2X5ZA

Crystal structure of t. maritima gdp-mannose pyrophosphorylase in complex with gdp-mannose.
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
333
structure length
333
Chain Sequence
VMKALILAGGSGERFWPLSTPETPKQFLKLFGNKSLMRWTFERVLEEMDPKDVIVVTHKDYVERTKKELPELPDENIIAEPMKKNTAPACFIGTKLADDDEPVLVLPADHRIPDTKKFWKTVKKALDALEKYDGLFTFGIVPTRPETGYGYIEIGEELEEGVHKVAQFREKPDLETAKKFVESGRFLWNSGMFLWKAREFIEEVKVCEPSIYENLKDVDPRNFEELKKAYEKVPSISVDYAVMEKSKKVRVVKADFEWSDLGNWSSVREIEGYTEESDEVILVDSDRVFVKTHNKPIAVVGLSDVIVIDTPNGILICKEEYAQKVREVVKKLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANNOSE-1-PHOSPHATE GUANYLYLTRANSFERASE
publication title Structural Insights Into the Catalytic Mechanism of Bacterial Guanosine-Diphospho-D-Mannose Pyrophosphorylase and its Regulation by Divalent Ions.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 108
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature ec 2.7.7.13: Mannose-1-phosphate guanylyltransferase.
pdb deposition date 2010-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2x5zA00
2OEGA 1G0RA 2Y7AA 5FU0A 4IRQA 4FRLA 2BO4A 1NF5B 4ZDQA 1W77A 3IOHA 4NANA 2OEFA 5AJPA 1H4EA 1WT0A 4KC4A 5C3AA 3U2TA 1LL3A 3OH1A 3RSBA 1ZJ2A 2VS4A 3DUVA 2P6WA 1VGTA 2APCA 1FO8A 3V0NA 1JVGA 1ZI1A 5C3DA 2X60A 3U2VA 2RIXA 3I0KA 5AJOA 3V0MA 4FQWA 1H4CA 1R7XA 4Y7GA 3EE5A 4KNRA 2Z86A 3T7NA 2YC5A 5CQLX 1TZFA 3I0LA 3ZLKA 4CVHA 1FR8A 1R82A 5IFYA 3OKRA 1MP3A 5EJZA 4Y64A 5L6VA 1MP5A 1Z90A 2RITA 2XWLA 2WGZA 2Y4JA 1VZXA 3F1YA 3RMVA 1PZTA 3IOIA 4G3QA 3SXCA 1ZCUA 1GX0A 1VH3A 1HJLA 2V0JA 4KC1A 5C4EA 3PNNA 3Q4SA 2RJ5A 2A8UA 4HO0A 4EEMA 2BO8A 2XMEA 2AH9A 2WE9A 2W0VA 4CJBA 4FRDA 4ASYA 3I0FA 2JCJA 5DDVA 3ZGGA 3USRA 2ZU7A 1LZIA 2YQHA 2FFUA 2RIYA 4FRPA 4M2BA 3V0QA 1JVDA 