1NF5B

Crystal structure of lactose synthase, complex with glucose
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
272
structure length
272
Chain Sequence
LTACPEESPLLVGPMLIEFNIPVDLKLVEQQNPKVKLGGRYTPMDCISPHKVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGESMFNRAKLLNVGFKEALKDYDYNCFVFSDVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLSINGFPNNYWGWGGEDDDIYNRLAFRGMSVSRPNAVIGKCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYMVLEVQRYPLYTKITVDIGTPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase
molecule keywords Alpha-lactalbumin
publication title Crystal Structure of Lactose Synthase Reveals a Large Conformational Change in its Catalytic Component, the beta-1,4-galactosyltransferase
pubmed doi rcsb
source organism Mus musculus
total genus 88
structure length 272
sequence length 272
chains with identical sequence D
ec nomenclature ec 2.4.1.22: Lactose synthase.
pdb deposition date 2002-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02709 Glyco_transf_7C N-terminal domain of galactosyltransferase
B PF13733 Glyco_transf_7N N-terminal region of glycosyl transferase group 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1nf5B00
1HJLA 2RJ7A 4MYBA 2Y7AA 1H4EA 4IRQA 4C2SA 3QVBA 1WSZA 1OMZA 3EE5A 4LW3A 4EE5A 4D11C 2VD4A 2QGIA 4KNRA 5FU8A 3SX7A 2O1HA 3F1YA 2RJ8A 1GWVA 3I0FA 3OH3A 3SX3A 1H5SB 4FCEA 1W57A 5HS2A 1FR8A 1H7QA 4HO0A 4FRLA 4KPXA 2RIYA 4EEOA 1QGSA 1G9RA 4FRDA 3I0JA 1ON6A 4HO8A 5C4CA 4FRMA 3I0LA 3V0QA 3I0EA 4ZDQA 5C36A 4G3SA 1NWGB 4K6RA 3N9WA 2XWMA 5C47A 4R7PA 1HJJA 3ZLLA 3TZTA 4XWIA 4Y7FA 5EJ1A 1FO8A 1G97A 2V0KA 1H7TA 1VZUA 3CKJA 2AE7A 2VS5A 2JCKA 5CQLX 2WVMA 1ZI3A 3TQDA 3V0MA 2P72A 4B4MA 5EJZA 2P73A 2VS4A 3GUEA 3USRA 2V0HA 1H7HA 2P6WA 1WT1A 5L6SA 4D48A 3SXDA 1H7FA 3OC9A 1H5TB 1HM0A 1GX4A 1ZIZA 2XMHA 1EZIA 4HCQA 5C8RA 2AGDA 4P02A 2QKXA 4JD0A 1G93A 4AC3A 4Y7GA 2Z86A 3I0GA 1VH3A 3PKPA 1H5SA 1LVWA 1LZIA 3ZLKA 1TW5A 2BO8A 2E3DA 2FY7A 3KIAA 4B42A 5FYEA 5BXCA 5J49A 1ZI4A 2Y6PA 5CMIA 2AESA 3R3IA 1YP3A 2JCLA 2RIXA 4DDZA 4Y7TA 3NGWA 1INJA 4M4KA 2X5ZA 3K8EA 1FGXA 3U2VA 1R7XA 4ASYA 1H3MA 1H7LA 2D0JA 2WGZA 1VGWA 2PX7A 1O23B 1ZCYA 1O7QA 3I0KA 1G2VA 2AM4A 4DECA 4B2WA 4FRHA 5C48A 3USQA 1MP3A 4HG6A 5CMGX 1NMMB 1LZ7A 2GGQA 2OI7A 1PZTA 4G3QA 1H5TA 5C4EA 1HM8A 1MP4A 1XHBA 5I1FA 1OQMB 4FQWA 1ZJ2A 2O1GA 2RJ5A 3SXGA 3U2WA 1NF5B 1H4CA 4KC4A 4J18A 2Y4MA 3D5NA 2WVLA 5C4BA 5CMJA 3OH0A 1R7YA 1V83A 1FXOA 4CJBA 1GQ9A 1WT0A 1TW1A 4CVHA 3U0YA 5CQMX 3SXEA 3SPTA 2VXMA 3V90A 2YQCA 3FWWA 5CMFX 5C3DA 2RJ1A 3DUVA 1FOAA 2V0JA 4D0ZA 3E25A 2ZU7A 2RJ4A 3IOIA 4CJ8A 2FYDB 1ZHJA 2BO7A 1JV1A 3PNNA 3T7OA 1R80A 1ZJPA 1TZFA 2Y4KA 4Y6UA 2WE9A 1JYKA 2Q4JA 3V91A 4D11A 1MC3A 4GBPA 1WVCA 1GA8A 1LL3A 4G3PA 4B5BA 1ZI5A 4KT7A 1FZWA 1QG8A 3I0HA 2WEEA 4G87A 3T7NA 1ZJ1A 3OKRA 1JYLA 3SXAA 4KQLA 2VSHA 4EE4A 1TVYA 2I5EA 3OH2A 1NHEB 1FRWA 5IDTA 1HM9A 1H5RB 4EEMA 2JCOA 4EVWA 3ZGFA 4YS8A 3E26A 3K8DA 3F1CA 4Y7UA 1ZJOA 4HO5A 5FV9A 3SXCA 3BRKX 3SX8A 2QH5A 3DK5A 4B3UA 3FOQA 4ASJA 1HV9A 4FRPA 2I5KA 3CKOA 5EIYA 2PA4A 3BCVA 1H4DA 1G3LA 1ZCTA 5FTVA 1IIMA 1MP5A 4M2AA 1GX0A 3CU0A 4AYLA 3V0PA 4AAWA 4D0TA 2OI6A 1S4PA 5C49A 5C4FA 2AM5A 2AH9A 2X5SA 5C38A 4IRPA 2FYCB 1LL0A 4NANA 4E1KA 1VGUA 2FYAA 4KXOA 4HO3A 2NXVA 1G95A 5L6VA 1O0RA 1G0RA 4HOCA 2ZU9A 3OH4A 2ICYA 4P00A 1H7GA 3I0IX 2BO6A 2VS3A 2BO4A 5AJNA 2JCJA 2Z87A 3V0LA 3LW6A 1NKHB 2DPWA 4HO2A 4KC1A 3OH1A 1G8OA 3IOJA 1VGTA 1FGGA 1ZI1A 2RJ0A 2AECA 1VM8A 2OEGA 4KPZA 4FRQA 5CQPA 1Z90A 1FO9A 3DJ4A 1JVDA 2D7IA 4Y7VA 5AJOA 2YQHA 2WVKA 4CJCA 1FG5N 2E8BA 5C3BA 1JV3A 1VPAA 3U0XA 5C1GA 1PZYB 5CQNX 