3NGWA

Crystal structure of molybdopterin-guanine dinucleotide biosynthesis protein a from archaeoglobus fulgidus, northeast structural genomics consortium target gr189
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
195
structure length
195
Chain Sequence
MKVAVLVGGVGRRIGMEKTEVMLCGKKLIEWVLEKYSPFQTVFVCRDEKQAEKLSSRYEAEFIWDLHKGVGSIAGIHAALRHFGSCVVAAIDMPFVKPEVLEHLYKEGEKAGCDALIPKHDYPEPLLAYYAESAADELERAILQGIRKILVPLERLNVVYYPVEKLRKFDKELISFFNINTPDDLKRAEEICSKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Molybdopterin-guanine dinucleotide biosynthesis protein A (M
publication title Northeast Structural Genomics Consortium Target GR189
rcsb
source organism Archaeoglobus fulgidus
total genus 67
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2010-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12804 NTP_transf_3 MobA-like NTP transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3ngwA00
3ZLLA 4Y6UA 4FCUA 3V91A 4G3QA 1HV9A 1E5KA 2Z87A 2RJ9A 5C4DA 3I0FA 1ZDGA 3DJ4A 4R7PA 4EE5A 2OI5A 1W55A 2VD4A 2Y4JA 3SX3A 3SPTA 4Y62A 4DECA 3V8ZA 1G1LA 1ZI3A 5C47A 2A8UA 1O0RA 2VFZA 1QGQA 1MP5A 1HJJA 1TW5A 3U2XA 4BMAA 1H5RA 1G23A 2AESA 3CKOA 1YROB 3CKQA 2ICYA 3OH2A 1O23B 4HO2A 2O1FA 4FRAA 4FRMA 5C4BA 2X60A 4EEAA 5DDVA 5FU0A 1FXOA 2FY7A 2I5EA 2YESA 1G95A 4KQLA 1GQCA 3QVBA 2UX8A 1V83A 5EJZA 4B2WA 1NHEB 2XMEA 5HS2A 2PX7A 3SXGA 1VZUA 5IFYA 2OI7A 2AE7A 4HG6A 1MP4A 2W0WA 4GBPA 2Y7AA 5C38A 3U2VA 1Z90A 1ZI1A 5CMHA 2RJ5A 2VS5A 2GGOA 3I0KA 2Y4LA 3PKQA 1R7TA 1GA8A 2JCKA 1HM8A 1QGSA 2X65A 3RMVA 4HO3A 2Y4MA 2AM5A 1R82A 4D48A 1YP2A 2BO8A 3PKPA 4IRQA 3I0JA 3ZGFA 1FRWA 5CMJA 5EIYA 4EE3A 4KC1A 5CMGX 4FRQA 2XMHA 4M28A 1JV3A 5BXCA 1XZ6A 2YC3A 2V0JA 2D7IA 5IDTA 3FWWA 1INJA 4B5BA 3SXCA 4C2SA 3V0OA 1GQ9A 5FV9A 1V84A 4B3UA 4CJ8A 1ZDFA 1FZWA 1FG5N 3CKJA 3V90A 3U2UA 4BQHA 1NKHB 3OKRA 2GGQA 3I0EA 2FFVA 2ZU7A 1VM8A 5L6VA 1H7HA 3CU0A 2FYAA 1JYKA 3T7OA 2V0LA 5C1HA 3V0NA 4FCEA 3DK5A 1VPAA 4DE7A 4FRPA 1LZ0A 3OAMA 3K8DA 1H5TA 2MZBA 2Y6PA 4EEMA 1H7LA 2VS3A 1H5TB 1H5SC 5C1LA 2WVKA 1H5SA 4MNDA 2VSHA 4ASJA 3TZTA 1H5SB 3I0CA 4B4BA 1H7GA 2OEFA 2RIXA 4AYLA 5C4FA 1LL0A 1YP4A 4FRHA 1HJLA 2P6WA 2V0HA 2BO6A 5C3AA 1VH3A 2I7BA 2XWNA 3I0GA 1VGUA 4FQWA 2ZU9A 1OQMB 1FO8A 2YQCA 1VGTA 5EJ1A 2PGVA 4AYJA 1FXJA 2YQHA 1JVDA 2DPWA 2XWMA 4AAWA 5CQLX 1H7FA 2AH9A 4KXOA 1GX0A 4HO4A 2V0KA 1H5RB 5CQOA 1O7QA 1WT2A 4HO0A 3CGXA 4EE4A 3D98A 1R81A 4P02A 4KC2A 1ZI4A 2O1HA 1WT0A 1VGWA 4ARWA 4M4KA 3FOQA 1R7YA 2RIYA 1G3LA 1TVYA 1GWWA 3I0DA 2QH5A 4FRDA 2P73A 1R80A 3OGZA 1FGGA 5FYEA 2O1GA 2NXVA 1MP3A 2RJ0A 4B4GA 1FR9A 2WVMA 3E26A 4HO5A 5C49A 3SXEA 3R3IA 4J18A 1H4CA 5JQQA 5C8RA 1NWGB 4FRLA 4HCQA 4ASYA 5C48A 3D5NA 4NANA 1WSZA 4LW6A 4XWIA 3POLA 2VSIA 2RIZA 1ZJPA 4EVWA 3N9WA 2AM4A 1ON8A 2D7RA 3V0MA 4YS8A 2OEGA 1NQIB 3OH3A 1ZJ2A 1ZI5A 1I52A 1W77A 4FREA 4Y63A 1V82A 3T7NA 1VZTA 4UEGA 2P72A 3SX5A 2RJ4A 1VH1A 4Y6NA 3USQA 1YP3A 2VS4A 1KWSA 1ON6A 3NGWA 1GX4A 4KNXA 4EEOA 3F1YA 2RJ7A 2WGZA 1LZIA 1MC3A 1HM9A 4IRPA 3Q80A 1FOAA 3IOHA 3V8YA 3HL3A 2PA4A 3OH1A 1ZCUA 4G3PA 1SS9A 4Y7UA 2Y4KA 1WT1A 2YQSA 4L41C 3IOIA 1ZHJA 5FU8A 2VXLA 1VICA 5CQPA 2JCOA 4JISA 2D0JA 1G93A 1PZYB 1FR8A 1H5SD 2VXMA 4KPXA 1IIMA 5C4EA 1INIA 4HO6A 4G87A 4D0TA 4Y7FA 3JUKA 3OH0A 4D11A 1ZCYA 2APCA 4EEGA 1G0RA 1VGZA 3JTJA 1EZIA 5I1FA 4FRBA 1QWJA 2XWLA 2E8BA 2V0IA 2JCLA 2WVLA 1JVGA 1LVWA 3RMWA 3U0YA 3IOJA 4KRVA 4HOCA 2PGYA 1NMMB 5AJOA 4Y7VA 4Y7TA 2FFUA 1EYRA 1PZTA 2WEEA 2WAWA 2X5ZA 3T7MA 2QGIA 2Z86A 3I0LA 5IDSA 1WT3A 2ZU8A 4FROA 5CQNX 1R7VA 5FUHA 5L6SA 1LL3A 4B2XA 1FO9A 3U2TA 3V0LA 3JUJA 