2FYAA 4HO9A 3OH1A 2PGYA 4EEAA 1WT1A 1H7GA 3D5NA 4Y9XA 5CQLX 2D0JA 3BCVA 3SX3A 3V91A 1H5SB 3D98A 2V0IA 3OGZA 4Y7UA 4KRVA 2Y6PA 3SXCA 4G87A 5FTSA 2OEGA 4KC2A 3TZTA 1GWWA 4EEOA 4KPXA 2XWMA 1SS9A 2A8WA 4B3UA 1OMZA 1FXOA 1LZJA 1R80A 4KPZA 2RJ5A 2RJ9A 4B2WA 1VH1A 1G93A 1LZ0A 1W57A 2X65A 4HG6A 4AYJA 2JCJA 4FCUA 4B5BA 1R7UA 2OEFA 2J0BA 3U2VA 1VGTA 4NAIA 1R7XA 1YP2A 2FYDB 2RJ6A 1H5SD 2X5ZA 4KXOA 3E26A 2RJ7A 5C4DA 1ZJ2A 5DDTA 1JV1A 1H5RA 5EJZA 1LL0A 1IIMA 2O1HA 5I1FA 2ZU9A 2OI7A 2V0HA 4D11C 5J49A 3K8DA 2FY7A 2VSHA 3USRA 2YQCA 5JQQA 1FRWA 2Z87A 1R7YA 1PZTA 2VK9A 1ZJ1A 1ZCTA 1GX4A 3R3IA 2YC5A 5C38A 2FYBA 3I0GA 3POLA 4AYLA 4Y6UA 1WVCA 1FGXA 2QH5A 2WAWA 3IOHA 3PNNA 2APCA 4JD0A 1VICA 3E25A 4D48A 2AM3A 4FROA 5FTVA 1H7TA 3V0NA 2VSIA 3OH4A 3FWWA 2AM4A 4FRHA 1H5RB 4ARWA 2JCOA 4FIXA 4FRBA 2RITA 3CKQA 1ZJPA 3CKVA 2QKXA 4NAKA 1G95A 5CMIA 3SPTA 3SXAA 3DUVA 1JVDA 4KT7A 4Y64A 4BQHA 5IDSA 4FREA 4MIXA 3LW6A 2V0KA 4C2SA 3PKPA 4Y62A 5EJ1A 3U2WA 5CQNX 1IINA 1ZCUA 5C1GA 1ZI4A 2WVMA 1LVWA 1VZXA 2PA4A 3JUJA 2WGZA 4HO4A 4Y63A 4CJBA 1ON6A 5FUHA 1XZ6A 1VGZA 2BO7A 1JVGA 4P00A 1K4VA 3KIAA 5FU0A 4DDZA 4LW3A 1ZCVA 1HV9A 1FR8A 3OH2A 3JTJA 1YROB 5FYEA 5C36A 1INIA 1O23B 2V0JA 2RJ0A 4HO5A 3F1YA 2RIZA 1W77A 3U0YA 3ST8A 4AAWA 1ZHJA 1VZTA 3ZGGA 4B4BA 4KNRA 3SXEA 5C4CA 1MC3A 3ZF8A 3N9WA 1G0RA 1H4CA 1O7OA 3T7MA 1FO9A 4G3PA 2Y4LA 4M28A 1H5SC 4KC4A 4B2XA 2BO8A 2FFUA 3QVBA 2C0NA 5C3DA 4R7PA 4YS8A 2JCLA 2E8BA 2GGQA 4FRDA 3I0FA 5CQMX 4Y7FA 1G97A 4Y7GA 3HL3A 4FRQA 4GBPA 2AE7A 1R81A 2CU2A 4BMAA 1EYRA 1MP3A 2RIYA 3SXDA 3F1CA 4AC3A 3I0EA 1QWJA 1G3LA 2UX8A 2P73A 3I0HA 1WSZA 1NQIB 4HO2A 3V0MA 4E1KA 1O0RA 4EEGA 1H4EA 4ZDQA 3U2TA 5BXCA 4CJ8A 4DE7A 2J0AA 2YESA 1TVYA 2X5SA 1VH3A 1O7QA 1LZ7A 2OI6A 4G3QA 3SX5A 1H7LA 1EZIA 5CQPA 2O1FA 3IOIA 2ICYA 1Z90A 1VGUA 4LW6A 3CGXA 5C3AA 1R82A 1S4PA 3NGWA 2JCKA 4Q7CA 5CMGX 4HO6A 4UEGA 1XHBA 5CQOA 2P72A 1GQCA 1H4DA 3JUKA 3TQDA 1FZWA 1H7FA 2VS5A 2AGDA 1HJJA 4DECA 1WT0A 2X60A 3OAMA 1NF5B 1NKHB 1FG5N 4FQWA 2I5KA 4FRPA 1FXJA 1ZIZA 3DJ4A 2VS3A 1NMMB 2A8UA 3SX7A 2OI5A 2W0WA 2Q4JA 4ECMA 1GA8A 1G9RA 2RJ4A 4FRAA 2XWNA 4EEMA 1G8OA 3V0LA 3I0DA 2YQJA 1ZJ0A 4J18A 1H7QA 3U0XA 1H5TA 1PZYB 1NHEB 4MYBA 2Y4MA 3U2UA 1ON8A 4B4MA 2XMHA 1VZUA 2RJ8A 3CKJA 4FCEA 4Y7TA 1TW5A 5C1HA 1LZIA 1INJA 3I0CA 3CKOA 2VS4A 5C1LA 2NXVA 2AH9A 2WEEA 3OH3A 3CKNA 4CJCA 5CMFX 2YC3A 1V82A 5C47A 1YP3A 3I0JA 1MP5A 2D7RA 4ASYA 1R7VA 4L41C 4EE3A 4CVHA 4K6RA 2W0VA 5L6SA 2MZBA 4O6MA 3V0PA 3V8ZA 2VFZA 4JISA 2VXMA 1ZCYA 1G1LA 3I0IX 5IFYA 1LL2A 3ZLLA 5DDVA 5AJOA 1ZJ3A 3SXBA 2FYCB 1FR9A 4D0ZA 3R2WA 2VD4A 1HJLA 3SXGA 1JYKA 3OC9A 4IRQA 1VM8A 4D0TA 4HOCA 4D11A 2AECA 1V83A 2Y4JA 3V0QA 4FIYA 3V0OA 3SX8A 4EE4A 5C3BA 3T7NA 4HCQA 5C4FA 5C4BA 1ZI3A 2PX7A 4HO0A 2ICXA 1VGWA
chains in the Genus database with same CATH topology