1OQMB 2RJ0A 1JYKA 1VGUA 4G3PA 3Q80A 1VZTA 2X65A 3I0JA 1ZCVA 1FOAA 1ZI3A 1O7QA 4Y63A 1H5TB 3IOJA 1NQIB 2V0IA 3U2UA 3U2WA 1LL0A 2RJ7A 1G93A 4FREA 2AM4A 1G97A 4HO3A 2RJ1A 1EZIA 2I7BA 1HM9A 3V8YA 4AYJA 1W57A 1W55A 1ON8A 4NALA 1TVYA 1R7UA 2D0JA 1HM0A 3V90A 1MP4A 2RJ9A 4M2AA 1VGZA 2QH5A 2I5KA 4EE5A 1JYLA 3FWWA 1FXJA 1O0RA 1XHBA 4R7PA 1LZ0A 1G1LA 2FYCB 1LZ7A 3FOQA 3POLA 4YS8A 4CJCA 4D0TA 2WVKA 2Q4JA 4FRQA 1G2VA 1JV1A 1GA8A 4Y6UA 1WT1A 1E5KA 3NGWA 3U0YA 2W0WA 4C2SA 4B2WA 5JQQA 2FY7A 3BRKX 1H5TA 2YQCA 2WEEA 5L6SA 2VSHA 3E26A 2QGIA 3R3IA 3SX7A 2YQJA 1WT3A 1ZJPA 4UEGA 4AC3A 1INJA 3JUKA 3T7MA 4B42A 1R7VA 3CKQA 4FRAA 5J49A 1FG5N 1S4NA 2RJ6A 4HCQA 3GUEA 1NWGB 3OH2A 3USQA 2VXLA 4B5BA 1NKHB 1ZJ0A 3V91A 2O1HA 1LZJA 3SXDA 1NMMB 1OMXA 4FCUA 3V0OA 3RMWA 3F1CA 4KQLA 4KXOA 1ZDFA 3PKPA 3SXAA 3I0DA 1YP4A 5CQPA 4XWIA 1H7EA 1FWYA 1VM8A 4P00A 4HO4A 4KNXA 4HO6A 1QGQA 1K4VA 2I5EA 1VH1A 5C36A 1QWJA 1INIA 2JCLA 1HV9A 3CKJA 1H3MA 2OI7A 2GGQA 5HS2A 1YP3A 3CKOA 2P72A 5EIYA 5FU8A 5IDTA 1G3LA 4Y7UA 1H7TA 3V8ZA 2VS3A 2X5SA 5C3BA 4J18A 3OAMA 4EEGA 3SXGA 1VZUA 4D11C 5FTVA 1ZJOA 1GWWA 1SS9A 2AGDA 4FRBA 3ZLLA 4GBPA 2PGYA 2Z87A 2Y4LA 3U2XA 4NAIA 5DDTA 3OGZA 2VD4A 1JV3A 1GWVA 4B3UA 3OH4A 2FFVA 2O1FA 1O23B 2WVMA 4KC2A 3SPTA 5I1FA 1KWSA 1WVCA 2CU2A 1FGXA 1LL2A 2AM3A 2AM5A 2ICYA 4DE7A 2YCMA 5C48A 2JCKA 4ECMA 1H4DA 2D7IA 3I0GA 3T7OA 1MC3A 2VFZA 1FXOA 5CMJA 1R81A 1G8OA 3BCVA 3QVBA 4EE3A 2O1GA 2X5ZA 2FYBA 2RIZA 2WVLA 2WAWA 4DDZA 1IIMA 2FYAA 5FV9A 4EVWA 3OC9A 2YC3A 4Y7FA 4E1KA 4BMAA 2XMHA 5CMGX 2Y4KA 3JTJA 3I0HA 5CQMX 5C4BA 1YROB 2NXVA 1H5SD 3TZTA 4KT7A 1NHEB 4Y9XA 3ZF8A 4CJ8A 1VICA 3DJ4A 4LW6A 4ARWA 2PA4A 1H5SC 1I52A 2FYDB 4G3SA 1WSZA 2MZBA 2JCOA 2V0HA 2VSIA 4Y6NA 1O7OA 3OH3A 4G87A 5C4DA 2E8BA 1FZWA 4HO5A 5C1GA 