3SX7A 3ZGGA 3V0QA 2RJ6A 3V0PA 4HO9A 3U0XA 4AC3A 3SXBA 5AJPA 4NALA 5C4CA 5C3DA 2AECA 2AGDA 1ZCTA 1G97A 2RITA 1NF5B 3SX8A 3GUEA 1FWYA 2BO4A 1ZJ3A 1LL2A 3Q4SA 1H3MA 3OC9A 1ZIZA 3K8EA 4M2BA 1H4DA 3LW6A 3PNNA 1QG8A 1H4EA 1XHBA 2I5KA 3BRKX 2FYDB 1G2VA 1TZFA 2Q4JA 2OI6A 4HO8A 1WVCA 3Q7UA 3R2WA 1ZCVA 2QKXA 2RJ8A 2ICXA 3ZF8A 2RJ1A 3KIAA 4G3SA 2YC5A 4KNRA 4MYBA 4DDZA 2A8WA 4D0ZA 1S4NA 3O3PA 1HM0A 5J49A 1LZJA 3SXDA 4LW3A 4P00A 5CMFX 1ZJOA 2BO7A 4CVHA 4NAKA 1K4VA 1H7QA 4B42A 1JV1A 4KT7A 4CJCA 1OMXA 2W0VA 3I0IX 4KC4A 1R7UA 3ST8A 4JD0A 5C3BA 4Y9XA 3F1CA 4NAIA 4ECMA 1TW1A 1R7XA 2FYCB 3CKNA 1G8OA 1H7TA 1S4PA 4K6RA 1OMZA 3RSBA 1JYLA 1FGXA 3I0HA 2AM3A 3DUVA 3OH4A 4ZDQA 3E25A 2WE9A 1S4OA 2YCMA 1O7OA 4KPZA 4E1KA 2CU2A 5C36A 4B4MA 4Y7GA 5CMIA 2FYBA 3ZLKA 1IINA 1LZ7A 2X5SA 1W57A 3U2WA 1G9RA 3CKVA 4Y64A 5CQMX 3SXAA 2YQJA 5FTVA 1VZXA 5FTSA 1H7EA 5C1GA 3USRA 4D11C 1GWVA 2E3DA 2JCJA 5DDTA 1ZJ0A 3D8VA 4M2AA 5AJNA 3EE5A 3BCVA 4CJBA 3TQDA 1ZJ1A
chains in the Genus database with same CATH superfamily
3ZLLA 4Y6UA 4FCUA 3V91A 4G3QA 1HV9A 1E5KA 2Z87A 2RJ9A 5C4DA 3I0FA 1ZDGA 3DJ4A 4R7PA 4EE5A 2OI5A 1W55A 2VD4A 2Y4JA 3SX3A 3SPTA 4Y62A 4DECA 3V8ZA 1G1LA 1ZI3A 5C47A 2A8UA 1O0RA 2VFZA 2J0BA 1QGQA 1MP5A 1HJJA 1TW5A 3U2XA 4BMAA 1H5RA 1G23A 2AESA 3CKOA 1YROB 3CKQA 2ICYA 3OH2A 1O23B 4HO2A 2O1FA 4FRAA 4FRMA 5C4BA 2X60A 4EEAA 5DDVA 5FU0A 1FXOA 2FY7A 2I5EA 2YESA 1G95A 4KQLA 1GQCA 3QVBA 2UX8A 1V83A 5EJZA 4B2WA 1NHEB 2XMEA 5HS2A 2PX7A 3SXGA 1VZUA 5IFYA 2OI7A 2AE7A 4HG6A 1MP4A 2W0WA 4GBPA 2Y7AA 5C38A 3U2VA 1Z90A 1ZI1A 5CMHA 2RJ5A 2VS5A 2GGOA 3I0KA 2Y4LA 3PKQA 1R7TA 1GA8A 2JCKA 1HM8A 1QGSA 2X65A 3RMVA 4HO3A 2Y4MA 2AM5A 1R82A 4D48A 1YP2A 2BO8A 3PKPA 4IRQA 3I0JA 3ZGFA 1FRWA 5CMJA 5EIYA 4EE3A 4KC1A 5CMGX 4FRQA 2XMHA 4M28A 1JV3A 5BXCA 1XZ6A 2YC3A 4O6MA 2V0JA 2D7IA 5IDTA 3FWWA 1INJA 4B5BA 3SXCA 4C2SA 3V0OA 1GQ9A 5FV9A 1V84A 4B3UA 4CJ8A 1ZDFA 1FZWA 1FG5N 3CKJA 3V90A 3U2UA 4BQHA 1NKHB 3OKRA 2GGQA 3I0EA 2C0NA 2FFVA 2ZU7A 1VM8A 5L6VA 1H7HA 3CU0A 2FYAA 1JYKA 3T7OA 2V0LA 5C1HA 3V0NA 4FCEA 3DK5A 1VPAA 4DE7A 4FRPA 1LZ0A 3OAMA 3K8DA 1H5TA 2MZBA 2Y6PA 4EEMA 1H7LA 2VS3A 1H5TB 1H5SC 5C1LA 2WVKA 1H5SA 4MNDA 2VSHA 4ASJA 3TZTA 1H5SB 3I0CA 4B4BA 1H7GA 2OEFA 2RIXA 4AYLA 5C4FA 1LL0A 1YP4A 4FRHA 1HJLA 2P6WA 2V0HA 2BO6A 5C3AA 1VH3A 2I7BA 2XWNA 3I0GA 1VGUA 4FQWA 2ZU9A 1OQMB 1FO8A 2YQCA 1VGTA 5EJ1A 2PGVA 4AYJA 1FXJA 2YQHA 1JVDA 2DPWA 2XWMA 4AAWA 5CQLX 1H7FA 2AH9A 4KXOA 1GX0A 4HO4A 2V0KA 1H5RB 5CQOA 1O7QA 1WT2A 5D92A 4HO0A 3CGXA 4EE4A 3D98A 1R81A 4P02A 4KC2A 1ZI4A 2O1HA 1WT0A 1VGWA 4ARWA 4M4KA 3FOQA 1R7YA 2RIYA 1G3LA 1TVYA 1GWWA 3I0DA 2QH5A 4FRDA 2P73A 1R80A 3OGZA 1FGGA 5FYEA 2O1GA 2NXVA 1MP3A 2RJ0A 4B4GA 1FR9A 2WVMA 3E26A 4HO5A 5C49A 3SXEA 3R3IA 4J18A 1H4CA 5JQQA 5C8RA 1NWGB 4FRLA 4HCQA 4ASYA 5C48A 3D5NA 4NANA 1WSZA 4LW6A 4XWIA 3POLA 2VSIA 2RIZA 1ZJPA 4EVWA 3N9WA 2AM4A 1ON8A 2D7RA 3V0MA 4YS8A 2OEGA 1NQIB 3OH3A 1ZJ2A 1ZI5A 1I52A 1W77A 4FREA 4Y63A 4MIXA 1V82A 3T7NA 1VZTA 4UEGA 2P72A 3SX5A 2RJ4A 4O6NA 1VH1A 4Y6NA 3USQA 1YP3A 2VS4A 1KWSA 1ON6A 3NGWA 1GX4A 4KNXA 4EEOA 3F1YA 2RJ7A 2WGZA 1LZIA 1MC3A 1HM9A 4IRPA 3Q80A 1FOAA 3IOHA 3V8YA 3HL3A 2PA4A 3OH1A 1ZCUA 4G3PA 1SS9A 4Y7UA 2Y4KA 1WT1A 2YQSA 4L41C 3IOIA 1ZHJA 5FU8A 2VXLA 1VICA 5CQPA 2JCOA 4JISA 2D0JA 1G93A 1PZYB 1FR8A 1H5SD 2VXMA 4KPXA 1IIMA 5C4EA 1INIA 4HO6A 4G87A 4D0TA 4Y7FA 3JUKA 3OH0A 4D11A 1ZCYA 2APCA 4EEGA 1G0RA 1VGZA 3JTJA 1EZIA 2VK9A 5I1FA 4FRBA 1QWJA 2XWLA 2E8BA 2V0IA 2JCLA 2WVLA 1JVGA 1LVWA 3RMWA 3U0YA 3IOJA 4KRVA 4HOCA 2PGYA 1NMMB 5AJOA 4Y7VA 4Y7TA 2FFUA 1EYRA 1PZTA 2WEEA 2WAWA 