4NAKA 5FU0A 1I52A 2X65A 1R7TA 1R7UA 4B4BA 4DE7A 3RSBA 3SX5A 1ZJ0A 1YP2A 2YQSA 2RJ6A 2PGVA 2RIZA 1YROB 3I0DA 1LZ0A 4KRVA 3ST8A 1EYRA 1H5SD 3SXBA 1O7OA 3PKQA 1KWSA 4BMAA 2XWLA 3RMWA 1JVGA 5C1HA 4M2BA 4LW6A 2UX8A 4M28A 1FWYA 3U2XA 2OEFA 1FR9A 1SS9A 4FRAA 1YP4A 3V0OA 4HO6A 3ZF8A 3HL3A 1G1LA 1S4NA 3T7MA 2VSIA 2W0VA 1GQCA 1H5SC 4Y62A 4AYJA 4EE3A 4Y63A 4KNXA 4UEGA 1ZJ3A 4NALA 2V0IA 2AM3A 1ZDFA 2VFZA 1R82A 4FROA 5IDSA 1ZCVA 2YESA 5DDTA 2FYBA 2MZBA 3CKQA 1LZJA 3Q7UA 5DDVA 3V0NA 4B4GA 2RITA 2A8UA 2RJ9A 1V84A 1R81A 2O1FA 2XMEA 4Y64A 3ZGGA 4EEGA 2X60A 4MNDA 4B2XA 1K4VA 3CGXA 1QWJA 2XWNA 3I0CA 1INIA 1W55A 5C1LA 3CKVA 3V8ZA 1VZTA 5CMHA 4Y6NA 3R2WA 1IINA 3U2UA 1ON8A 1WT3A 1ZCUA 2YQJA 4ARWA 3POLA 1H7EA 3D8VA 2WAWA 1ZDGA 2A8WA 1LL2A 1R7VA 1G23A 2ZU8A 4EEAA 5JQQA 5FUHA 1S4OA 2APCA 1WT2A 3JTJA 3V8YA 1V82A 4FCUA 4KC2A 1OMXA 1NQIB 1E5KA 5CQOA 4BQHA 2GGOA 1H5RA 2I7BA 1VICA 1VZXA 5C4DA 1VH1A 1XZ6A 1FXJA 3IOHA 3OAMA 3Q4SA 4NAIA 3OGZA 1QGQA 2PGYA 4L41C 3U2TA 2VXLA 3JUKA 3RMVA 1W77A 2FFUA 4HO9A 3JUJA 2Y4LA 2ICXA 2D7RA 2V0LA 2YCMA 3Q80A 2CU2A 3CKNA 2Y4JA 3D98A 1VGZA 2OI5A 4Y9XA 4FREA 4HO4A 5IFYA 5FTSA 1GWWA 2FFVA 2YC3A 2YC5A 3O3PA 5C3AA 4ECMA 4JISA 5AJPA 2W0WA 4FRBA
chains in the Genus database with same CATH superfamily
1HJLA 2RJ7A 4MYBA 2Y7AA 1H4EA 4IRQA 4C2SA 5D92A 3QVBA 1WSZA 1OMZA 3EE5A 4LW3A 4EE5A 4D11C 2VD4A 2QGIA 4KNRA 5FU8A 3SX7A 2O1HA 3F1YA 2RJ8A 1GWVA 3I0FA 3OH3A 3SX3A 1H5SB 4FCEA 1W57A 5HS2A 1FR8A 1H7QA 4HO0A 4FRLA 4KPXA 2RIYA 4EEOA 1QGSA 1G9RA 4FRDA 3I0JA 1ON6A 4HO8A 5C4CA 4FRMA 3I0LA 3V0QA 3I0EA 4ZDQA 5C36A 4G3SA 1NWGB 4K6RA 3N9WA 2XWMA 5C47A 4R7PA 1HJJA 3ZLLA 3TZTA 4XWIA 4Y7FA 5EJ1A 1FO8A 1G97A 2V0KA 1H7TA 1VZUA 3CKJA 2AE7A 2VS5A 2JCKA 5CQLX 2WVMA 1ZI3A 3TQDA 3V0MA 2P72A 4B4MA 5EJZA 2P73A 2VS4A 3GUEA 3USRA 2V0HA 1H7HA 2P6WA 1WT1A 5L6SA 4D48A 3SXDA 1H7FA 3OC9A 1H5TB 1HM0A 1GX4A 1ZIZA 2XMHA 1EZIA 4HCQA 5C8RA 2AGDA 4P02A 2QKXA 4JD0A 1G93A 4AC3A 4Y7GA 2Z86A 3I0GA 1VH3A 3PKPA 1H5SA 1LVWA 1LZIA 3ZLKA 1TW5A 2BO8A 2E3DA 2FY7A 3KIAA 4B42A 5FYEA 5BXCA 5J49A 1ZI4A 2Y6PA 5CMIA 2AESA 3R3IA 1YP3A 2JCLA 2RIXA 4O6MA 4DDZA 4Y7TA 3NGWA 1INJA 4M4KA 2X5ZA 3K8EA 1FGXA 3U2VA 1R7XA 4ASYA 1H3MA 1H7LA 2D0JA 2WGZA 1VGWA 2PX7A 1O23B 1ZCYA 1O7QA 3I0KA 1G2VA 2AM4A 4DECA 4B2WA 4FRHA 5C48A 3USQA 1MP3A 4HG6A 5CMGX 1NMMB 1LZ7A 2GGQA 2OI7A 1PZTA 4G3QA 1H5TA 5C4EA 1HM8A 1MP4A 1XHBA 5I1FA 1OQMB 4FQWA 1ZJ2A 2O1GA 2RJ5A 3SXGA 3U2WA 1NF5B 1H4CA 4KC4A 4J18A 2Y4MA 3D5NA 2WVLA 5C4BA 5CMJA 3OH0A 1R7YA 1V83A 1FXOA 4CJBA 1GQ9A 1WT0A 1TW1A 4CVHA 3U0YA 4Q7CA 5CQMX 3SXEA 3SPTA 2VXMA 3V90A 2YQCA 3FWWA 5CMFX 5C3DA 2RJ1A 3DUVA 1FOAA 2V0JA 4D0ZA 3E25A 2ZU7A 2RJ4A 2C0NA 3IOIA 4CJ8A 2FYDB 1ZHJA 2BO7A 1JV1A 3PNNA 3T7OA 1R80A 1ZJPA 1TZFA 2Y4KA 4Y6UA 2WE9A 1JYKA 2Q4JA 3V91A 4D11A 1MC3A 4GBPA 1WVCA 1GA8A 1LL3A 4G3PA 4B5BA 1ZI5A 4KT7A 1FZWA 1QG8A 3I0HA 2WEEA 4G87A 3T7NA 1ZJ1A 3OKRA 1JYLA 3SXAA 4KQLA 2VSHA 4EE4A 1TVYA 2I5EA 3OH2A 1NHEB 1FRWA 5IDTA 1HM9A 1H5RB 4EEMA 2JCOA 4EVWA 3ZGFA 4YS8A 3E26A 3K8DA 3F1CA 2VK9A 4Y7UA 1ZJOA 4HO5A 5FV9A 3SXCA 3BRKX 3SX8A 2QH5A 3DK5A 4B3UA 3FOQA 4ASJA 1HV9A 4FRPA 2I5KA 3CKOA 5EIYA 2PA4A 3BCVA 1H4DA 1G3LA 1ZCTA 5FTVA 1IIMA 1MP5A 4M2AA 1GX0A 3CU0A 2J0BA 4AYLA 3V0PA 4AAWA 4D0TA 2OI6A 1S4PA 5C49A 5C4FA 2AM5A 2AH9A 2X5SA 5D91A 5C38A 4IRPA 2FYCB 1LL0A 4NANA 4E1KA 1VGUA 2FYAA 4KXOA 4HO3A 2NXVA 1G95A 5L6VA 1O0RA 1G0RA 4HOCA 2ZU9A 3OH4A 2ICYA 4P00A 1H7GA 3I0IX 4FIXA 2BO6A 2VS3A 2BO4A 5AJNA 2JCJA 2Z87A 3V0LA 3LW6A 1NKHB 2DPWA 4HO2A 4KC1A 3OH1A 1G8OA 3IOJA 1VGTA 1FGGA 1ZI1A 2RJ0A 2AECA 1VM8A 2OEGA 4KPZA 4FRQA 5CQPA 1Z90A 1FO9A 1JVDA 2D7IA 