4ASJA 5IDTA 1I52A 4KNXA 3I0KA 1HM0A 1QGSA 2DPWA 1E5KA 4Y6NA 1OMXA 4M2BA 1ZJOA 1GWVA 1W55A 1LL3A 3RMWA 3IOJA 3CU0A 2D7IA 2I5EA 2XWLA 2Z86A 5C48A 1KWSA 1OQMB 2XMEA 3O3PA 4M4KA 5AJNA 1FOAA 4Y7VA 1GQ9A 2RIXA 3OH0A 2FFVA 4KQLA 2Y7AA 3I0LA 4P02A 2YQSA 3Q7UA 1JYLA 1TZFA 1ZI1A 5D91A 5AJPA 2BO4A 1S4NA 5FV9A 1H7HA 1WT2A 1ZI5A 4NALA 1R7TA 1HM9A 1TW1A 1QGQA 4M2AA 1S4OA 1FGGA 2ZU7A 1MP4A 4FRMA 4HO3A 4EVWA 1GX0A 3Q4SA 2Y4KA 2ZU8A 3GUEA 1VPAA 3USQA 4KC1A 3V8YA 5HS2A 3DK5A 1V84A 2WE9A 4G3SA 4B4GA 1QG8A 3Q80A 1WT3A 3K8EA 5L6VA 1H3MA 2P6WA 4IRPA 3RSBA 3FOQA 4HO8A 2BO6A 1H7EA 4MNDA 2QGIA 1FWYA 1HM8A 4O6NA 5CMHA 2GGOA 3D8VA 2VXLA 1G23A 4NANA 1H5SA 2YCMA 3RMVA 3PKQA 3OKRA 2I7BA 2E3DA 2O1GA 2AESA 2RJ1A 5D92A 4EE5A 1JV3A 1ZDFA 4FRLA 3ZLKA 5C49A 2PGVA 2AM5A 3EE5A 3BRKX 4XWIA 2WVKA 4B42A 1NWGB 5FU8A 2V0LA 2WVLA 5C4EA 1FO8A 1ZDGA 2YQHA 3ZGFA 1YP4A 5C8RA 5CMJA 5EIYA 3V90A 3T7OA 1H5TB 3U2XA 1G2VA 2FYAA 4HO9A 3OH1A 2PGYA 4EEAA 1WT1A 1H7GA 3D5NA 4Y9XA 5CQLX 2D0JA 3BCVA 3SX3A 3V91A 1H5SB 3D98A 2V0IA 3OGZA 4Y7UA 4KRVA 2Y6PA 3SXCA 4G87A 5FTSA 2OEGA 4KC2A 3TZTA 1GWWA 4EEOA 4KPXA 2XWMA 1SS9A 2A8WA 4B3UA 1OMZA 1FXOA 1LZJA 1R80A 4KPZA 2RJ5A 2RJ9A 4B2WA 1VH1A 1G93A 1LZ0A 1W57A 2X65A 4HG6A 4AYJA 2JCJA 4FCUA 4B5BA 1R7UA 2OEFA 2J0BA 3U2VA 1VGTA 4NAIA 1R7XA 1YP2A 2FYDB 2RJ6A 1H5SD 2X5ZA 4KXOA 3E26A 2RJ7A 5C4DA 1ZJ2A 5DDTA 1JV1A 1H5RA 5EJZA 1LL0A 1IIMA 2O1HA 5I1FA 2ZU9A 2OI7A 2V0HA 4D11C 5J49A 3K8DA 2FY7A 2VSHA 3USRA 2YQCA 5JQQA 1FRWA 2Z87A 1R7YA 1PZTA 2VK9A 1ZJ1A 1ZCTA 1GX4A 3R3IA 2YC5A 5C38A 2FYBA 3I0GA 3POLA 4AYLA 4Y6UA 1WVCA 1FGXA 2QH5A 2WAWA 3IOHA 3PNNA 2APCA 4JD0A 1VICA 3E25A 4D48A 2AM3A 4FROA 5FTVA 1H7TA 3V0NA 2VSIA 3OH4A 3FWWA 2AM4A 4FRHA 1H5RB 4ARWA 2JCOA 4FIXA 4FRBA 2RITA 3CKQA 1ZJPA 3CKVA 2QKXA 4NAKA 1G95A 5CMIA 3SPTA 3SXAA 3DUVA 1JVDA 4KT7A 4Y64A 4BQHA 5IDSA 4FREA 4MIXA 3LW6A 2V0KA 4C2SA 3PKPA 4Y62A 5EJ1A 3U2WA 5CQNX 1IINA 1ZCUA 5C1GA 1ZI4A 2WVMA 1LVWA 1VZXA 2PA4A 3JUJA 2WGZA 4HO4A 4Y63A 4CJBA 1ON6A 5FUHA 1XZ6A 1VGZA 2BO7A 1JVGA 4P00A 1K4VA 3KIAA 5FU0A 4DDZA 4LW3A 1ZCVA 1HV9A 1FR8A 3OH2A 3JTJA 1YROB 5FYEA 5C36A 1INIA 1O23B 2V0JA 2RJ0A 4HO5A 3F1YA 2RIZA 1W77A 3U0YA 3ST8A 4AAWA 1ZHJA 1VZTA 3ZGGA 4B4BA 4KNRA 3SXEA 5C4CA 1MC3A 3ZF8A 3N9WA 1G0RA 1H4CA 1O7OA 3T7MA 1FO9A 4G3PA 2Y4LA 4M28A 1H5SC 4KC4A 4B2XA 2BO8A 2FFUA 3QVBA 2C0NA 5C3DA 4R7PA 4YS8A 2JCLA 2E8BA 2GGQA 4FRDA 3I0FA 5CQMX 4Y7FA 1G97A 4Y7GA 3HL3A 4FRQA 4GBPA 2AE7A 1R81A 2CU2A 4BMAA 1EYRA 1MP3A 2RIYA 3SXDA 3F1CA 4AC3A 3I0EA 1QWJA 1G3LA 2UX8A 2P73A 3I0HA 1WSZA 1NQIB 4HO2A 3V0MA 4E1KA 1O0RA 4EEGA 1H4EA 4ZDQA 3U2TA 5BXCA 4CJ8A 4DE7A 2J0AA 2YESA 1TVYA 2X5SA 1VH3A 1O7QA 1LZ7A 2OI6A 4G3QA 3SX5A 1H7LA 1EZIA 5CQPA 2O1FA 3IOIA 2ICYA 1Z90A 1VGUA 4LW6A 3CGXA 5C3AA 1R82A 1S4PA 3NGWA 2JCKA 4Q7CA 5CMGX 4HO6A 4UEGA 1XHBA 5CQOA 2P72A 1GQCA 1H4DA 3JUKA 3TQDA 1FZWA 1H7FA 2VS5A 2AGDA 1HJJA 4DECA 1WT0A 2X60A 3OAMA 1NF5B 1NKHB 1FG5N 4FQWA 2I5KA 4FRPA 1FXJA 1ZIZA 3DJ4A 2VS3A 1NMMB 2A8UA 