2X5ZA 3T7MA 2QGIA 2Z86A 4FIXA 3I0LA 5IDSA 1WT3A 2ZU8A 4FROA 5CQNX 1R7VA 5FUHA 5L6SA 1LL3A 4B2XA 1FO9A 4Q7CA 3U2TA 3V0LA 3JUJA 3SX7A 3ZGGA 3V0QA 2RJ6A 3V0PA 4HO9A 3U0XA 4AC3A 3SXBA 5AJPA 4NALA 5C4CA 5C3DA 2AECA 2AGDA 1ZCTA 1G97A 2RITA 1NF5B 3SX8A 3GUEA 1FWYA 2BO4A 1ZJ3A 1LL2A 3Q4SA 1H3MA 3OC9A 1ZIZA 3K8EA 4M2BA 1H4DA 3LW6A 3PNNA 1QG8A 1H4EA 1XHBA 2I5KA 3BRKX 2FYDB 1G2VA 1TZFA 2Q4JA 2OI6A 4HO8A 1WVCA 3Q7UA 3R2WA 1ZCVA 2QKXA 2RJ8A 5D91A 2ICXA 3ZF8A 2RJ1A 3KIAA 4G3SA 2YC5A 4KNRA 4MYBA 4DDZA 2A8WA 4D0ZA 1S4NA 3O3PA 1HM0A 5J49A 1LZJA 3SXDA 4LW3A 4P00A 5CMFX 1ZJOA 2BO7A 4CVHA 4NAKA 1K4VA 1H7QA 4B42A 1JV1A 4KT7A 4CJCA 1OMXA 2W0VA 3I0IX 4KC4A 1R7UA 3ST8A 4JD0A 5C3BA 4Y9XA 3F1CA 4NAIA 4ECMA 1TW1A 1R7XA 2FYCB 3CKNA 1G8OA 1H7TA 1S4PA 4K6RA 1OMZA 3RSBA 1JYLA 1FGXA 3I0HA 2AM3A 3DUVA 3OH4A 4ZDQA 3E25A 2WE9A 1S4OA 2YCMA 1O7OA 4KPZA 4E1KA 2CU2A 5C36A 4B4MA 4Y7GA 5CMIA 2FYBA 3ZLKA 1IINA 1LZ7A 2X5SA 1W57A 3U2WA 1G9RA 3CKVA 4Y64A 5CQMX 3SXAA 2YQJA 5FTVA 1VZXA 5FTSA 1H7EA 5C1GA 3USRA 4D11C 1GWVA 2E3DA 2JCJA 5DDTA 1ZJ0A 2J0AA 3D8VA 4FIYA 4M2AA 5AJNA 3EE5A 3BCVA 4CJBA 3TQDA 1ZJ1A
chains in the Genus database with same CATH topology
3ZLLA 4Y6UA 4FCUA 3V91A 4G3QA 1HV9A 1E5KA 2Z87A 2RJ9A 5C4DA 3I0FA 1ZDGA 3DJ4A 4R7PA 4EE5A 2OI5A 1W55A 2VD4A 2Y4JA 3SX3A 3SPTA 4Y62A 4DECA 3V8ZA 1G1LA 1ZI3A 5C47A 2A8UA 1O0RA 2VFZA 2J0BA 1QGQA 1MP5A 1HJJA 1TW5A 3U2XA 4BMAA 1H5RA 1G23A 2AESA 3CKOA 1YROB 3CKQA 2ICYA 3OH2A 1O23B 4HO2A 2O1FA 4FRAA 4FRMA 5C4BA 2X60A 4EEAA 5DDVA 5FU0A 1FXOA 2FY7A 2I5EA 2YESA 1G95A 4KQLA 1GQCA 3QVBA 2UX8A 1V83A 5EJZA 4B2WA 1NHEB 2XMEA 5HS2A 2PX7A 3SXGA 1VZUA 5IFYA 2OI7A 2AE7A 4HG6A 1MP4A 2W0WA 4GBPA 2Y7AA 5C38A 3U2VA 1Z90A 1ZI1A 5CMHA 2RJ5A 2VS5A 2GGOA 3I0KA 2Y4LA 3PKQA 1R7TA 1GA8A 2JCKA 1HM8A 1QGSA 2X65A 3RMVA 4HO3A 2Y4MA 2AM5A 1R82A 4D48A 1YP2A 2BO8A 3PKPA 4IRQA 3I0JA 3ZGFA 1FRWA 5CMJA 5EIYA 4EE3A 4KC1A 5CMGX 4FRQA 2XMHA 4M28A 1JV3A 5BXCA 1XZ6A 2YC3A 4O6MA 2V0JA 2D7IA 5IDTA 3FWWA 1INJA 4B5BA 3SXCA 4C2SA 3V0OA 1GQ9A 5FV9A 1V84A 4B3UA 4CJ8A 1ZDFA 1FZWA 1FG5N 3CKJA 3V90A 3U2UA 4BQHA 1NKHB 3OKRA 2GGQA 3I0EA 2C0NA 2FFVA 2ZU7A 1VM8A 5L6VA 1H7HA 3CU0A 2FYAA 1JYKA 3T7OA 2V0LA 5C1HA 3V0NA 4FCEA 3DK5A 1VPAA 4DE7A 4FRPA 1LZ0A 3OAMA 3K8DA 1H5TA 2MZBA 2Y6PA 4EEMA 1H7LA 2VS3A 1H5TB 1H5SC 5C1LA 2WVKA 1H5SA 4MNDA 2VSHA 4ASJA 3TZTA 1H5SB 3I0CA 4B4BA 1H7GA 2OEFA 2RIXA 4AYLA 5C4FA 1LL0A 1YP4A 4FRHA 1HJLA 2P6WA 2V0HA 2BO6A 5C3AA 1VH3A 2I7BA 2XWNA 3I0GA 1VGUA 4FQWA 2ZU9A 1OQMB 1FO8A 2YQCA 1VGTA 5EJ1A 2PGVA 4AYJA 1FXJA 2YQHA 1JVDA 2DPWA 2XWMA 4AAWA 5CQLX 1H7FA 2AH9A 4KXOA 1GX0A 4HO4A 2V0KA 1H5RB 5CQOA 1O7QA 1WT2A 5D92A 4HO0A 3CGXA 4EE4A 3D98A 1R81A 4P02A 4KC2A 1ZI4A 2O1HA 1WT0A 1VGWA 4ARWA 4M4KA 3FOQA 1R7YA 2RIYA 1G3LA 1TVYA 1GWWA 3I0DA 2QH5A 4FRDA 2P73A 1R80A 3OGZA 1FGGA 5FYEA 2O1GA 2NXVA 1MP3A 2RJ0A 4B4GA 1FR9A 2WVMA 3E26A 4HO5A 5C49A 3SXEA 3R3IA 4J18A 1H4CA 5JQQA 5C8RA 1NWGB 4FRLA 4HCQA 4ASYA 5C48A 3D5NA 4NANA 1WSZA 4LW6A 4XWIA 3POLA 2VSIA 2RIZA 1ZJPA 4EVWA 3N9WA 2AM4A 1ON8A 2D7RA 3V0MA 4YS8A 2OEGA 1NQIB 3OH3A 1ZJ2A 1ZI5A 1I52A 1W77A 4FREA 4Y63A 4MIXA 1V82A 3T7NA 1VZTA 4UEGA 2P72A 3SX5A 2RJ4A 4O6NA 1VH1A 4Y6NA 3USQA 1YP3A 2VS4A 1KWSA 1ON6A 3NGWA 1GX4A 4KNXA 4EEOA 3F1YA 2RJ7A 2WGZA 1LZIA 1MC3A 1HM9A 4IRPA 3Q80A 1FOAA 3IOHA 3V8YA 3HL3A 2PA4A 3OH1A 1ZCUA 4G3PA 1SS9A 4Y7UA 2Y4KA 1WT1A 2YQSA 4L41C 3IOIA 1ZHJA 5FU8A 2VXLA 1VICA 5CQPA 2JCOA 4JISA 2D0JA 1G93A 1PZYB 1FR8A 1H5SD 2VXMA 4KPXA 1IIMA 5C4EA 1INIA 4HO6A 4G87A 4D0TA 4Y7FA 3JUKA 3OH0A 4D11A 1ZCYA 2APCA 4EEGA 1G0RA 1VGZA 3JTJA 1EZIA 2VK9A 5I1FA 4FRBA 