3DJ4A 4Y7VA 5AJOA 2YQHA 2WVKA 4CJCA 1FG5N 2E8BA 5C3BA 1JV3A 1VPAA 3U0XA 5C1GA 1PZYB 5CQNX 4NAKA 5FU0A 1I52A 2X65A 1R7TA 4O6NA 1R7UA 4B4BA 4DE7A 3RSBA 3SX5A 1ZJ0A 1YP2A 2YQSA 2RJ6A 2PGVA 2RIZA 1YROB 3I0DA 1LZ0A 4KRVA 3ST8A 1EYRA 1H5SD 3SXBA 1O7OA 3PKQA 1KWSA 4BMAA 2XWLA 3RMWA 1JVGA 5C1HA 4M2BA 4LW6A 2UX8A 4M28A 1FWYA 3U2XA 2OEFA 1FR9A 1SS9A 4FRAA 1YP4A 3V0OA 4HO6A 3ZF8A 3HL3A 1G1LA 1S4NA 3T7MA 2VSIA 2W0VA 1GQCA 1H5SC 4Y62A 4AYJA 4EE3A 4Y63A 4KNXA 4UEGA 1ZJ3A 4NALA 2V0IA 2AM3A 1ZDFA 2VFZA 1R82A 4FROA 5IDSA 1ZCVA 2YESA 5DDTA 2FYBA 2MZBA 3CKQA 1LZJA 3Q7UA 5DDVA 3V0NA 4B4GA 2RITA 2A8UA 2RJ9A 1V84A 1R81A 2O1FA 2XMEA 4Y64A 3ZGGA 4EEGA 2X60A 4MNDA 4B2XA 1K4VA 3CGXA 1QWJA 2XWNA 3I0CA 1INIA 1W55A 5C1LA 3CKVA 3V8ZA 1VZTA 5CMHA 4Y6NA 3R2WA 1IINA 3U2UA 1ON8A 1WT3A 1ZCUA 2YQJA 4ARWA 3POLA 1H7EA 3D8VA 2WAWA 1ZDGA 2A8WA 1LL2A 1R7VA 1G23A 2ZU8A 4EEAA 5JQQA 5FUHA 1S4OA 2APCA 1WT2A 3JTJA 3V8YA 1V82A 4FCUA 4KC2A 1OMXA 1NQIB 1E5KA 5CQOA 4BQHA 2GGOA 1H5RA 2I7BA 1VICA 1VZXA 5C4DA 1VH1A 1XZ6A 1FXJA 3IOHA 3OAMA 3Q4SA 4FIYA 2J0AA 4NAIA 3OGZA 1QGQA 2PGYA 4L41C 3U2TA 2VXLA 3JUKA 3RMVA 1W77A 2FFUA 4HO9A 3JUJA 2Y4LA 2ICXA 2D7RA 2V0LA 2YCMA 3Q80A 2CU2A 3CKNA 2Y4JA 3D98A 1VGZA 2OI5A 4Y9XA 4FREA 4HO4A 5IFYA 4MIXA 5FTSA 1GWWA 2FFVA 2YC3A 2YC5A 3O3PA 5C3AA 4ECMA 4JISA 5AJPA 2W0WA 4FRBA
chains in the Genus database with same CATH topology
1HJLA 2RJ7A 4MYBA 2Y7AA 1H4EA 4IRQA 4C2SA 5D92A 3QVBA 1WSZA 1OMZA 3EE5A 4LW3A 4EE5A 4D11C 2VD4A 2QGIA 4KNRA 5FU8A 3SX7A 2O1HA 3F1YA 2RJ8A 1GWVA 3I0FA 3OH3A 3SX3A 1H5SB 4FCEA 1W57A 5HS2A 1FR8A 1H7QA 4HO0A 4FRLA 4KPXA 2RIYA 4EEOA 1QGSA 1G9RA 4FRDA 3I0JA 1ON6A 4HO8A 5C4CA 4FRMA 3I0LA 3V0QA 3I0EA 4ZDQA 5C36A 4G3SA 1NWGB 4K6RA 3N9WA 2XWMA 5C47A 4R7PA 1HJJA 3ZLLA 3TZTA 4XWIA 4Y7FA 5EJ1A 1FO8A 1G97A 2V0KA 1H7TA 1VZUA 3CKJA 2AE7A 2VS5A 2JCKA 5CQLX 2WVMA 1ZI3A 3TQDA 3V0MA 2P72A 4B4MA 5EJZA 2P73A 2VS4A 3GUEA 3USRA 2V0HA 1H7HA 2P6WA 1WT1A 5L6SA 4D48A 3SXDA 1H7FA 3OC9A 1H5TB 1HM0A 1GX4A 1ZIZA 2XMHA 1EZIA 4HCQA 5C8RA 2AGDA 4P02A 2QKXA 4JD0A 1G93A 4AC3A 4Y7GA 2Z86A 3I0GA 1VH3A 3PKPA 1H5SA 1LVWA 1LZIA 3ZLKA 1TW5A 2BO8A 2E3DA 2FY7A 3KIAA 4B42A 5FYEA 5BXCA 5J49A 1ZI4A 2Y6PA 5CMIA 2AESA 3R3IA 1YP3A 2JCLA 2RIXA 4O6MA 4DDZA 4Y7TA 3NGWA 1INJA 4M4KA 2X5ZA 3K8EA 1FGXA 3U2VA 1R7XA 4ASYA 1H3MA 1H7LA 2D0JA 2WGZA 1VGWA 2PX7A 1O23B 1ZCYA 1O7QA 3I0KA 1G2VA 2AM4A 4DECA 4B2WA 4FRHA 5C48A 3USQA 1MP3A 4HG6A 5CMGX 1NMMB 1LZ7A 2GGQA 2OI7A 1PZTA 4G3QA 1H5TA 5C4EA 1HM8A 1MP4A 1XHBA 5I1FA 1OQMB 4FQWA 1ZJ2A 2O1GA 2RJ5A 3SXGA 3U2WA 1NF5B 1H4CA 4KC4A 4J18A 2Y4MA 3D5NA 2WVLA 5C4BA 5CMJA 3OH0A 1R7YA 1V83A 1FXOA 4CJBA 1GQ9A 1WT0A 1TW1A 4CVHA 3U0YA 4Q7CA 5CQMX 3SXEA 3SPTA 2VXMA 3V90A 2YQCA 3FWWA 5CMFX 5C3DA 2RJ1A 3DUVA 1FOAA 2V0JA 4D0ZA 3E25A 2ZU7A 2RJ4A 2C0NA 3IOIA 4CJ8A 2FYDB 1ZHJA 2BO7A 1JV1A 3PNNA 3T7OA 1R80A 1ZJPA 1TZFA 2Y4KA 4Y6UA 2WE9A 1JYKA 2Q4JA 3V91A 4D11A 1MC3A 4GBPA 1WVCA 1GA8A 1LL3A 4G3PA 4B5BA 1ZI5A 4KT7A 1FZWA 1QG8A 3I0HA 2WEEA 4G87A 3T7NA 1ZJ1A 3OKRA 1JYLA 3SXAA 4KQLA 2VSHA 4EE4A 1TVYA 2I5EA 3OH2A 1NHEB 1FRWA 5IDTA 1HM9A 1H5RB 4EEMA 2JCOA 4EVWA 3ZGFA 4YS8A 3E26A 3K8DA 3F1CA 2VK9A 4Y7UA 1ZJOA 4HO5A 5FV9A 3SXCA 3BRKX 3SX8A 2QH5A 3DK5A 4B3UA 3FOQA 4ASJA 1HV9A 4FRPA 2I5KA 3CKOA 5EIYA 2PA4A 3BCVA 1H4DA 1G3LA 1ZCTA 5FTVA 1IIMA 1MP5A 4M2AA 1GX0A 3CU0A 2J0BA 4AYLA 3V0PA 4AAWA 4D0TA 2OI6A 1S4PA 5C49A 5C4FA 2AM5A 2AH9A 2X5SA 5D91A 5C38A 4IRPA 2FYCB 1LL0A 4NANA 4E1KA 1VGUA 2FYAA 4KXOA 4HO3A 2NXVA 1G95A 5L6VA 1O0RA 1G0RA 4HOCA 2ZU9A 3OH4A 2ICYA 4P00A 1H7GA 3I0IX 4FIXA 2BO6A 2VS3A 2BO4A 5AJNA 2JCJA 2Z87A 3V0LA 3LW6A 1NKHB 2DPWA 4HO2A 