3SX7A 2OI5A 2W0WA 2Q4JA 4ECMA 1GA8A 1G9RA 2RJ4A 4FRAA 2XWNA 4EEMA 1G8OA 3V0LA 3I0DA 2YQJA 1ZJ0A 4J18A 1H7QA 3U0XA 1H5TA 1PZYB 1NHEB 4MYBA 2Y4MA 3U2UA 1ON8A 4B4MA 2XMHA 1VZUA 2RJ8A 3CKJA 4FCEA 4Y7TA 1TW5A 5C1HA 1LZIA 1INJA 3I0CA 3CKOA 2VS4A 5C1LA 2NXVA 2AH9A 2WEEA 3OH3A 3CKNA 4CJCA 5CMFX 2YC3A 1V82A 5C47A 1YP3A 3I0JA 1MP5A 2D7RA 4ASYA 1R7VA 4L41C 4EE3A 4CVHA 4K6RA 2W0VA 5L6SA 2MZBA 4O6MA 3V0PA 3V8ZA 2VFZA 4JISA 2VXMA 1ZCYA 1G1LA 3I0IX 5IFYA 1LL2A 3ZLLA 5DDVA 5AJOA 1ZJ3A 3SXBA 2FYCB 1FR9A 4D0ZA 3R2WA 2VD4A 1HJLA 3SXGA 1JYKA 3OC9A 4IRQA 1VM8A 4D0TA 4HOCA 4D11A 2AECA 1V83A 2Y4JA 3V0QA 4FIYA 3V0OA 3SX8A 4EE4A 5C3BA 3T7NA 4HCQA 5C4FA 5C4BA 1ZI3A 2PX7A 4HO0A 2ICXA 1VGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ASJ A;  5IDT A;  1I52 A;  4KNX A;  3I0K A;  1HM0 A;  1QGS A;  2DPW A;  1E5K A;  4Y6N A;  1OMX A;  4M2B A;  1ZJO A;  1GWV A;  1W55 A;  1LL3 A;  3RMW A;  3IOJ A;  3CU0 A;  2D7I A;  2I5E A;  2XWL A;  2Z86 A;  5C48 A;  1KWS A;  1OQM B;  2XME A;  3O3P A;  4M4K A;  5AJN A;  1FOA A;  4Y7V A;  1GQ9 A;  2RIX A;  3OH0 A;  2FFV A;  4KQL A;  2Y7A A;  3I0L A;  4P02 A;  2YQS A;  3Q7U A;  1JYL A;  1TZF A;  1ZI1 A;  5AJP A;  2BO4 A;  1S4N A;  5FV9 A;  1H7H A;  1WT2 A;  1ZI5 A;  4NAL A;  1R7T A;  1HM9 A;  1TW1 A;  1QGQ A;  4M2A A;  1S4O A;  1FGG A;  2ZU7 A;  1MP4 A;  4FRM A;  4HO3 A;  4EVW A;  1GX0 A;  3Q4S A;  2Y4K A;  2ZU8 A;  3GUE A;  1VPA A;  3USQ A;  4KC1 A;  3V8Y A;  5HS2 A;  3DK5 A;  1V84 A;  2WE9 A;  4G3S A;  4B4G A;  1QG8 A;  3Q80 A;  1WT3 A;  3K8E A;  5L6V A;  1H3M A;  2P6W A;  4IRP A;  3RSB A;  3FOQ A;  4HO8 A;  2BO6 A;  1H7E A;  4MND A;  2QGI A;  1FWY A;  1HM8 A;  5CMH A;  2GGO A;  3D8V A;  2VXL A;  1G23 A;  4NAN A;  1H5S A;  2YCM A;  3RMV A;  3PKQ A;  3OKR A;  2I7B A;  2E3D A;  2O1G A;  2AES A;  2RJ1 A;  4EE5 A;  1JV3 A;  1ZDF A;  4FRL A;  3ZLK A;  5C49 A;  2PGV A;  2AM5 A;  3EE5 A;  3BRK X;  4XWI A;  2WVK A;  4B42 A;  1NWG B;  5FU8 A;  2V0L A;  2WVL A;  5C4E A;  1FO8 A;  1ZDG A;  2YQH A;  3ZGF A;  1YP4 A;  5C8R A;  5CMJ A;  5EIY A;  3V90 A;  3T7O A;  1H5T B;  3U2X A;  1G2V A;  2FYA A;  4HO9 A;  3OH1 A;  2PGY A;  4EEA A;  1WT1 A;  1H7G A;  3D5N A;  4Y9X A;  5CQL X;  2D0J A;  3BCV A;  3SX3 A;  3V91 A;  1H5S B;  3D98 A;  2V0I A;  3OGZ A;  4Y7U A;  4KRV A;  2Y6P A;  3SXC A;  4G87 A;  5FTS A;  2OEG A;  4KC2 A;  3TZT A;  1GWW A;  4EEO A;  4KPX A;  2XWM A;  1SS9 A;  2A8W A;  4B3U A;  1OMZ A;  1FXO A;  1LZJ A;  1R80 A;  4KPZ A;  2RJ5 A;  2RJ9 A;  4B2W A;  1VH1 A;  1G93 A;  1LZ0 A;  1W57 A;  2X65 A;  4HG6 A;  4AYJ A;  2JCJ A;  4FCU A;  4B5B A;  1R7U A;  2OEF A;  3U2V A;  1VGT A;  4NAI A;  1R7X A;  1YP2 A;  2FYD B;  2RJ6 A;  1H5S D;  2X5Z A;  4KXO A;  3E26 A;  2RJ7 A;  5C4D A;  1ZJ2 A;  5DDT A;  1JV1 A;  1H5R A;  5EJZ A;  1LL0 A;  1IIM A;  2O1H A;  5I1F A;  2ZU9 A;  2OI7 A;  2V0H A;  4D11 C;  5J49 A;  3K8D A;  2FY7 A;  