1QWJA 2XWLA 2E8BA 2V0IA 2JCLA 2WVLA 1JVGA 1LVWA 3RMWA 3U0YA 3IOJA 4KRVA 4HOCA 2PGYA 1NMMB 5AJOA 4Y7VA 4Y7TA 2FFUA 1EYRA 1PZTA 2WEEA 2WAWA 2X5ZA 3T7MA 2QGIA 2Z86A 4FIXA 3I0LA 5IDSA 1WT3A 2ZU8A 4FROA 5CQNX 1R7VA 5FUHA 5L6SA 1LL3A 4B2XA 1FO9A 4Q7CA 3U2TA 3V0LA 3JUJA 3SX7A 3ZGGA 3V0QA 2RJ6A 3V0PA 4HO9A 3U0XA 4AC3A 3SXBA 5AJPA 4NALA 5C4CA 5C3DA 2AECA 2AGDA 1ZCTA 1G97A 2RITA 1NF5B 3SX8A 3GUEA 1FWYA 2BO4A 1ZJ3A 1LL2A 3Q4SA 1H3MA 3OC9A 1ZIZA 3K8EA 4M2BA 1H4DA 3LW6A 3PNNA 1QG8A 1H4EA 1XHBA 2I5KA 3BRKX 2FYDB 1G2VA 1TZFA 2Q4JA 2OI6A 4HO8A 1WVCA 3Q7UA 3R2WA 1ZCVA 2QKXA 2RJ8A 5D91A 2ICXA 3ZF8A 2RJ1A 3KIAA 4G3SA 2YC5A 4KNRA 4MYBA 4DDZA 2A8WA 4D0ZA 1S4NA 3O3PA 1HM0A 5J49A 1LZJA 3SXDA 4LW3A 4P00A 5CMFX 1ZJOA 2BO7A 4CVHA 4NAKA 1K4VA 1H7QA 4B42A 1JV1A 4KT7A 4CJCA 1OMXA 2W0VA 3I0IX 4KC4A 1R7UA 3ST8A 4JD0A 5C3BA 4Y9XA 3F1CA 4NAIA 4ECMA 1TW1A 1R7XA 2FYCB 3CKNA 1G8OA 1H7TA 1S4PA 4K6RA 1OMZA 3RSBA 1JYLA 1FGXA 3I0HA 2AM3A 3DUVA 3OH4A 4ZDQA 3E25A 2WE9A 1S4OA 2YCMA 1O7OA 4KPZA 4E1KA 2CU2A 5C36A 4B4MA 4Y7GA 5CMIA 2FYBA 3ZLKA 1IINA 1LZ7A 2X5SA 1W57A 3U2WA 1G9RA 3CKVA 4Y64A 5CQMX 3SXAA 2YQJA 5FTVA 1VZXA 5FTSA 1H7EA 5C1GA 3USRA 4D11C 1GWVA 2E3DA 2JCJA 5DDTA 1ZJ0A 2J0AA 3D8VA 4FIYA 4M2AA 5AJNA 3EE5A 3BCVA 4CJBA 3TQDA 1ZJ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZLL A;  4Y6U A;  4FCU A;  3V91 A;  4G3Q A;  1HV9 A;  1E5K A;  2Z87 A;  2RJ9 A;  5C4D A;  3I0F A;  1ZDG A;  3DJ4 A;  4R7P A;  4EE5 A;  2OI5 A;  1W55 A;  2VD4 A;  2Y4J A;  3SX3 A;  3SPT A;  4Y62 A;  4DEC A;  3V8Z A;  1G1L A;  1ZI3 A;  5C47 A;  2A8U A;  1O0R A;  2VFZ A;  1QGQ A;  1MP5 A;  1HJJ A;  1TW5 A;  3U2X A;  4BMA A;  1H5R A;  1G23 A;  2AES A;  3CKO A;  1YRO B;  3CKQ A;  2ICY A;  3OH2 A;  1O23 B;  4HO2 A;  2O1F A;  4FRA A;  4FRM A;  5C4B A;  2X60 A;  4EEA A;  5DDV A;  5FU0 A;  1FXO A;  2FY7 A;  2I5E A;  2YES A;  1G95 A;  4KQL A;  1GQC A;  3QVB A;  2UX8 A;  1V83 A;  5EJZ A;  4B2W A;  1NHE B;  2XME A;  5HS2 A;  2PX7 A;  3SXG A;  1VZU A;  5IFY A;  2OI7 A;  2AE7 A;  4HG6 A;  1MP4 A;  2W0W A;  4GBP A;  2Y7A A;  5C38 A;  3U2V A;  1Z90 A;  1ZI1 A;  5CMH A;  2RJ5 A;  2VS5 A;  2GGO A;  3I0K A;  2Y4L A;  3PKQ A;  1R7T A;  1GA8 A;  2JCK A;  1HM8 A;  1QGS A;  2X65 A;  3RMV A;  4HO3 A;  2Y4M A;  2AM5 A;  1R82 A;  4D48 A;  1YP2 A;  2BO8 A;  3PKP A;  4IRQ A;  3I0J A;  3ZGF A;  1FRW A;  5CMJ A;  5EIY A;  4EE3 A;  4KC1 A;  5CMG X;  4FRQ A;  2XMH A;  4M28 A;  1JV3 A;  5BXC A;  1XZ6 A;  2YC3 A;  2V0J A;  2D7I A;  5IDT A;  3FWW A;  1INJ A;  4B5B A;  3SXC A;  4C2S A;  3V0O A;  1GQ9 A;  5FV9 A;  1V84 A;  4B3U A;  4CJ8 A;  1ZDF A;  1FZW A;  1FG5 N;  3CKJ A;  3V90 A;  3U2U A;  4BQH A;  1NKH B;  3OKR A;  2GGQ A;  3I0E A;  2FFV A;  2ZU7 A;  1VM8 A;  5L6V A;  1H7H A;  3CU0 A;  2FYA A;  1JYK A;  3T7O A;  2V0L A;  5C1H A;  3V0N A;  4FCE A;  3DK5 A;  1VPA A;  4DE7 A;  4FRP A;  1LZ0 A;  3OAM A;  3K8D A;  1H5T A;  2MZB A;  2Y6P A;  4EEM A;  1H7L A;  2VS3 A;  1H5T B;  1H5S C;  5C1L A;  2WVK A;  1H5S A;  4MND A;  2VSH A;  4ASJ A;  3TZT A;  1H5S B;  3I0C A;  4B4B A;  1H7G A;  2OEF A;  2RIX A;  4AYL A;  5C4F A;  1LL0 A;  1YP4 A;  4FRH A;  1HJL A;  2P6W A;  2V0H A;  2BO6 A;  5C3A A;  1VH3 A;  2I7B A;  2XWN A;  3I0G A;  1VGU A;  4FQW A;  2ZU9 A;  1OQM B;  1FO8 A;  2YQC A;  1VGT A;  5EJ1 A;  2PGV A;  4AYJ A;  1FXJ A;  2YQH A;  1JVD A;  2DPW A;  2XWM A;  4AAW A;  5CQL X;  1H7F A;  2AH9 A;  4KXO A;  1GX0 A;  4HO4 A;  2V0K A;  1H5R B;  5CQO A;  1O7Q A;  1WT2 A;  4HO0 A;  3CGX A;  4EE4 A;  3D98 A;  1R81 A;  4P02 A;  4KC2 A;  1ZI4 A;  2O1H A;  1WT0 A;  1VGW A;  