4KC1A 3OH1A 1G8OA 3IOJA 1VGTA 1FGGA 1ZI1A 2RJ0A 2AECA 1VM8A 2OEGA 4KPZA 4FRQA 5CQPA 1Z90A 1FO9A 1JVDA 2D7IA 3DJ4A 4Y7VA 5AJOA 2YQHA 2WVKA 4CJCA 1FG5N 2E8BA 5C3BA 1JV3A 1VPAA 3U0XA 5C1GA 1PZYB 5CQNX 4NAKA 5FU0A 1I52A 2X65A 1R7TA 4O6NA 1R7UA 4B4BA 4DE7A 3RSBA 3SX5A 1ZJ0A 1YP2A 2YQSA 2RJ6A 2PGVA 2RIZA 1YROB 3I0DA 1LZ0A 4KRVA 3ST8A 1EYRA 1H5SD 3SXBA 1O7OA 3PKQA 1KWSA 4BMAA 2XWLA 3RMWA 1JVGA 5C1HA 4M2BA 4LW6A 2UX8A 4M28A 1FWYA 3U2XA 2OEFA 1FR9A 1SS9A 4FRAA 1YP4A 3V0OA 4HO6A 3ZF8A 3HL3A 1G1LA 1S4NA 3T7MA 2VSIA 2W0VA 1GQCA 1H5SC 4Y62A 4AYJA 4EE3A 4Y63A 4KNXA 4UEGA 1ZJ3A 4NALA 2V0IA 2AM3A 1ZDFA 2VFZA 1R82A 4FROA 5IDSA 1ZCVA 2YESA 5DDTA 2FYBA 2MZBA 3CKQA 1LZJA 3Q7UA 5DDVA 3V0NA 4B4GA 2RITA 2A8UA 2RJ9A 1V84A 1R81A 2O1FA 2XMEA 4Y64A 3ZGGA 4EEGA 2X60A 4MNDA 4B2XA 1K4VA 3CGXA 1QWJA 2XWNA 3I0CA 1INIA 1W55A 5C1LA 3CKVA 3V8ZA 1VZTA 5CMHA 4Y6NA 3R2WA 1IINA 3U2UA 1ON8A 1WT3A 1ZCUA 2YQJA 4ARWA 3POLA 1H7EA 3D8VA 2WAWA 1ZDGA 2A8WA 1LL2A 1R7VA 1G23A 2ZU8A 4EEAA 5JQQA 5FUHA 1S4OA 2APCA 1WT2A 3JTJA 3V8YA 1V82A 4FCUA 4KC2A 1OMXA 1NQIB 1E5KA 5CQOA 4BQHA 2GGOA 1H5RA 2I7BA 1VICA 1VZXA 5C4DA 1VH1A 1XZ6A 1FXJA 3IOHA 3OAMA 3Q4SA 4FIYA 2J0AA 4NAIA 3OGZA 1QGQA 2PGYA 4L41C 3U2TA 2VXLA 3JUKA 3RMVA 1W77A 2FFUA 4HO9A 3JUJA 2Y4LA 2ICXA 2D7RA 2V0LA 2YCMA 3Q80A 2CU2A 3CKNA 2Y4JA 3D98A 1VGZA 2OI5A 4Y9XA 4FREA 4HO4A 5IFYA 4MIXA 5FTSA 1GWWA 2FFVA 2YC3A 2YC5A 3O3PA 5C3AA 4ECMA 4JISA 5AJPA 2W0WA 4FRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HJL A;  2RJ7 A;  4MYB A;  2Y7A A;  1H4E A;  4IRQ A;  4C2S A;  3QVB A;  1WSZ A;  1OMZ A;  3EE5 A;  4LW3 A;  4EE5 A;  4D11 C;  2VD4 A;  2QGI A;  4KNR A;  5FU8 A;  3SX7 A;  2O1H A;  3F1Y A;  2RJ8 A;  1GWV A;  3I0F A;  3OH3 A;  3SX3 A;  1H5S B;  4FCE A;  1W57 A;  5HS2 A;  1FR8 A;  1H7Q A;  4HO0 A;  4FRL A;  4KPX A;  2RIY A;  4EEO A;  1QGS A;  1G9R A;  4FRD A;  3I0J A;  1ON6 A;  4HO8 A;  5C4C A;  4FRM A;  3I0L A;  3V0Q A;  3I0E A;  4ZDQ A;  5C36 A;  4G3S A;  1NWG B;  4K6R A;  3N9W A;  2XWM A;  5C47 A;  4R7P A;  1HJJ A;  3ZLL A;  3TZT A;  4XWI A;  4Y7F A;  5EJ1 A;  1FO8 A;  1G97 A;  2V0K A;  1H7T A;  1VZU A;  3CKJ A;  2AE7 A;  2VS5 A;  2JCK A;  5CQL X;  2WVM A;  1ZI3 A;  3TQD A;  3V0M A;  2P72 A;  4B4M A;  5EJZ A;  2P73 A;  2VS4 A;  3GUE A;  3USR A;  2V0H A;  1H7H A;  2P6W A;  1WT1 A;  5L6S A;  4D48 A;  3SXD A;  1H7F A;  3OC9 A;  1H5T B;  1HM0 A;  1GX4 A;  1ZIZ A;  2XMH A;  1EZI A;  4HCQ A;  5C8R A;  2AGD A;  4P02 A;  2QKX A;  4JD0 A;  1G93 A;  4AC3 A;  4Y7G A;  2Z86 A;  3I0G A;  1VH3 A;  3PKP A;  1H5S A;  1LVW A;  1LZI A;  3ZLK A;  1TW5 A;  2BO8 A;  2E3D A;  2FY7 A;  3KIA A;  4B42 A;  5FYE A;  5BXC A;  5J49 A;  1ZI4 A;  2Y6P A;  5CMI A;  2AES A;  3R3I A;  1YP3 A;  2JCL A;  2RIX A;  4DDZ A;  4Y7T A;  3NGW A;  1INJ A;  4M4K A;  2X5Z A;  3K8E A;  1FGX A;  3U2V A;  1R7X A;  4ASY A;  1H3M A;  1H7L A;  2D0J A;  2WGZ A;  1VGW A;  2PX7 A;  1O23 B;  1ZCY A;  1O7Q A;  3I0K A;  1G2V A;  2AM4 A;  4DEC A;  4B2W A;  4FRH A;  5C48 A;  3USQ A;  1MP3 A;  4HG6 A;  5CMG X;  1NMM B;  1LZ7 A;  2GGQ A;  2OI7 A;  1PZT A;  4G3Q A;  1H5T A;  5C4E A;  1HM8 A;  1MP4 A;  1XHB A;  5I1F A;  1OQM B;  4FQW A;  1ZJ2 A;  2O1G A;  2RJ5 A;  3SXG A;  3U2W A;  1NF5 B;  1H4C A;  4KC4 A;  4J18 A;  2Y4M A;  3D5N A;  2WVL A;  5C4B A;  5CMJ A;  3OH0 A;  1R7Y A;  1V83 A;  1FXO A;  4CJB A;  1GQ9 A;  1WT0 A;  1TW1 A;  4CVH A;  3U0Y A;  5CQM X;  3SXE A;  3SPT A;  2VXM A;  3V90 A;  2YQC A;  3FWW A;  5CMF X;  5C3D A;  2RJ1 A;  3DUV A;  1FOA A;  2V0J A;  4D0Z A;  3E25 A;  2ZU7 A;  2RJ4 A;  3IOI A;  4CJ8 A;  2FYD B;  1ZHJ A;  2BO7 A;  1JV1 A;  