2VSH A;  3USR A;  2YQC A;  5JQQ A;  1FRW A;  2Z87 A;  1R7Y A;  1PZT A;  1ZJ1 A;  1ZCT A;  1GX4 A;  3R3I A;  2YC5 A;  5C38 A;  2FYB A;  3I0G A;  3POL A;  4AYL A;  4Y6U A;  1WVC A;  1FGX A;  2QH5 A;  2WAW A;  3IOH A;  3PNN A;  2APC A;  4JD0 A;  1VIC A;  3E25 A;  4D48 A;  2AM3 A;  4FRO A;  5FTV A;  1H7T A;  3V0N A;  2VSI A;  3OH4 A;  3FWW A;  2AM4 A;  4FRH A;  1H5R B;  4ARW A;  2JCO A;  4FRB A;  2RIT A;  3CKQ A;  1ZJP A;  3CKV A;  2QKX A;  4NAK A;  1G95 A;  5CMI A;  3SPT A;  3SXA A;  3DUV A;  1JVD A;  4KT7 A;  4Y64 A;  4BQH A;  5IDS A;  4FRE A;  3LW6 A;  2V0K A;  4C2S A;  3PKP A;  4Y62 A;  5EJ1 A;  3U2W A;  5CQN X;  1IIN A;  1ZCU A;  5C1G A;  1ZI4 A;  2WVM A;  1LVW A;  1VZX A;  2PA4 A;  3JUJ A;  2WGZ A;  4HO4 A;  4Y63 A;  4CJB A;  1ON6 A;  5FUH A;  1XZ6 A;  1VGZ A;  2BO7 A;  1JVG A;  4P00 A;  1K4V A;  3KIA A;  5FU0 A;  4DDZ A;  4LW3 A;  1ZCV A;  1HV9 A;  1FR8 A;  3OH2 A;  3JTJ A;  1YRO B;  5FYE A;  5C36 A;  1INI A;  1O23 B;  2V0J A;  2RJ0 A;  4HO5 A;  3F1Y A;  2RIZ A;  1W77 A;  3U0Y A;  3ST8 A;  4AAW A;  1ZHJ A;  1VZT A;  3ZGG A;  4B4B A;  4KNR A;  3SXE A;  5C4C A;  1MC3 A;  3ZF8 A;  3N9W A;  1G0R A;  1H4C A;  1O7O A;  3T7M A;  1FO9 A;  4G3P A;  2Y4L A;  4M28 A;  1H5S C;  4KC4 A;  4B2X A;  2BO8 A;  2FFU A;  3QVB A;  5C3D A;  4R7P A;  4YS8 A;  2JCL A;  2E8B A;  2GGQ A;  4FRD A;  3I0F A;  5CQM X;  4Y7F A;  1G97 A;  4Y7G A;  3HL3 A;  4FRQ A;  4GBP A;  2AE7 A;  1R81 A;  2CU2 A;  4BMA A;  1EYR A;  1MP3 A;  2RIY A;  3SXD A;  3F1C A;  4AC3 A;  3I0E A;  1QWJ A;  1G3L A;  2UX8 A;  2P73 A;  3I0H A;  1WSZ A;  1NQI B;  4HO2 A;  3V0M A;  4E1K A;  1O0R A;  4EEG A;  1H4E A;  4ZDQ A;  3U2T A;  5BXC A;  4CJ8 A;  4DE7 A;  2YES A;  1TVY A;  2X5S A;  1VH3 A;  1O7Q A;  1LZ7 A;  2OI6 A;  4G3Q A;  3SX5 A;  1H7L A;  1EZI A;  5CQP A;  2O1F A;  3IOI A;  2ICY A;  1Z90 A;  1VGU A;  4LW6 A;  3CGX A;  5C3A A;  1R82 A;  1S4P A;  3NGW A;  2JCK A;  5CMG X;  4HO6 A;  4UEG A;  1XHB A;  5CQO A;  2P72 A;  1GQC A;  1H4D A;  3JUK A;  3TQD A;  1FZW A;  1H7F A;  2VS5 A;  2AGD A;  1HJJ A;  4DEC A;  1WT0 A;  2X60 A;  3OAM A;  1NF5 B;  1NKH B;  1FG5 N;  4FQW A;  2I5K A;  4FRP A;  1FXJ A;  1ZIZ A;  3DJ4 A;  2VS3 A;  1NMM B;  2A8U A;  3SX7 A;  2OI5 A;  2W0W A;  2Q4J A;  4ECM A;  1GA8 A;  1G9R A;  2RJ4 A;  4FRA A;  2XWN A;  4EEM A;  1G8O A;  3V0L A;  3I0D A;  2YQJ A;  1ZJ0 A;  4J18 A;  1H7Q A;  3U0X A;  1H5T A;  1PZY B;  1NHE B;  4MYB A;  2Y4M A;  3U2U A;  1ON8 A;  4B4M A;  2XMH A;  1VZU A;  2RJ8 A;  3CKJ A;  4FCE A;  4Y7T A;  1TW5 A;  5C1H A;  1LZI A;  1INJ A;  3I0C A;  3CKO A;  2VS4 A;  5C1L A;  2NXV A;  2AH9 A;  2WEE A;  3OH3 A;  3CKN A;  4CJC A;  5CMF X;  2YC3 A;  1V82 A;  5C47 A;  1YP3 A;  3I0J A;  1MP5 A;  2D7R A;  4ASY A;  1R7V A;  4L41 C;  4EE3 A;  4CVH A;  4K6R A;  2W0V A;  5L6S A;  2MZB A;  3V0P A;  3V8Z A;  2VFZ A;  4JIS A;  2VXM A;  1ZCY A;  1G1L A;  3I0I X;  5IFY A;  1LL2 A;  3ZLL A;  5DDV A;  5AJO A;  1ZJ3 A;  3SXB A;  2FYC B;  1FR9 A;  4D0Z A;  3R2W A;  2VD4 A;  1HJL A;  3SXG A;  1JYK A;  3OC9 A;  4IRQ A;  1VM8 A;  4D0T A;  4HOC A;  4D11 A;  2AEC A;  1V83 A;  2Y4J A;  3V0Q A;  3V0O A;  3SX8 A;  4EE4 A;  5C3B A;  3T7N A;  4HCQ A;  5C4F A;  5C4B A;  1ZI3 A;  2PX7 A;  4HO0 A;  2ICX A;  1VGW A; 