3CU0A 5CMFX 1H7QA 1HJJA 5CQNX 1HM8A 1YP2A 5C47A 1GQCA 4Y7VA 4FCEA 4K6RA 2ICXA 3D5NA 4Y62A 5C1LA 1G95A 2RJ4A 3CGXA 2V0KA 4AAWA 4MNDA 1OMZA 1H7HA 3TQDA 2RJ8A 1QG8A 4JD0A 1VGWA 1V83A 1FRWA 1R80A 3O3PA 3E25A 3HL3A 3U0XA 3D8VA 3DK5A 1H5SA 2BO7A 5C8RA 5C1HA 3R2WA 2OI6A 2DPWA 4M28A 4EE4A 2V0LA 4Y7TA 3K8DA 4EEOA 1VPAA 2E3DA 1GQ9A 3I0IX 4KPXA 5IDSA 2QKXA 1EYRA 1V82A 1H5RB 3CKNA 2UX8A 4B4GA 4EEAA 4B4MA 2YQSA 3Q7UA 3ZGFA 1ZCYA 3SX5A 3D98A 4FRMA 3K8EA 4JISA 5BXCA 5FUHA 5FTSA 1WT2A 2AESA 2AE7A 1LVWA 3SX8A 3SXEA 4AYLA 4B2XA 5CQOA 5EJ1A 1H7LA 1IINA 1ZI5A 1ZHJA 4L41C 5CMHA 1V84A 2P73A 3JUJA 2XWMA 4KRVA 2YESA 4IRPA 4NAKA 1ZIZA 1FR9A 1TW1A 4BQHA 1FO9A 3SXBA 4P02A 2Y6PA 2ZU8A 4MYBA 3SX3A 2Y4MA 4HOCA 1ON6A 1ZDGA 3V0PA 5FYEA 2VXMA 1FGGA 4D48A 4LW3A 4HO8A 2OI5A 3N9WA 3CKVA 4FRHA 1PZYB 1ZI4A 5CMIA 1TW5A 4M4KA 3OH0A 1H7FA 2A8WA 2VS5A 4D11A 1QGSA 1XZ6A 2PX7A 1H5RA 1ZJ1A 4KPZA 5AJNA 4HG6A 1GX4A 4DECA 1S4OA 4HO2A 5C49A 3LW6A 3PKQA 5C4FA 1G23A 1ZJ3A 1G9RA 2AECA 2PGVA 5C4CA 3I0CA 1H7GA 1ZCTA 2GGOA 2ZU9A 3V0LA 1R7TA 1S4PA 2XWNA 4B4BA 3I0EA 1R7YA 4FROA 2D7RA 4HO9A 1H5SB 3KIAA 4ASJA 3ST8A 5C38A 4D0ZA 2BO6A
chains in the Genus database with same CATH superfamily
2OEGA 1G0RA 2Y7AA 5FU0A 4IRQA 4FRLA 2BO4A 1NF5B 4ZDQA 1W77A 3IOHA 2VK9A 4NANA 2OEFA 5AJPA 1H4EA 1WT0A 4KC4A 5C3AA 3U2TA 1LL3A 3OH1A 3RSBA 1ZJ2A 2VS4A 3DUVA 2P6WA 1VGTA 2APCA 1FO8A 3V0NA 1JVGA 1ZI1A 5C3DA 2X60A 3U2VA 2RIXA 3I0KA 5AJOA 3V0MA 4FQWA 1H4CA 1R7XA 4Y7GA 3EE5A 4KNRA 2Z86A 3T7NA 2YC5A 5CQLX 1TZFA 3I0LA 3ZLKA 4CVHA 1FR8A 1R82A 5IFYA 3OKRA 1MP3A 5EJZA 4Y64A 5L6VA 1MP5A 1Z90A 2RITA 2XWLA 2WGZA 2Y4JA 1VZXA 3F1YA 3RMVA 1PZTA 3IOIA 4G3QA 3SXCA 1ZCUA 1GX0A 1VH3A 1HJLA 2V0JA 4KC1A 5C4EA 3PNNA 3Q4SA 2RJ5A 2A8UA 4HO0A 4EEMA 2BO8A 2XMEA 2AH9A 