3PNN A;  3T7O A;  1R80 A;  1ZJP A;  1TZF A;  2Y4K A;  4Y6U A;  2WE9 A;  1JYK A;  2Q4J A;  3V91 A;  4D11 A;  1MC3 A;  4GBP A;  1WVC A;  1GA8 A;  1LL3 A;  4G3P A;  4B5B A;  1ZI5 A;  4KT7 A;  1FZW A;  1QG8 A;  3I0H A;  2WEE A;  4G87 A;  3T7N A;  1ZJ1 A;  3OKR A;  1JYL A;  3SXA A;  4KQL A;  2VSH A;  4EE4 A;  1TVY A;  2I5E A;  3OH2 A;  1NHE B;  1FRW A;  5IDT A;  1HM9 A;  1H5R B;  4EEM A;  2JCO A;  4EVW A;  3ZGF A;  4YS8 A;  3E26 A;  3K8D A;  3F1C A;  4Y7U A;  1ZJO A;  4HO5 A;  5FV9 A;  3SXC A;  3BRK X;  3SX8 A;  2QH5 A;  3DK5 A;  4B3U A;  3FOQ A;  4ASJ A;  1HV9 A;  4FRP A;  2I5K A;  3CKO A;  5EIY A;  2PA4 A;  3BCV A;  1H4D A;  1G3L A;  1ZCT A;  5FTV A;  1IIM A;  1MP5 A;  4M2A A;  1GX0 A;  3CU0 A;  4AYL A;  3V0P A;  4AAW A;  4D0T A;  2OI6 A;  1S4P A;  5C49 A;  5C4F A;  2AM5 A;  2AH9 A;  2X5S A;  5C38 A;  4IRP A;  2FYC B;  1LL0 A;  4NAN A;  4E1K A;  1VGU A;  2FYA A;  4KXO A;  4HO3 A;  2NXV A;  1G95 A;  5L6V A;  1O0R A;  1G0R A;  4HOC A;  2ZU9 A;  3OH4 A;  2ICY A;  4P00 A;  1H7G A;  3I0I X;  2BO6 A;  2VS3 A;  2BO4 A;  5AJN A;  2JCJ A;  2Z87 A;  3V0L A;  3LW6 A;  1NKH B;  2DPW A;  4HO2 A;  4KC1 A;  3OH1 A;  1G8O A;  3IOJ A;  1VGT A;  1FGG A;  1ZI1 A;  2RJ0 A;  2AEC A;  1VM8 A;  2OEG A;  4KPZ A;  4FRQ A;  5CQP A;  1Z90 A;  1FO9 A;  3DJ4 A;  1JVD A;  2D7I A;  4Y7V A;  5AJO A;  2YQH A;  2WVK A;  4CJC A;  1FG5 N;  2E8B A;  5C3B A;  1JV3 A;  1VPA A;  3U0X A;  5C1G A;  1PZY B;  5CQN X;  4NAK A;  5FU0 A;  1I52 A;  2X65 A;  1R7T A;  1R7U A;  4B4B A;  4DE7 A;  3RSB A;  3SX5 A;  1ZJ0 A;  1YP2 A;  2YQS A;  2RJ6 A;  2PGV A;  2RIZ A;  1YRO B;  3I0D A;  1LZ0 A;  4KRV A;  3ST8 A;  1EYR A;  1H5S D;  3SXB A;  1O7O A;  3PKQ A;  1KWS A;  4BMA A;  2XWL A;  3RMW A;  1JVG A;  5C1H A;  4M2B A;  4LW6 A;  2UX8 A;  4M28 A;  1FWY A;  3U2X A;  2OEF A;  1FR9 A;  1SS9 A;  4FRA A;  1YP4 A;  3V0O A;  4HO6 A;  3ZF8 A;  3HL3 A;  1G1L A;  1S4N A;  3T7M A;  2VSI A;  2W0V A;  1GQC A;  1H5S C;  4Y62 A;  4AYJ A;  4EE3 A;  4Y63 A;  4KNX A;  4UEG A;  1ZJ3 A;  4NAL A;  2V0I A;  2AM3 A;  1ZDF A;  2VFZ A;  1R82 A;  4FRO A;  5IDS A;  1ZCV A;  2YES A;  5DDT A;  2FYB A;  2MZB A;  3CKQ A;  1LZJ A;  3Q7U A;  5DDV A;  3V0N A;  4B4G A;  2RIT A;  2A8U A;  2RJ9 A;  1V84 A;  1R81 A;  2O1F A;  2XME A;  4Y64 A;  3ZGG A;  4EEG A;  2X60 A;  4MND A;  4B2X A;  1K4V A;  3CGX A;  1QWJ A;  2XWN A;  3I0C A;  1INI A;  1W55 A;  5C1L A;  3CKV A;  3V8Z A;  1VZT A;  5CMH A;  4Y6N A;  3R2W A;  1IIN A;  3U2U A;  1ON8 A;  1WT3 A;  1ZCU A;  2YQJ A;  4ARW A;  3POL A;  1H7E A;  3D8V A;  2WAW A;  1ZDG A;  2A8W A;  1LL2 A;  1R7V A;  1G23 A;  2ZU8 A;  4EEA A;  5JQQ A;  5FUH A;  1S4O A;  2APC A;  1WT2 A;  3JTJ A;  3V8Y A;  1V82 A;  4FCU A;  4KC2 A;  1OMX A;  1NQI B;  1E5K A;  5CQO A;  4BQH A;  2GGO A;  1H5R A;  2I7B A;  1VIC A;  1VZX A;  5C4D A;  1VH1 A;  1XZ6 A;  1FXJ A;  3IOH A;  3OAM A;  3Q4S A;  4NAI A;  3OGZ A;  1QGQ A;  2PGY A;  4L41 C;  3U2T A;  2VXL A;  3JUK A;  3RMV A;  1W77 A;  2FFU A;  4HO9 A;  3JUJ A;  2Y4L A;  2ICX A;  2D7R A;  2V0L A;  2YCM A;  3Q80 A;  2CU2 A;  3CKN A;  2Y4J A;  3D98 A;  1VGZ A;  2OI5 A;  4Y9X A;  4FRE A;  4HO4 A;  5IFY A;  5FTS A;  1GWW A;  2FFV A;  2YC3 A;  2YC5 A;  3O3P A;  5C3A A;  4ECM A;  4JIS A;  5AJP A;  2W0W A;  4FRB A; 
#chains in the Genus database with same CATH topology