#chains in the Genus database with same CATH topology
 4ASJ A;  5IDT A;  1I52 A;  4KNX A;  3I0K A;  1HM0 A;  1QGS A;  2DPW A;  1E5K A;  4Y6N A;  1OMX A;  4M2B A;  1ZJO A;  1GWV A;  1W55 A;  1LL3 A;  3RMW A;  3IOJ A;  3CU0 A;  2D7I A;  2I5E A;  2XWL A;  2Z86 A;  5C48 A;  1KWS A;  1OQM B;  2XME A;  3O3P A;  4M4K A;  5AJN A;  1FOA A;  4Y7V A;  1GQ9 A;  2RIX A;  3OH0 A;  2FFV A;  4KQL A;  2Y7A A;  3I0L A;  4P02 A;  2YQS A;  3Q7U A;  1JYL A;  1TZF A;  1ZI1 A;  5D91 A;  5AJP A;  2BO4 A;  1S4N A;  5FV9 A;  1H7H A;  1WT2 A;  1ZI5 A;  4NAL A;  1R7T A;  1HM9 A;  1TW1 A;  1QGQ A;  4M2A A;  1S4O A;  1FGG A;  2ZU7 A;  1MP4 A;  4FRM A;  4HO3 A;  4EVW A;  1GX0 A;  3Q4S A;  2Y4K A;  2ZU8 A;  3GUE A;  1VPA A;  3USQ A;  4KC1 A;  3V8Y A;  5HS2 A;  3DK5 A;  1V84 A;  2WE9 A;  4G3S A;  4B4G A;  1QG8 A;  3Q80 A;  1WT3 A;  3K8E A;  5L6V A;  1H3M A;  2P6W A;  4IRP A;  3RSB A;  3FOQ A;  4HO8 A;  2BO6 A;  1H7E A;  4MND A;  2QGI A;  1FWY A;  1HM8 A;  4O6N A;  5CMH A;  2GGO A;  3D8V A;  2VXL A;  1G23 A;  4NAN A;  1H5S A;  2YCM A;  3RMV A;  3PKQ A;  3OKR A;  2I7B A;  2E3D A;  2O1G A;  2AES A;  2RJ1 A;  5D92 A;  4EE5 A;  1JV3 A;  1ZDF A;  4FRL A;  3ZLK A;  5C49 A;  2PGV A;  2AM5 A;  3EE5 A;  3BRK X;  4XWI A;  2WVK A;  4B42 A;  1NWG B;  5FU8 A;  2V0L A;  2WVL A;  5C4E A;  1FO8 A;  1ZDG A;  2YQH A;  3ZGF A;  1YP4 A;  5C8R A;  5CMJ A;  5EIY A;  3V90 A;  3T7O A;  1H5T B;  3U2X A;  1G2V A;  2FYA A;  4HO9 A;  3OH1 A;  2PGY A;  4EEA A;  1WT1 A;  1H7G A;  3D5N A;  4Y9X A;  5CQL X;  2D0J A;  3BCV A;  3SX3 A;  3V91 A;  1H5S B;  3D98 A;  2V0I A;  3OGZ A;  4Y7U A;  4KRV A;  2Y6P A;  3SXC A;  4G87 A;  5FTS A;  2OEG A;  4KC2 A;  3TZT A;  1GWW A;  4EEO A;  4KPX A;  2XWM A;  1SS9 A;  2A8W A;  4B3U A;  1OMZ A;  1FXO A;  1LZJ A;  1R80 A;  4KPZ A;  2RJ5 A;  2RJ9 A;  4B2W A;  1VH1 A;  1G93 A;  1LZ0 A;  1W57 A;  2X65 A;  4HG6 A;  4AYJ A;  2JCJ A;  4FCU A;  4B5B A;  1R7U A;  2OEF A;  2J0B A;  3U2V A;  1VGT A;  4NAI A;  1R7X A;  1YP2 A;  2FYD B;  2RJ6 A;  1H5S D;  2X5Z A;  4KXO A;  3E26 A;  2RJ7 A;  5C4D A;  1ZJ2 A;  5DDT A;  1JV1 A;  1H5R A;  5EJZ A;  1LL0 A;  1IIM A;  2O1H A;  5I1F A;  2ZU9 A;  2OI7 A;  2V0H A;  4D11 C;  5J49 A;  3K8D A;  2FY7 A;  2VSH A;  3USR A;  2YQC A;  5JQQ A;  1FRW A;  2Z87 A;  1R7Y A;  1PZT A;  2VK9 A;  1ZJ1 A;  1ZCT A;  1GX4 A;  3R3I A;  2YC5 A;  5C38 A;  2FYB A;  3I0G A;  3POL A;  4AYL A;  4Y6U A;  1WVC A;  1FGX A;  2QH5 A;  2WAW A;  3IOH A;  3PNN A;  2APC A;  4JD0 A;  1VIC A;  3E25 A;  4D48 