4ARW A;  4M4K A;  3FOQ A;  1R7Y A;  2RIY A;  1G3L A;  1TVY A;  1GWW A;  3I0D A;  2QH5 A;  4FRD A;  2P73 A;  1R80 A;  3OGZ A;  1FGG A;  5FYE A;  2O1G A;  2NXV A;  1MP3 A;  2RJ0 A;  4B4G A;  1FR9 A;  2WVM A;  3E26 A;  4HO5 A;  5C49 A;  3SXE A;  3R3I A;  4J18 A;  1H4C A;  5JQQ A;  5C8R A;  1NWG B;  4FRL A;  4HCQ A;  4ASY A;  5C48 A;  3D5N A;  4NAN A;  1WSZ A;  4LW6 A;  4XWI A;  3POL A;  2VSI A;  2RIZ A;  1ZJP A;  4EVW A;  3N9W A;  2AM4 A;  1ON8 A;  2D7R A;  3V0M A;  4YS8 A;  2OEG A;  1NQI B;  3OH3 A;  1ZJ2 A;  1ZI5 A;  1I52 A;  1W77 A;  4FRE A;  4Y63 A;  1V82 A;  3T7N A;  1VZT A;  4UEG A;  2P72 A;  3SX5 A;  2RJ4 A;  1VH1 A;  4Y6N A;  3USQ A;  1YP3 A;  2VS4 A;  1KWS A;  1ON6 A;  3NGW A;  1GX4 A;  4KNX A;  4EEO A;  3F1Y A;  2RJ7 A;  2WGZ A;  1LZI A;  1MC3 A;  1HM9 A;  4IRP A;  3Q80 A;  1FOA A;  3IOH A;  3V8Y A;  3HL3 A;  2PA4 A;  3OH1 A;  1ZCU A;  4G3P A;  1SS9 A;  4Y7U A;  2Y4K A;  1WT1 A;  2YQS A;  4L41 C;  3IOI A;  1ZHJ A;  5FU8 A;  2VXL A;  1VIC A;  5CQP A;  2JCO A;  4JIS A;  2D0J A;  1G93 A;  1PZY B;  1FR8 A;  1H5S D;  2VXM A;  4KPX A;  1IIM A;  5C4E A;  1INI A;  4HO6 A;  4G87 A;  4D0T A;  4Y7F A;  3JUK A;  3OH0 A;  4D11 A;  1ZCY A;  2APC A;  4EEG A;  1G0R A;  1VGZ A;  3JTJ A;  1EZI A;  5I1F A;  4FRB A;  1QWJ A;  2XWL A;  2E8B A;  2V0I A;  2JCL A;  2WVL A;  1JVG A;  1LVW A;  3RMW A;  3U0Y A;  3IOJ A;  4KRV A;  4HOC A;  2PGY A;  1NMM B;  5AJO A;  4Y7V A;  4Y7T A;  2FFU A;  1EYR A;  1PZT A;  2WEE A;  2WAW A;  2X5Z A;  3T7M A;  2QGI A;  2Z86 A;  3I0L A;  5IDS A;  1WT3 A;  2ZU8 A;  4FRO A;  5CQN X;  1R7V A;  5FUH A;  5L6S A;  1LL3 A;  4B2X A;  1FO9 A;  3U2T A;  3V0L A;  3JUJ A;  3SX7 A;  3ZGG A;  3V0Q A;  2RJ6 A;  3V0P A;  4HO9 A;  3U0X A;  4AC3 A;  3SXB A;  5AJP A;  4NAL A;  5C4C A;  5C3D A;  2AEC A;  2AGD A;  1ZCT A;  1G97 A;  2RIT A;  1NF5 B;  3SX8 A;  3GUE A;  1FWY A;  2BO4 A;  1ZJ3 A;  1LL2 A;  3Q4S A;  1H3M A;  3OC9 A;  1ZIZ A;  3K8E A;  4M2B A;  1H4D A;  3LW6 A;  3PNN A;  1QG8 A;  1H4E A;  1XHB A;  2I5K A;  3BRK X;  2FYD B;  1G2V A;  1TZF A;  2Q4J A;  2OI6 A;  4HO8 A;  1WVC A;  3Q7U A;  3R2W A;  1ZCV A;  2QKX A;  2RJ8 A;  2ICX A;  3ZF8 A;  2RJ1 A;  3KIA A;  4G3S A;  2YC5 A;  4KNR A;  4MYB A;  4DDZ A;  2A8W A;  4D0Z A;  1S4N A;  3O3P A;  1HM0 A;  5J49 A;  1LZJ A;  3SXD A;  4LW3 A;  4P00 A;  5CMF X;  1ZJO A;  2BO7 A;  4CVH A;  4NAK A;  1K4V A;  1H7Q A;  4B42 A;  1JV1 A;  4KT7 A;  4CJC A;  1OMX A;  2W0V A;  3I0I X;  4KC4 A;  1R7U A;  3ST8 A;  4JD0 A;  5C3B A;  4Y9X A;  3F1C A;  4NAI A;  4ECM A;  1TW1 A;  1R7X A;  2FYC B;  3CKN A;  1G8O A;  1H7T A;  1S4P A;  4K6R A;  1OMZ A;  3RSB A;  1JYL A;  1FGX A;  3I0H A;  2AM3 A;  3DUV A;  3OH4 A;  4ZDQ A;  3E25 A;  2WE9 A;  1S4O A;  2YCM A;  1O7O A;  4KPZ A;  4E1K A;  2CU2 A;  5C36 A;  4B4M A;  4Y7G A;  5CMI A;  2FYB A;  3ZLK A;  1IIN A;  1LZ7 A;  2X5S A;  1W57 A;  3U2W A;  1G9R A;  3CKV A;  4Y64 A;  5CQM X;  3SXA A;  2YQJ A;  5FTV A;  1VZX A;  5FTS A;  1H7E A;  5C1G A;  3USR A;  4D11 C;  1GWV A;  2E3D A;  2JCJ A;  5DDT A;  1ZJ0 A;  3D8V A;  4M2A A;  5AJN A;  3EE5 A;  3BCV A;  4CJB A;  3TQD A;  1ZJ1 A; 
#chains in the Genus database with same CATH topology