 1HJL A;  2RJ7 A;  4MYB A;  2Y7A A;  1H4E A;  4IRQ A;  4C2S A;  5D92 A;  3QVB A;  1WSZ A;  1OMZ A;  3EE5 A;  4LW3 A;  4EE5 A;  4D11 C;  2VD4 A;  2QGI A;  4KNR A;  5FU8 A;  3SX7 A;  2O1H A;  3F1Y A;  2RJ8 A;  1GWV A;  3I0F A;  3OH3 A;  3SX3 A;  1H5S B;  4FCE A;  1W57 A;  5HS2 A;  1FR8 A;  1H7Q A;  4HO0 A;  4FRL A;  4KPX A;  2RIY A;  4EEO A;  1QGS A;  1G9R A;  4FRD A;  3I0J A;  1ON6 A;  4HO8 A;  5C4C A;  4FRM A;  3I0L A;  3V0Q A;  3I0E A;  4ZDQ A;  5C36 A;  4G3S A;  1NWG B;  4K6R A;  3N9W A;  2XWM A;  5C47 A;  4R7P A;  1HJJ A;  3ZLL A;  3TZT A;  4XWI A;  4Y7F A;  5EJ1 A;  1FO8 A;  1G97 A;  2V0K A;  1H7T A;  1VZU A;  3CKJ A;  2AE7 A;  2VS5 A;  2JCK A;  5CQL X;  2WVM A;  1ZI3 A;  3TQD A;  3V0M A;  2P72 A;  4B4M A;  5EJZ A;  2P73 A;  2VS4 A;  3GUE A;  3USR A;  2V0H A;  1H7H A;  2P6W A;  1WT1 A;  5L6S A;  4D48 A;  3SXD A;  1H7F A;  3OC9 A;  1H5T B;  1HM0 A;  1GX4 A;  1ZIZ A;  2XMH A;  1EZI A;  4HCQ A;  5C8R A;  2AGD A;  4P02 A;  2QKX A;  4JD0 A;  1G93 A;  4AC3 A;  4Y7G A;  2Z86 A;  3I0G A;  1VH3 A;  3PKP A;  1H5S A;  1LVW A;  1LZI A;  3ZLK A;  1TW5 A;  2BO8 A;  2E3D A;  2FY7 A;  3KIA A;  4B42 A;  5FYE A;  5BXC A;  5J49 A;  1ZI4 A;  2Y6P A;  5CMI A;  2AES A;  3R3I A;  1YP3 A;  2JCL A;  2RIX A;  4O6M A;  4DDZ A;  4Y7T A;  3NGW A;  1INJ A;  4M4K A;  2X5Z A;  3K8E A;  1FGX A;  3U2V A;  1R7X A;  4ASY A;  1H3M A;  1H7L A;  2D0J A;  2WGZ A;  1VGW A;  2PX7 A;  1O23 B;  1ZCY A;  1O7Q A;  3I0K A;  1G2V A;  2AM4 A;  4DEC A;  4B2W A;  4FRH A;  5C48 A;  3USQ A;  1MP3 A;  4HG6 A;  5CMG X;  1NMM B;  1LZ7 A;  2GGQ A;  2OI7 A;  1PZT A;  4G3Q A;  1H5T A;  5C4E A;  1HM8 A;  1MP4 A;  1XHB A;  5I1F A;  1OQM B;  4FQW A;  1ZJ2 A;  2O1G A;  2RJ5 A;  3SXG A;  3U2W A;  1NF5 B;  1H4C A;  4KC4 A;  4J18 A;  2Y4M A;  3D5N A;  2WVL A;  5C4B A;  5CMJ A;  3OH0 A;  1R7Y A;  1V83 A;  1FXO A;  4CJB A;  1GQ9 A;  1WT0 A;  1TW1 A;  4CVH A;  3U0Y A;  4Q7C A;  5CQM X;  3SXE A;  3SPT A;  2VXM A;  3V90 A;  2YQC A;  3FWW A;  5CMF X;  5C3D A;  2RJ1 A;  3DUV A;  1FOA A;  2V0J A;  4D0Z A;  3E25 A;  2ZU7 A;  2RJ4 A;  2C0N A;  3IOI A;  4CJ8 A;  2FYD B;  1ZHJ A;  2BO7 A;  1JV1 A;  3PNN A;  3T7O A;  1R80 A;  1ZJP A;  1TZF A;  2Y4K A;  4Y6U A;  2WE9 A;  1JYK A;  2Q4J A;  3V91 A;  4D11 A;  1MC3 A;  4GBP A;  1WVC A;  1GA8 A;  1LL3 A;  4G3P A;  4B5B A;  1ZI5 A;  4KT7 A;  1FZW A;  1QG8 A;  3I0H A;  2WEE A;  4G87 A;  3T7N A;  1ZJ1 A;  3OKR A;  1JYL A;  3SXA A;  4KQL A;  2VSH A;  4EE4 A;  1TVY A;  2I5E A;  3OH2 A;  1NHE B;  1FRW A;  5IDT A;  1HM9 A;  1H5R B;  4EEM A;  2JCO A;  4EVW A;  3ZGF A;  4YS8 A;  3E26 A;  3K8D A;  3F1C A;  2VK9 A;  4Y7U A;  1ZJO A;  4HO5 A;  5FV9 A;  3SXC A;  3BRK X;  3SX8 A;  2QH5 A;  3DK5 A;  4B3U A;  3FOQ A;  4ASJ A;  1HV9 A;  4FRP A;  2I5K A;  3CKO A;  5EIY A;  2PA4 A;  3BCV A;  1H4D A;  1G3L A;  1ZCT A;  5FTV A;  1IIM A;  1MP5 A;  4M2A A;  1GX0 A;  3CU0 A;  2J0B A;  4AYL A;  3V0P A;  4AAW A;  4D0T A;  2OI6 A;  1S4P A;  5C49 A;  5C4F A;  2AM5 A;  2AH9 A;  2X5S A;  5D91 A;  5C38 A;  4IRP A;  2FYC B;  1LL0 A;  4NAN A;  4E1K A;  1VGU A;  2FYA A;  4KXO A;  4HO3 A;  2NXV A;  1G95 A;  5L6V A;  1O0R A;  1G0R A;  4HOC A;  2ZU9 A;  3OH4 A;  2ICY A;  4P00 A;  1H7G A;  3I0I X;  4FIX A;  2BO6 A;  2VS3 A;  2BO4 A;  5AJN A;  2JCJ A;  2Z87 A;  3V0L A;  3LW6 A;  1NKH B;  2DPW A;  4HO2 A;  4KC1 A;  3OH1 A;  1G8O A;  3IOJ A;  1VGT A;  1FGG A;  1ZI1 A;  2RJ0 A;  2AEC A;  1VM8 A;  2OEG A;  4KPZ A;  4FRQ A;  5CQP A;  1Z90 A;  1FO9 A;  1JVD A;  2D7I A;  3DJ4 A;  4Y7V A;  5AJO A;  2YQH A;  2WVK A;  4CJC A;  1FG5 N;  2E8B A;  5C3B A;  1JV3 A;  1VPA A;  3U0X A;  5C1G A;  1PZY B;  5CQN X;  4NAK A;  5FU0 A;  1I52 A;  2X65 A;  1R7T A;  4O6N A;  1R7U A;  4B4B A;  4DE7 A;  3RSB A;  3SX5 A;  1ZJ0 A;  1YP2 A;  2YQS A;  2RJ6 A;  2PGV A;  2RIZ A;  1YRO B;  3I0D A;  1LZ0 A;  4KRV A;  3ST8 A;  1EYR A;  1H5S D;  3SXB A;  1O7O A;  