A;  2AM3 A;  4FRO A;  5FTV A;  1H7T A;  3V0N A;  2VSI A;  3OH4 A;  3FWW A;  2AM4 A;  4FRH A;  1H5R B;  4ARW A;  2JCO A;  4FIX A;  4FRB A;  2RIT A;  3CKQ A;  1ZJP A;  3CKV A;  2QKX A;  4NAK A;  1G95 A;  5CMI A;  3SPT A;  3SXA A;  3DUV A;  1JVD A;  4KT7 A;  4Y64 A;  4BQH A;  5IDS A;  4FRE A;  4MIX A;  3LW6 A;  2V0K A;  4C2S A;  3PKP A;  4Y62 A;  5EJ1 A;  3U2W A;  5CQN X;  1IIN A;  1ZCU A;  5C1G A;  1ZI4 A;  2WVM A;  1LVW A;  1VZX A;  2PA4 A;  3JUJ A;  2WGZ A;  4HO4 A;  4Y63 A;  4CJB A;  1ON6 A;  5FUH A;  1XZ6 A;  1VGZ A;  2BO7 A;  1JVG A;  4P00 A;  1K4V A;  3KIA A;  5FU0 A;  4DDZ A;  4LW3 A;  1ZCV A;  1HV9 A;  1FR8 A;  3OH2 A;  3JTJ A;  1YRO B;  5FYE A;  5C36 A;  1INI A;  1O23 B;  2V0J A;  2RJ0 A;  4HO5 A;  3F1Y A;  2RIZ A;  1W77 A;  3U0Y A;  3ST8 A;  4AAW A;  1ZHJ A;  1VZT A;  3ZGG A;  4B4B A;  4KNR A;  3SXE A;  5C4C A;  1MC3 A;  3ZF8 A;  3N9W A;  1G0R A;  1H4C A;  1O7O A;  3T7M A;  1FO9 A;  4G3P A;  2Y4L A;  4M28 A;  1H5S C;  4KC4 A;  4B2X A;  2BO8 A;  2FFU A;  3QVB A;  2C0N A;  5C3D A;  4R7P A;  4YS8 A;  2JCL A;  2E8B A;  2GGQ A;  4FRD A;  3I0F A;  5CQM X;  4Y7F A;  1G97 A;  4Y7G A;  3HL3 A;  4FRQ A;  4GBP A;  2AE7 A;  1R81 A;  2CU2 A;  4BMA A;  1EYR A;  1MP3 A;  2RIY A;  3SXD A;  3F1C A;  4AC3 A;  3I0E A;  1QWJ A;  1G3L A;  2UX8 A;  2P73 A;  3I0H A;  1WSZ A;  1NQI B;  4HO2 A;  3V0M A;  4E1K A;  1O0R A;  4EEG A;  1H4E A;  4ZDQ A;  3U2T A;  5BXC A;  4CJ8 A;  4DE7 A;  2J0A A;  2YES A;  1TVY A;  2X5S A;  1VH3 A;  1O7Q A;  1LZ7 A;  2OI6 A;  4G3Q A;  3SX5 A;  1H7L A;  1EZI A;  5CQP A;  2O1F A;  3IOI A;  2ICY A;  1Z90 A;  1VGU A;  4LW6 A;  3CGX A;  5C3A A;  1R82 A;  1S4P A;  3NGW A;  2JCK A;  4Q7C A;  5CMG X;  4HO6 A;  4UEG A;  1XHB A;  5CQO A;  2P72 A;  1GQC A;  1H4D A;  3JUK A;  3TQD A;  1FZW A;  1H7F A;  2VS5 A;  2AGD A;  1HJJ A;  4DEC A;  1WT0 A;  2X60 A;  3OAM A;  1NF5 B;  1NKH B;  1FG5 N;  4FQW A;  2I5K A;  4FRP A;  1FXJ A;  1ZIZ A;  3DJ4 A;  2VS3 A;  1NMM B;  2A8U A;  3SX7 A;  2OI5 A;  2W0W A;  2Q4J A;  4ECM A;  1GA8 A;  1G9R A;  2RJ4 A;  4FRA A;  2XWN A;  4EEM A;  1G8O A;  3V0L A;  3I0D A;  2YQJ A;  1ZJ0 A;  4J18 A;  1H7Q A;  3U0X A;  1H5T A;  1PZY B;  1NHE B;  4MYB A;  2Y4M A;  3U2U A;  1ON8 A;  4B4M A;  2XMH A;  1VZU A;  2RJ8 A;  3CKJ A;  4FCE A;  4Y7T A;  1TW5 A;  5C1H A;  1LZI A;  1INJ A;  3I0C A;  3CKO A;  2VS4 A;  5C1L A;  2NXV A;  2AH9 A;  2WEE A;  3OH3 A;  3CKN A;  4CJC A;  5CMF X;  2YC3 A;  1V82 A;  5C47 A;  1YP3 A;  3I0J A;  1MP5 A;  2D7R A;  4ASY A;  1R7V A;  4L41 C;  4EE3 A;  4CVH A;  4K6R A;  2W0V A;  5L6S A;  2MZB A;  4O6M A;  3V0P A;  3V8Z A;  2VFZ A;  4JIS A;  2VXM A;  1ZCY A;  1G1L A;  3I0I X;  5IFY A;  1LL2 A;  3ZLL A;  5DDV A;  5AJO A;  1ZJ3 A;  3SXB A;  2FYC B;  1FR9 A;  4D0Z A;  3R2W A;  2VD4 A;  1HJL A;  3SXG A;  1JYK A;  3OC9 A;  4IRQ A;  1VM8 A;  4D0T A;  4HOC A;  4D11 A;  2AEC A;  1V83 A;  2Y4J A;  3V0Q A;  4FIY A;  3V0O A;  3SX8 A;  4EE4 A;  5C3B A;  3T7N A;  4HCQ A;  5C4F A;  5C4B A;  1ZI3 A;  2PX7 A;  4HO0 A;  2ICX A;  1VGW A; 