 3ZLL A;  4Y6U A;  4FCU A;  3V91 A;  4G3Q A;  1HV9 A;  1E5K A;  2Z87 A;  2RJ9 A;  5C4D A;  3I0F A;  1ZDG A;  3DJ4 A;  4R7P A;  4EE5 A;  2OI5 A;  1W55 A;  2VD4 A;  2Y4J A;  3SX3 A;  3SPT A;  4Y62 A;  4DEC A;  3V8Z A;  1G1L A;  1ZI3 A;  5C47 A;  2A8U A;  1O0R A;  2VFZ A;  2J0B A;  1QGQ A;  1MP5 A;  1HJJ A;  1TW5 A;  3U2X A;  4BMA A;  1H5R A;  1G23 A;  2AES A;  3CKO A;  1YRO B;  3CKQ A;  2ICY A;  3OH2 A;  1O23 B;  4HO2 A;  2O1F A;  4FRA A;  4FRM A;  5C4B A;  2X60 A;  4EEA A;  5DDV A;  5FU0 A;  1FXO A;  2FY7 A;  2I5E A;  2YES A;  1G95 A;  4KQL A;  1GQC A;  3QVB A;  2UX8 A;  1V83 A;  5EJZ A;  4B2W A;  1NHE B;  2XME A;  5HS2 A;  2PX7 A;  3SXG A;  1VZU A;  5IFY A;  2OI7 A;  2AE7 A;  4HG6 A;  1MP4 A;  2W0W A;  4GBP A;  2Y7A A;  5C38 A;  3U2V A;  1Z90 A;  1ZI1 A;  5CMH A;  2RJ5 A;  2VS5 A;  2GGO A;  3I0K A;  2Y4L A;  3PKQ A;  1R7T A;  1GA8 A;  2JCK A;  1HM8 A;  1QGS A;  2X65 A;  3RMV A;  4HO3 A;  2Y4M A;  2AM5 A;  1R82 A;  4D48 A;  1YP2 A;  2BO8 A;  3PKP A;  4IRQ A;  3I0J A;  3ZGF A;  1FRW A;  5CMJ A;  5EIY A;  4EE3 A;  4KC1 A;  5CMG X;  4FRQ A;  2XMH A;  4M28 A;  1JV3 A;  5BXC A;  1XZ6 A;  2YC3 A;  4O6M A;  2V0J A;  2D7I A;  5IDT A;  3FWW A;  1INJ A;  4B5B A;  3SXC A;  4C2S A;  3V0O A;  1GQ9 A;  5FV9 A;  1V84 A;  4B3U A;  4CJ8 A;  1ZDF A;  1FZW A;  1FG5 N;  3CKJ A;  3V90 A;  3U2U A;  4BQH A;  1NKH B;  3OKR A;  2GGQ A;  3I0E A;  2C0N A;  2FFV A;  2ZU7 A;  1VM8 A;  5L6V A;  1H7H A;  3CU0 A;  2FYA A;  1JYK A;  3T7O A;  2V0L A;  5C1H A;  3V0N A;  4FCE A;  3DK5 A;  1VPA A;  4DE7 A;  4FRP A;  1LZ0 A;  3OAM A;  3K8D A;  1H5T A;  2MZB A;  2Y6P A;  4EEM A;  1H7L A;  2VS3 A;  1H5T B;  1H5S C;  5C1L A;  2WVK A;  1H5S A;  4MND A;  2VSH A;  4ASJ A;  3TZT A;  1H5S B;  3I0C A;  4B4B A;  1H7G A;  2OEF A;  2RIX A;  4AYL A;  5C4F A;  1LL0 A;  1YP4 A;  4FRH A;  1HJL A;  2P6W A;  2V0H A;  2BO6 A;  5C3A A;  1VH3 A;  2I7B A;  2XWN A;  3I0G A;  1VGU A;  4FQW A;  2ZU9 A;  1OQM B;  1FO8 A;  2YQC A;  1VGT A;  5EJ1 A;  2PGV A;  4AYJ A;  1FXJ A;  2YQH A;  1JVD A;  2DPW A;  2XWM A;  4AAW A;  5CQL X;  1H7F A;  2AH9 A;  4KXO A;  1GX0 A;  4HO4 A;  2V0K A;  1H5R B;  5CQO A;  1O7Q A;  1WT2 A;  5D92 A;  4HO0 A;  3CGX A;  4EE4 A;  3D98 A;  1R81 A;  4P02 A;  4KC2 A;  1ZI4 A;  2O1H A;  1WT0 A;  1VGW A;  4ARW A;  4M4K A;  3FOQ A;  1R7Y A;  2RIY A;  1G3L A;  1TVY A;  1GWW A;  3I0D A;  2QH5 A;  4FRD A;  2P73 A;  1R80 A;  3OGZ A;  1FGG A;  5FYE A;  2O1G A;  2NXV A;  1MP3 A;  2RJ0 A;  4B4G A;  1FR9 A;  2WVM A;  3E26 A;  4HO5 A;  5C49 A;  3SXE A;  3R3I A;  4J18 A;  1H4C A;  5JQQ A;  5C8R A;  1NWG B;  4FRL A;  4HCQ A;  4ASY A;  5C48 A;  3D5N A;  4NAN A;  1WSZ A;  4LW6 A;  4XWI A;  3POL A;  2VSI A;  2RIZ A;  1ZJP A;  4EVW A;  3N9W A;  2AM4 A;  1ON8 A;  2D7R A;  3V0M A;  4YS8 A;  2OEG A;  1NQI B;  3OH3 A;  1ZJ2 A;  1ZI5 A;  1I52 A;  1W77 A;  4FRE A;  4Y63 A;  4MIX A;  1V82 A;  3T7N A;  1VZT A;  4UEG A;  2P72 A;  3SX5 A;  2RJ4 A;  4O6N A;  1VH1 A;  4Y6N A;  3USQ A;  1YP3 A;  2VS4 A;  1KWS A;  1ON6 A;  3NGW A;  1GX4 A;  4KNX A;  4EEO A;  3F1Y A;  2RJ7 A;  2WGZ A;  1LZI A;  1MC3 A;  1HM9 A;  4IRP A;  3Q80 A;  1FOA A;  3IOH A;  3V8Y A;  3HL3 A;  2PA4 A;  3OH1 A;  1ZCU A;  4G3P A;  1SS9 A;  4Y7U A;  2Y4K A;  1WT1 A;  2YQS A;  4L41 C;  3IOI A;  1ZHJ A;  5FU8 A;  2VXL A;  1VIC A;  5CQP A;  2JCO A;  4JIS A;  2D0J A;  1G93 A;  1PZY B;  1FR8 A;  1H5S D;  2VXM A;  4KPX A;  1IIM A;  5C4E A;  1INI A;  4HO6 A;  4G87 A;  4D0T A;  4Y7F A;  3JUK A;  3OH0 A;  4D11 A;  1ZCY A;  2APC A;  4EEG A;  1G0R A;  1VGZ A;  3JTJ A;  1EZI A;  2VK9 A;  5I1F A;  4FRB A;  1QWJ A;  2XWL A;  2E8B A;  2V0I A;  2JCL A;  2WVL A;  1JVG A;  1LVW A;  3RMW A;  3U0Y A;  3IOJ A;  4KRV A;  4HOC A;  2PGY A;  1NMM B;  5AJO A;  4Y7V A;  4Y7T A;  2FFU A;  1EYR A;  1PZT A;  2WEE A;  2WAW A;  2X5Z A;  3T7M A;  2QGI A;  2Z86 A;  4FIX A;  3I0L A;  5IDS A;  1WT3 A;  2ZU8 A;  4FRO A;  5CQN X;  1R7V A;  5FUH A;  5L6S A;  1LL3 A;  