3PKQ A;  1KWS A;  4BMA A;  2XWL A;  3RMW A;  1JVG A;  5C1H A;  4M2B A;  4LW6 A;  2UX8 A;  4M28 A;  1FWY A;  3U2X A;  2OEF A;  1FR9 A;  1SS9 A;  4FRA A;  1YP4 A;  3V0O A;  4HO6 A;  3ZF8 A;  3HL3 A;  1G1L A;  1S4N A;  3T7M A;  2VSI A;  2W0V A;  1GQC A;  1H5S C;  4Y62 A;  4AYJ A;  4EE3 A;  4Y63 A;  4KNX A;  4UEG A;  1ZJ3 A;  4NAL A;  2V0I A;  2AM3 A;  1ZDF A;  2VFZ A;  1R82 A;  4FRO A;  5IDS A;  1ZCV A;  2YES A;  5DDT A;  2FYB A;  2MZB A;  3CKQ A;  1LZJ A;  3Q7U A;  5DDV A;  3V0N A;  4B4G A;  2RIT A;  2A8U A;  2RJ9 A;  1V84 A;  1R81 A;  2O1F A;  2XME A;  4Y64 A;  3ZGG A;  4EEG A;  2X60 A;  4MND A;  4B2X A;  1K4V A;  3CGX A;  1QWJ A;  2XWN A;  3I0C A;  1INI A;  1W55 A;  5C1L A;  3CKV A;  3V8Z A;  1VZT A;  5CMH A;  4Y6N A;  3R2W A;  1IIN A;  3U2U A;  1ON8 A;  1WT3 A;  1ZCU A;  2YQJ A;  4ARW A;  3POL A;  1H7E A;  3D8V A;  2WAW A;  1ZDG A;  2A8W A;  1LL2 A;  1R7V A;  1G23 A;  2ZU8 A;  4EEA A;  5JQQ A;  5FUH A;  1S4O A;  2APC A;  1WT2 A;  3JTJ A;  3V8Y A;  1V82 A;  4FCU A;  4KC2 A;  1OMX A;  1NQI B;  1E5K A;  5CQO A;  4BQH A;  2GGO A;  1H5R A;  2I7B A;  1VIC A;  1VZX A;  5C4D A;  1VH1 A;  1XZ6 A;  1FXJ A;  3IOH A;  3OAM A;  3Q4S A;  4FIY A;  2J0A A;  4NAI A;  3OGZ A;  1QGQ A;  2PGY A;  4L41 C;  3U2T A;  2VXL A;  3JUK A;  3RMV A;  1W77 A;  2FFU A;  4HO9 A;  3JUJ A;  2Y4L A;  2ICX A;  2D7R A;  2V0L A;  2YCM A;  3Q80 A;  2CU2 A;  3CKN A;  2Y4J A;  3D98 A;  1VGZ A;  2OI5 A;  4Y9X A;  4FRE A;  4HO4 A;  5IFY A;  4MIX A;  5FTS A;  1GWW A;  2FFV A;  2YC3 A;  2YC5 A;  3O3P A;  5C3A A;  4ECM A;  4JIS A;  5AJP A;  2W0W A;  4FRB A; 
#chains in the Genus database with same CATH homology
 1HJL A;  2RJ7 A;  4MYB A;  2Y7A A;  1H4E A;  4IRQ A;  4C2S A;  5D92 A;  3QVB A;  1WSZ A;  1OMZ A;  3EE5 A;  4LW3 A;  4EE5 A;  4D11 C;  2VD4 A;  2QGI A;  4KNR A;  5FU8 A;  3SX7 A;  2O1H A;  3F1Y A;  2RJ8 A;  1GWV A;  3I0F A;  3OH3 A;  3SX3 A;  1H5S B;  4FCE A;  1W57 A;  5HS2 A;  1FR8 A;  1H7Q A;  4HO0 A;  4FRL A;  4KPX A;  2RIY A;  4EEO A;  1QGS A;  1G9R A;  4FRD A;  3I0J A;  1ON6 A;  4HO8 A;  5C4C A;  4FRM A;  3I0L A;  3V0Q A;  3I0E A;  4ZDQ A;  5C36 A;  4G3S A;  1NWG B;  4K6R A;  3N9W A;  2XWM A;  5C47 A;  4R7P A;  1HJJ A;  3ZLL A;  3TZT A;  4XWI A;  4Y7F A;  5EJ1 A;  1FO8 A;  1G97 A;  2V0K A;  1H7T A;  1VZU A;  3CKJ A;  2AE7 A;  2VS5 A;  2JCK A;  5CQL X;  2WVM A;  1ZI3 A;  3TQD A;  3V0M A;  2P72 A;  4B4M A;  5EJZ A;  2P73 A;  2VS4 A;  3GUE A;  3USR A;  2V0H A;  1H7H A;  2P6W A;  1WT1 A;  5L6S A;  4D48 A;  3SXD A;  1H7F A;  3OC9 A;  1H5T B;  1HM0 A;  1GX4 A;  1ZIZ A;  2XMH A;  1EZI A;  4HCQ A;  5C8R A;  2AGD A;  4P02 A;  2QKX A;  4JD0 A;  1G93 A;  4AC3 A;  4Y7G A;  2Z86 A;  3I0G A;  1VH3 A;  3PKP A;  1H5S A;  1LVW A;  1LZI A;  3ZLK A;  1TW5 A;  2BO8 A;  2E3D A;  2FY7 A;  3KIA A;  4B42 A;  5FYE A;  5BXC A;  5J49 A;  1ZI4 A;  2Y6P A;  5CMI A;  2AES A;  3R3I A;  1YP3 A;  2JCL A;  2RIX A;  4O6M A;  4DDZ A;  4Y7T A;  3NGW A;  1INJ A;  4M4K A;  2X5Z A;  3K8E A;  1FGX A;  3U2V A;  1R7X A;  4ASY A;  1H3M A;  1H7L A;  2D0J A;  2WGZ A;  1VGW A;  2PX7 A;  1O23 B;  1ZCY A;  1O7Q A;  3I0K A;  1G2V A;  2AM4 A;  4DEC A;  4B2W A;  4FRH A;  5C48 A;  3USQ A;  1MP3 A;  4HG6 A;  5CMG X;  1NMM B;  1LZ7 A;  2GGQ A;  2OI7 A;  1PZT A;  4G3Q A;  1H5T A;  5C4E A;  1HM8 A;  1MP4 A;  1XHB A;  5I1F A;  1OQM B;  4FQW A;  1ZJ2 A;  2O1G A;  2RJ5 A;  3SXG A;  3U2W A;  1NF5 B;  1H4C A;  4KC4 A;  4J18 A;  2Y4M A;  3D5N A;  2WVL A;  5C4B A;  5CMJ A;  3OH0 A;  1R7Y A;  1V83 A;  1FXO A;  4CJB A;  1GQ9 A;  1WT0 A;  1TW1 A;  4CVH A;  3U0Y A;  4Q7C A;  5CQM X;  3SXE