#chains in the Genus database with same CATH homology
 4ASJ A;  5IDT A;  1I52 A;  4KNX A;  3I0K A;  1HM0 A;  1QGS A;  2DPW A;  1E5K A;  4Y6N A;  1OMX A;  4M2B A;  1ZJO A;  1GWV A;  1W55 A;  1LL3 A;  3RMW A;  3IOJ A;  3CU0 A;  2D7I A;  2I5E A;  2XWL A;  2Z86 A;  5C48 A;  1KWS A;  1OQM B;  2XME A;  3O3P A;  4M4K A;  5AJN A;  1FOA A;  4Y7V A;  1GQ9 A;  2RIX A;  3OH0 A;  2FFV A;  4KQL A;  2Y7A A;  3I0L A;  4P02 A;  2YQS A;  3Q7U A;  1JYL A;  1TZF A;  1ZI1 A;  5D91 A;  5AJP A;  2BO4 A;  1S4N A;  5FV9 A;  1H7H A;  1WT2 A;  1ZI5 A;  4NAL A;  1R7T A;  1HM9 A;  1TW1 A;  1QGQ A;  4M2A A;  1S4O A;  1FGG A;  2ZU7 A;  1MP4 A;  4FRM A;  4HO3 A;  4EVW A;  1GX0 A;  3Q4S A;  2Y4K A;  2ZU8 A;  3GUE A;  1VPA A;  3USQ A;  4KC1 A;  3V8Y A;  5HS2 A;  3DK5 A;  1V84 A;  2WE9 A;  4G3S A;  4B4G A;  1QG8 A;  3Q80 A;  1WT3 A;  3K8E A;  5L6V A;  1H3M A;  2P6W A;  4IRP A;  3RSB A;  3FOQ A;  4HO8 A;  2BO6 A;  1H7E A;  4MND A;  2QGI A;  1FWY A;  1HM8 A;  4O6N A;  5CMH A;  2GGO A;  3D8V A;  2VXL A;  1G23 A;  4NAN A;  1H5S A;  2YCM A;  3RMV A;  3PKQ A;  3OKR A;  2I7B A;  2E3D A;  2O1G A;  2AES A;  2RJ1 A;  5D92 A;  4EE5 A;  1JV3 A;  1ZDF A;  4FRL A;  3ZLK A;  5C49 A;  2PGV A;  2AM5 A;  3EE5 A;  3BRK X;  4XWI A;  2WVK A;  4B42 A;  1NWG B;  5FU8 A;  2V0L A;  2WVL A;  5C4E A;  1FO8 A;  1ZDG A;  2YQH A;  3ZGF A;  1YP4 A;  5C8R A;  5CMJ A;  5EIY A;  3V90 A;  3T7O A;  1H5T B;  3U2X A;  1G2V A;  2FYA A;  4HO9 A;  3OH1 A;  2PGY A;  4EEA A;  1WT1 A;  1H7G A;  3D5N A;  4Y9X A;  5CQL X;  2D0J A;  3BCV A;  3SX3 A;  3V91 A;  1H5S B;  3D98 A;  2V0I A;  3OGZ A;  4Y7U A;  4KRV A;  2Y6P A;  3SXC A;  4G87 A;  5FTS A;  2OEG A;  4KC2 A;  3TZT A;  1GWW A;  4EEO A;  4KPX A;  2XWM A;  1SS9 A;  2A8W A;  4B3U A;  1OMZ A;  1FXO A;  1LZJ A;  1R80 A;  4KPZ A;  2RJ5 A;  2RJ9 A;  4B2W A;  1VH1 A;  1G93 A;  1LZ0 A;  1W57 A;  2X65 A;  4HG6 A;  4AYJ A;  2JCJ A;  4FCU A;  4B5B A;  1R7U A;  2OEF A;  2J0B A;  3U2V A;  1VGT A;  4NAI A;  1R7X A;  1YP2 A;  2FYD B;  2RJ6 A;  1H5S D;  2X5Z A;  4KXO A;  3E26 A;  2RJ7 A;  5C4D A;  1ZJ2 A;  5DDT A;  1JV1 A;  1H5R A;  5EJZ A;  1LL0 A;  1IIM A;  2O1H A;  5I1F A;  2ZU9 A;  2OI7 A;  2V0H A;  4D11 C;  5J49 A;  3K8D A;  2FY7 A;  2VSH A;  3USR A;  2YQC A;  5JQQ A;  1FRW A;  2Z87 A;  1R7Y A;  1PZT A;  2VK9 A;  1ZJ1 A;  1ZCT A;  1GX4 A;  3R3I A;  2YC5 A;  5C38 A;  2FYB A;  3I0G A;  3POL A;  4AYL A;  4Y6U A;  1WVC A;  1FGX A;  2QH5 A;  2WAW A;  3IOH A;  3PNN A;  2APC A;  4JD0 A;  1VIC A;  3E25 A;  4D48 A;  2AM3 A;  4FRO A;  5FTV A;  1H7T A;  3V0N A;  2VSI A;  3OH4 A;  3FWW A;  2AM4 A;  4FRH A;  1H5R B;  4ARW A;  2JCO A;  4FIX A;  4FRB A;  2RIT A;  3CKQ A;  1ZJP A;  3CKV A;  2QKX A;  4NAK A;  1G95 A;  