4B2X A;  1FO9 A;  4Q7C A;  3U2T A;  3V0L A;  3JUJ A;  3SX7 A;  3ZGG A;  3V0Q A;  2RJ6 A;  3V0P A;  4HO9 A;  3U0X A;  4AC3 A;  3SXB A;  5AJP A;  4NAL A;  5C4C A;  5C3D A;  2AEC A;  2AGD A;  1ZCT A;  1G97 A;  2RIT A;  1NF5 B;  3SX8 A;  3GUE A;  1FWY A;  2BO4 A;  1ZJ3 A;  1LL2 A;  3Q4S A;  1H3M A;  3OC9 A;  1ZIZ A;  3K8E A;  4M2B A;  1H4D A;  3LW6 A;  3PNN A;  1QG8 A;  1H4E A;  1XHB A;  2I5K A;  3BRK X;  2FYD B;  1G2V A;  1TZF A;  2Q4J A;  2OI6 A;  4HO8 A;  1WVC A;  3Q7U A;  3R2W A;  1ZCV A;  2QKX A;  2RJ8 A;  5D91 A;  2ICX A;  3ZF8 A;  2RJ1 A;  3KIA A;  4G3S A;  2YC5 A;  4KNR A;  4MYB A;  4DDZ A;  2A8W A;  4D0Z A;  1S4N A;  3O3P A;  1HM0 A;  5J49 A;  1LZJ A;  3SXD A;  4LW3 A;  4P00 A;  5CMF X;  1ZJO A;  2BO7 A;  4CVH A;  4NAK A;  1K4V A;  1H7Q A;  4B42 A;  1JV1 A;  4KT7 A;  4CJC A;  1OMX A;  2W0V A;  3I0I X;  4KC4 A;  1R7U A;  3ST8 A;  4JD0 A;  5C3B A;  4Y9X A;  3F1C A;  4NAI A;  4ECM A;  1TW1 A;  1R7X A;  2FYC B;  3CKN A;  1G8O A;  1H7T A;  1S4P A;  4K6R A;  1OMZ A;  3RSB A;  1JYL A;  1FGX A;  3I0H A;  2AM3 A;  3DUV A;  3OH4 A;  4ZDQ A;  3E25 A;  2WE9 A;  1S4O A;  2YCM A;  1O7O A;  4KPZ A;  4E1K A;  2CU2 A;  5C36 A;  4B4M A;  4Y7G A;  5CMI A;  2FYB A;  3ZLK A;  1IIN A;  1LZ7 A;  2X5S A;  1W57 A;  3U2W A;  1G9R A;  3CKV A;  4Y64 A;  5CQM X;  3SXA A;  2YQJ A;  5FTV A;  1VZX A;  5FTS A;  1H7E A;  5C1G A;  3USR A;  4D11 C;  1GWV A;  2E3D A;  2JCJ A;  5DDT A;  1ZJ0 A;  2J0A A;  3D8V A;  4FIY A;  4M2A A;  5AJN A;  3EE5 A;  3BCV A;  4CJB A;  3TQD A;  1ZJ1 A; 
#chains in the Genus database with same CATH homology
 3ZLL A;  4Y6U A;  4FCU A;  3V91 A;  4G3Q A;  1HV9 A;  1E5K A;  2Z87 A;  2RJ9 A;  5C4D A;  3I0F A;  1ZDG A;  3DJ4 A;  4R7P A;  4EE5 A;  2OI5 A;  1W55 A;  2VD4 A;  2Y4J A;  3SX3 A;  3SPT A;  4Y62 A;  4DEC A;  3V8Z A;  1G1L A;  1ZI3 A;  5C47 A;  2A8U A;  1O0R A;  2VFZ A;  2J0B A;  1QGQ A;  1MP5 A;  1HJJ A;  1TW5 A;  3U2X A;  4BMA A;  1H5R A;  1G23 A;  2AES A;  3CKO A;  1YRO B;  3CKQ A;  2ICY A;  3OH2 A;  1O23 B;  4HO2 A;  2O1F A;  4FRA A;  4FRM A;  5C4B A;  2X60 A;  4EEA A;  5DDV A;  5FU0 A;  1FXO A;  2FY7 A;  2I5E A;  2YES A;  1G95 A;  4KQL A;  1GQC A;  3QVB A;  2UX8 A;  1V83 A;  5EJZ A;  4B2W A;  1NHE B;  2XME A;  5HS2 A;  2PX7 A;  3SXG A;  1VZU A;  5IFY A;  2OI7 A;  2AE7 A;  4HG6 A;  1MP4 A;  2W0W A;  4GBP A;  2Y7A A;  5C38 A;  3U2V A;  1Z90 A;  1ZI1 A;  5CMH A;  2RJ5 A;  2VS5 A;  2GGO A;  3I0K A;  2Y4L A;  3PKQ A;  1R7T A;  1GA8 A;  2JCK A;  1HM8 A;  1QGS A;  2X65 A;  3RMV A;  4HO3 A;  2Y4M A;  2AM5 A;  1R82 A;  4D48 A;  1YP2 A;  2BO8 A;  3PKP A;  4IRQ A;  3I0J A;  3ZGF A;  1FRW A;  5CMJ A;  5EIY A;  4EE3 A;  4KC1 A;  5CMG X;  4FRQ A;  2XMH A;  4M28 A;  1JV3 A;  5BXC A;  1XZ6 A;  2YC3 A;  4O6M A;  2V0J A;  2D7I A;  5IDT A;  3FWW A;  1INJ A;  4B5B A;  3SXC A;  4C2S A;  3V0O A;  1GQ9 A;  5FV9 A;  1V84 A;  4B3U A;  4CJ8 A;  1ZDF A;  1FZW A;  1FG5 N;  3CKJ A;  3V90 A;  3U2U A;  4BQH A;  1NKH B;  3OKR A;  2GGQ A;  3I0E A;  2C0N A;  2FFV A;  2ZU7 A;  1VM8 A;  5L6V A;  1H7H A;  3CU0 A;  2FYA A;  1JYK A;  3T7O A;  2V0L A;  5C1H A;  3V0N A;  4FCE A;  3DK5 A;  1VPA A;  4DE7 A;  4FRP A;  1LZ0 A;  3OAM A;  3K8D A;  1H5T A;  2MZB A;  2Y6P A;  4EEM A;  1H7L A;  2VS3 A;  1H5T B;  1H5S C;  5C1L A;  2WVK A;  1H5S A;  4MND A;  2VSH A;  4ASJ A;  3TZT A;  1H5S B;  3I0C A;  4B4B A;  1H7G A;  2OEF A;  2RIX A;  4AYL A;  5C4F A;  1LL0 A;  1YP4 A;  4FRH A;  1HJL A;  2P6W A;  2V0H A;  2BO6 A;  5C3A A;  1VH3 A;  2I7B A;  2XWN A;  3I0G A;  1VGU A;  4FQW A;  2ZU9 A;  1OQM B;  1FO8 A;  2YQC