A;  3SPT A;  2VXM A;  3V90 A;  2YQC A;  3FWW A;  5CMF X;  5C3D A;  2RJ1 A;  3DUV A;  1FOA A;  2V0J A;  4D0Z A;  3E25 A;  2ZU7 A;  2RJ4 A;  2C0N A;  3IOI A;  4CJ8 A;  2FYD B;  1ZHJ A;  2BO7 A;  1JV1 A;  3PNN A;  3T7O A;  1R80 A;  1ZJP A;  1TZF A;  2Y4K A;  4Y6U A;  2WE9 A;  1JYK A;  2Q4J A;  3V91 A;  4D11 A;  1MC3 A;  4GBP A;  1WVC A;  1GA8 A;  1LL3 A;  4G3P A;  4B5B A;  1ZI5 A;  4KT7 A;  1FZW A;  1QG8 A;  3I0H A;  2WEE A;  4G87 A;  3T7N A;  1ZJ1 A;  3OKR A;  1JYL A;  3SXA A;  4KQL A;  2VSH A;  4EE4 A;  1TVY A;  2I5E A;  3OH2 A;  1NHE B;  1FRW A;  5IDT A;  1HM9 A;  1H5R B;  4EEM A;  2JCO A;  4EVW A;  3ZGF A;  4YS8 A;  3E26 A;  3K8D A;  3F1C A;  2VK9 A;  4Y7U A;  1ZJO A;  4HO5 A;  5FV9 A;  3SXC A;  3BRK X;  3SX8 A;  2QH5 A;  3DK5 A;  4B3U A;  3FOQ A;  4ASJ A;  1HV9 A;  4FRP A;  2I5K A;  3CKO A;  5EIY A;  2PA4 A;  3BCV A;  1H4D A;  1G3L A;  1ZCT A;  5FTV A;  1IIM A;  1MP5 A;  4M2A A;  1GX0 A;  3CU0 A;  2J0B A;  4AYL A;  3V0P A;  4AAW A;  4D0T A;  2OI6 A;  1S4P A;  5C49 A;  5C4F A;  2AM5 A;  2AH9 A;  2X5S A;  5D91 A;  5C38 A;  4IRP A;  2FYC B;  1LL0 A;  4NAN A;  4E1K A;  1VGU A;  2FYA A;  4KXO A;  4HO3 A;  2NXV A;  1G95 A;  5L6V A;  1O0R A;  1G0R A;  4HOC A;  2ZU9 A;  3OH4 A;  2ICY A;  4P00 A;  1H7G A;  3I0I X;  4FIX A;  2BO6 A;  2VS3 A;  2BO4 A;  5AJN A;  2JCJ A;  2Z87 A;  3V0L A;  3LW6 A;  1NKH B;  2DPW A;  4HO2 A;  4KC1 A;  3OH1 A;  1G8O A;  3IOJ A;  1VGT A;  1FGG A;  1ZI1 A;  2RJ0 A;  2AEC A;  1VM8 A;  2OEG A;  4KPZ A;  4FRQ A;  5CQP A;  1Z90 A;  1FO9 A;  1JVD A;  2D7I A;  3DJ4 A;  4Y7V A;  5AJO A;  2YQH A;  2WVK A;  4CJC A;  1FG5 N;  2E8B A;  5C3B A;  1JV3 A;  1VPA A;  3U0X A;  5C1G A;  1PZY B;  5CQN X;  4NAK A;  5FU0 A;  1I52 A;  2X65 A;  1R7T A;  4O6N A;  1R7U A;  4B4B A;  4DE7 A;  3RSB A;  3SX5 A;  1ZJ0 A;  1YP2 A;  2YQS A;  2RJ6 A;  2PGV A;  2RIZ A;  1YRO B;  3I0D A;  1LZ0 A;  4KRV A;  3ST8 A;  1EYR A;  1H5S D;  3SXB A;  1O7O A;  3PKQ A;  1KWS A;  4BMA A;  2XWL A;  3RMW A;  1JVG A;  5C1H A;  4M2B A;  4LW6 A;  2UX8 A;  4M28 A;  1FWY A;  3U2X A;  2OEF A;  1FR9 A;  1SS9 A;  4FRA A;  1YP4 A;  3V0O A;  4HO6 A;  3ZF8 A;  3HL3 A;  1G1L A;  1S4N A;  3T7M A;  2VSI A;  2W0V A;  1GQC A;  1H5S C;  4Y62 A;  4AYJ A;  4EE3 A;  4Y63 A;  4KNX A;  4UEG A;  1ZJ3 A;  4NAL A;  2V0I A;  2AM3 A;  1ZDF A;  2VFZ A;  1R82 A;  4FRO A;  5IDS A;  1ZCV A;  2YES A;  5DDT A;  2FYB A;  2MZB A;  3CKQ A;  1LZJ A;  3Q7U A;  5DDV A;  3V0N A;  4B4G A;  2RIT A;  2A8U A;  2RJ9 A;  1V84 A;  1R81 A;  2O1F A;  2XME A;  4Y64 A;  3ZGG A;  4EEG A;  2X60 A;  4MND A;  4B2X A;  1K4V A;  3CGX A;  1QWJ A;  2XWN A;  3I0C A;  1INI A;  1W55 A;  5C1L A;  3CKV A;  3V8Z A;  1VZT A;  5CMH A;  4Y6N A;  3R2W A;  1IIN A;  3U2U A;  1ON8 A;  1WT3 A;  1ZCU A;  2YQJ A;  4ARW A;  3POL A;  1H7E A;  3D8V A;  2WAW A;  1ZDG A;  2A8W A;  1LL2 A;  1R7V A;  1G23 A;  2ZU8 A;  4EEA A;  5JQQ A;  5FUH A;  1S4O A;  2APC A;  1WT2 A;  3JTJ A;  3V8Y A;  1V82 A;  4FCU A;  4KC2 A;  1OMX A;  1NQI B;  1E5K A;  5CQO A;  4BQH A;  2GGO A;  1H5R A;  2I7B A;  1VIC A;  1VZX A;  5C4D A;  1VH1 A;  1XZ6 A;  1FXJ A;  3IOH A;  3OAM A;  3Q4S A;  4FIY A;  2J0A A;  4NAI A;  3OGZ A;  1QGQ A;  2PGY A;  4L41 C;  3U2T A;  2VXL A;  3JUK A;  3RMV A;  1W77 A;  2FFU A;  4HO9 A;  3JUJ A;  2Y4L A;  2ICX A;  2D7R A;  2V0L A;  2YCM A;  3Q80 A;  2CU2 A;  3CKN A;  2Y4J A;  3D98 A;  1VGZ A;  2OI5 A;  4Y9X A;  4FRE A;  4HO4 A;  5IFY A;  4MIX A;  5FTS A;  1GWW A;  2FFV A;  2YC3 A;  2YC5 A;  3O3P A;  5C3A A;  4ECM A;  4JIS A;  5AJP A;  2W0W A;  4FRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...