5CMI A;  3SPT A;  3SXA A;  3DUV A;  1JVD A;  4KT7 A;  4Y64 A;  4BQH A;  5IDS A;  4FRE A;  4MIX A;  3LW6 A;  2V0K A;  4C2S A;  3PKP A;  4Y62 A;  5EJ1 A;  3U2W A;  5CQN X;  1IIN A;  1ZCU A;  5C1G A;  1ZI4 A;  2WVM A;  1LVW A;  1VZX A;  2PA4 A;  3JUJ A;  2WGZ A;  4HO4 A;  4Y63 A;  4CJB A;  1ON6 A;  5FUH A;  1XZ6 A;  1VGZ A;  2BO7 A;  1JVG A;  4P00 A;  1K4V A;  3KIA A;  5FU0 A;  4DDZ A;  4LW3 A;  1ZCV A;  1HV9 A;  1FR8 A;  3OH2 A;  3JTJ A;  1YRO B;  5FYE A;  5C36 A;  1INI A;  1O23 B;  2V0J A;  2RJ0 A;  4HO5 A;  3F1Y A;  2RIZ A;  1W77 A;  3U0Y A;  3ST8 A;  4AAW A;  1ZHJ A;  1VZT A;  3ZGG A;  4B4B A;  4KNR A;  3SXE A;  5C4C A;  1MC3 A;  3ZF8 A;  3N9W A;  1G0R A;  1H4C A;  1O7O A;  3T7M A;  1FO9 A;  4G3P A;  2Y4L A;  4M28 A;  1H5S C;  4KC4 A;  4B2X A;  2BO8 A;  2FFU A;  3QVB A;  2C0N A;  5C3D A;  4R7P A;  4YS8 A;  2JCL A;  2E8B A;  2GGQ A;  4FRD A;  3I0F A;  5CQM X;  4Y7F A;  1G97 A;  4Y7G A;  3HL3 A;  4FRQ A;  4GBP A;  2AE7 A;  1R81 A;  2CU2 A;  4BMA A;  1EYR A;  1MP3 A;  2RIY A;  3SXD A;  3F1C A;  4AC3 A;  3I0E A;  1QWJ A;  1G3L A;  2UX8 A;  2P73 A;  3I0H A;  1WSZ A;  1NQI B;  4HO2 A;  3V0M A;  4E1K A;  1O0R A;  4EEG A;  1H4E A;  4ZDQ A;  3U2T A;  5BXC A;  4CJ8 A;  4DE7 A;  2J0A A;  2YES A;  1TVY A;  2X5S A;  1VH3 A;  1O7Q A;  1LZ7 A;  2OI6 A;  4G3Q A;  3SX5 A;  1H7L A;  1EZI A;  5CQP A;  2O1F A;  3IOI A;  2ICY A;  1Z90 A;  1VGU A;  4LW6 A;  3CGX A;  5C3A A;  1R82 A;  1S4P A;  3NGW A;  2JCK A;  4Q7C A;  5CMG X;  4HO6 A;  4UEG A;  1XHB A;  5CQO A;  2P72 A;  1GQC A;  1H4D A;  3JUK A;  3TQD A;  1FZW A;  1H7F A;  2VS5 A;  2AGD A;  1HJJ A;  4DEC A;  1WT0 A;  2X60 A;  3OAM A;  1NF5 B;  1NKH B;  1FG5 N;  4FQW A;  2I5K A;  4FRP A;  1FXJ A;  1ZIZ A;  3DJ4 A;  2VS3 A;  1NMM B;  2A8U A;  3SX7 A;  2OI5 A;  2W0W A;  2Q4J A;  4ECM A;  1GA8 A;  1G9R A;  2RJ4 A;  4FRA A;  2XWN A;  4EEM A;  1G8O A;  3V0L A;  3I0D A;  2YQJ A;  1ZJ0 A;  4J18 A;  1H7Q A;  3U0X A;  1H5T A;  1PZY B;  1NHE B;  4MYB A;  2Y4M A;  3U2U A;  1ON8 A;  4B4M A;  2XMH A;  1VZU A;  2RJ8 A;  3CKJ A;  4FCE A;  4Y7T A;  1TW5 A;  5C1H A;  1LZI A;  1INJ A;  3I0C A;  3CKO A;  2VS4 A;  5C1L A;  2NXV A;  2AH9 A;  2WEE A;  3OH3 A;  3CKN A;  4CJC A;  5CMF X;  2YC3 A;  1V82 A;  5C47 A;  1YP3 A;  3I0J A;  1MP5 A;  2D7R A;  4ASY A;  1R7V A;  4L41 C;  4EE3 A;  4CVH A;  4K6R A;  2W0V A;  5L6S A;  2MZB A;  4O6M A;  3V0P A;  3V8Z A;  2VFZ A;  4JIS A;  2VXM A;  1ZCY A;  1G1L A;  3I0I X;  5IFY A;  1LL2 A;  3ZLL A;  5DDV A;  5AJO A;  1ZJ3 A;  3SXB A;  2FYC B;  1FR9 A;  4D0Z A;  3R2W A;  2VD4 A;  1HJL A;  3SXG A;  1JYK A;  3OC9 A;  4IRQ A;  1VM8 A;  4D0T A;  4HOC A;  4D11 A;  2AEC A;  1V83 A;  2Y4J A;  3V0Q A;  4FIY A;  3V0O A;  3SX8 A;  4EE4 A;  5C3B A;  3T7N A;  4HCQ A;  5C4F A;  5C4B A;  1ZI3 A;  2PX7 A;  4HO0 A;  2ICX A;  1VGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...