A;  1VGT A;  5EJ1 A;  2PGV A;  4AYJ A;  1FXJ A;  2YQH A;  1JVD A;  2DPW A;  2XWM A;  4AAW A;  5CQL X;  1H7F A;  2AH9 A;  4KXO A;  1GX0 A;  4HO4 A;  2V0K A;  1H5R B;  5CQO A;  1O7Q A;  1WT2 A;  5D92 A;  4HO0 A;  3CGX A;  4EE4 A;  3D98 A;  1R81 A;  4P02 A;  4KC2 A;  1ZI4 A;  2O1H A;  1WT0 A;  1VGW A;  4ARW A;  4M4K A;  3FOQ A;  1R7Y A;  2RIY A;  1G3L A;  1TVY A;  1GWW A;  3I0D A;  2QH5 A;  4FRD A;  2P73 A;  1R80 A;  3OGZ A;  1FGG A;  5FYE A;  2O1G A;  2NXV A;  1MP3 A;  2RJ0 A;  4B4G A;  1FR9 A;  2WVM A;  3E26 A;  4HO5 A;  5C49 A;  3SXE A;  3R3I A;  4J18 A;  1H4C A;  5JQQ A;  5C8R A;  1NWG B;  4FRL A;  4HCQ A;  4ASY A;  5C48 A;  3D5N A;  4NAN A;  1WSZ A;  4LW6 A;  4XWI A;  3POL A;  2VSI A;  2RIZ A;  1ZJP A;  4EVW A;  3N9W A;  2AM4 A;  1ON8 A;  2D7R A;  3V0M A;  4YS8 A;  2OEG A;  1NQI B;  3OH3 A;  1ZJ2 A;  1ZI5 A;  1I52 A;  1W77 A;  4FRE A;  4Y63 A;  4MIX A;  1V82 A;  3T7N A;  1VZT A;  4UEG A;  2P72 A;  3SX5 A;  2RJ4 A;  4O6N A;  1VH1 A;  4Y6N A;  3USQ A;  1YP3 A;  2VS4 A;  1KWS A;  1ON6 A;  3NGW A;  1GX4 A;  4KNX A;  4EEO A;  3F1Y A;  2RJ7 A;  2WGZ A;  1LZI A;  1MC3 A;  1HM9 A;  4IRP A;  3Q80 A;  1FOA A;  3IOH A;  3V8Y A;  3HL3 A;  2PA4 A;  3OH1 A;  1ZCU A;  4G3P A;  1SS9 A;  4Y7U A;  2Y4K A;  1WT1 A;  2YQS A;  4L41 C;  3IOI A;  1ZHJ A;  5FU8 A;  2VXL A;  1VIC A;  5CQP A;  2JCO A;  4JIS A;  2D0J A;  1G93 A;  1PZY B;  1FR8 A;  1H5S D;  2VXM A;  4KPX A;  1IIM A;  5C4E A;  1INI A;  4HO6 A;  4G87 A;  4D0T A;  4Y7F A;  3JUK A;  3OH0 A;  4D11 A;  1ZCY A;  2APC A;  4EEG A;  1G0R A;  1VGZ A;  3JTJ A;  1EZI A;  2VK9 A;  5I1F A;  4FRB A;  1QWJ A;  2XWL A;  2E8B A;  2V0I A;  2JCL A;  2WVL A;  1JVG A;  1LVW A;  3RMW A;  3U0Y A;  3IOJ A;  4KRV A;  4HOC A;  2PGY A;  1NMM B;  5AJO A;  4Y7V A;  4Y7T A;  2FFU A;  1EYR A;  1PZT A;  2WEE A;  2WAW A;  2X5Z A;  3T7M A;  2QGI A;  2Z86 A;  4FIX A;  3I0L A;  5IDS A;  1WT3 A;  2ZU8 A;  4FRO A;  5CQN X;  1R7V A;  5FUH A;  5L6S A;  1LL3 A;  4B2X A;  1FO9 A;  4Q7C A;  3U2T A;  3V0L A;  3JUJ A;  3SX7 A;  3ZGG A;  3V0Q A;  2RJ6 A;  3V0P A;  4HO9 A;  3U0X A;  4AC3 A;  3SXB A;  5AJP A;  4NAL A;  5C4C A;  5C3D A;  2AEC A;  2AGD A;  1ZCT A;  1G97 A;  2RIT A;  1NF5 B;  3SX8 A;  3GUE A;  1FWY A;  2BO4 A;  1ZJ3 A;  1LL2 A;  3Q4S A;  1H3M A;  3OC9 A;  1ZIZ A;  3K8E A;  4M2B A;  1H4D A;  3LW6 A;  3PNN A;  1QG8 A;  1H4E A;  1XHB A;  2I5K A;  3BRK X;  2FYD B;  1G2V A;  1TZF A;  2Q4J A;  2OI6 A;  4HO8 A;  1WVC A;  3Q7U A;  3R2W A;  1ZCV A;  2QKX A;  2RJ8 A;  5D91 A;  2ICX A;  3ZF8 A;  2RJ1 A;  3KIA A;  4G3S A;  2YC5 A;  4KNR A;  4MYB A;  4DDZ A;  2A8W A;  4D0Z A;  1S4N A;  3O3P A;  1HM0 A;  5J49 A;  1LZJ A;  3SXD A;  4LW3 A;  4P00 A;  5CMF X;  1ZJO A;  2BO7 A;  4CVH A;  4NAK A;  1K4V A;  1H7Q A;  4B42 A;  1JV1 A;  4KT7 A;  4CJC A;  1OMX A;  2W0V A;  3I0I X;  4KC4 A;  1R7U A;  3ST8 A;  4JD0 A;  5C3B A;  4Y9X A;  3F1C A;  4NAI A;  4ECM A;  1TW1 A;  1R7X A;  2FYC B;  3CKN A;  1G8O A;  1H7T A;  1S4P A;  4K6R A;  1OMZ A;  3RSB A;  1JYL A;  1FGX A;  3I0H A;  2AM3 A;  3DUV A;  3OH4 A;  4ZDQ A;  3E25 A;  2WE9 A;  1S4O A;  2YCM A;  1O7O A;  4KPZ A;  4E1K A;  2CU2 A;  5C36 A;  4B4M A;  4Y7G A;  5CMI A;  2FYB A;  3ZLK A;  1IIN A;  1LZ7 A;  2X5S A;  1W57 A;  3U2W A;  1G9R A;  3CKV A;  4Y64 A;  5CQM X;  3SXA A;  2YQJ A;  5FTV A;  1VZX A;  5FTS A;  1H7E A;  5C1G A;  3USR A;  4D11 C;  1GWV A;  2E3D A;  2JCJ A;  5DDT A;  1ZJ0 A;  2J0A A;  3D8V A;  4FIY A;  4M2A A;  5AJN A;  3EE5 A;  3BCV A;  4CJB A;  3TQD A;  1ZJ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...