2WE9A 2W0VA 4CJBA 4FRDA 4ASYA 3I0FA 2JCJA 5DDVA 3ZGGA 3USRA 2ZU7A 1LZIA 2YQHA 2FFUA 2RIYA 4FRPA 4M2BA 3V0QA 1JVDA 1OQMB 2RJ0A 1JYKA 1VGUA 4G3PA 3Q80A 1VZTA 2X65A 3I0JA 1ZCVA 1FOAA 1ZI3A 1O7QA 4Y63A 1H5TB 3IOJA 1NQIB 2V0IA 3U2UA 3U2WA 1LL0A 2RJ7A 1G93A 4FREA 2AM4A 1G97A 4HO3A 2RJ1A 1EZIA 5D92A 2I7BA 1HM9A 3V8YA 4AYJA 1W57A 1W55A 1ON8A 4NALA 1TVYA 1R7UA 2D0JA 1HM0A 3V90A 1MP4A 2RJ9A 4M2AA 1VGZA 2QH5A 2I5KA 4EE5A 4FIXA 1JYLA 3FWWA 1FXJA 1O0RA 1XHBA 4R7PA 1LZ0A 1G1LA 2FYCB 1LZ7A 3FOQA 3POLA 4YS8A 4CJCA 4D0TA 2WVKA 2Q4JA 4FRQA 1G2VA 1JV1A 1GA8A 4Y6UA 1WT1A 1E5KA 3NGWA 3U0YA 2W0WA 4C2SA 4B2WA 5JQQA 2FY7A 3BRKX 1H5TA 2YQCA 2WEEA 5L6SA 2VSHA 3E26A 2QGIA 3R3IA 3SX7A 2YQJA 1WT3A 1ZJPA 4UEGA 4AC3A 1INJA 3JUKA 3T7MA 4B42A 1R7VA 3CKQA 4FRAA 5J49A 1FG5N 1S4NA 2RJ6A 4HCQA 3GUEA 1NWGB 3OH2A 3USQA 2VXLA 4B5BA 1NKHB 1ZJ0A 3V91A 2O1HA 1LZJA 3SXDA 1NMMB 1OMXA 4FCUA 4O6MA 3RMWA 3V0OA 3F1CA 4KQLA 4KXOA 1ZDFA 3PKPA 3SXAA 3I0DA 1YP4A 5CQPA 4XWIA 1H7EA 1FWYA 1VM8A 4P00A 4HO4A 4KNXA 4HO6A 1QGQA 1K4VA 2I5EA 1VH1A 5C36A 1QWJA 1INIA 2JCLA 1HV9A 3CKJA 1H3MA 2OI7A 2GGQA 5HS2A 1YP3A 3CKOA 2P72A 5EIYA 5FU8A 5IDTA 1G3LA 4Y7UA 1H7TA 3V8ZA 2VS3A 2X5SA 5C3BA 4J18A 3OAMA 4EEGA 3SXGA 1VZUA 4D11C 5FTVA 1ZJOA 1GWWA 1SS9A 2AGDA 4FRBA 3ZLLA 4GBPA 2PGYA 2Z87A 2Y4LA 3U2XA 4NAIA 5DDTA 3OGZA 2VD4A 1JV3A 1GWVA 4B3UA 3OH4A 2FFVA 2O1FA 1O23B 2WVMA 4KC2A 3SPTA 5I1FA 1KWSA 1WVCA 2CU2A 1FGXA 1LL2A 2AM3A 2AM5A 2ICYA 4DE7A 2YCMA 5C48A 2JCKA 4ECMA 1H4DA 2D7IA 3I0GA 3T7OA 1MC3A 2VFZA 1FXOA 5CMJA 1R81A 1G8OA 3BCVA 3QVBA 4EE3A 2O1GA 2X5ZA 2FYBA 2RIZA 2WVLA 2WAWA 4DDZA 1IIMA 2FYAA 5FV9A 4EVWA 3OC9A 2YC3A 4Y7FA 4E1KA 4BMAA 2XMHA 2J0AA 5CMGX 2Y4KA 3JTJA 3I0HA 5CQMX 5C4BA 1YROB 2NXVA 1H5SD 3TZTA 4KT7A 1NHEB 4Y9XA 3ZF8A 4CJ8A 1VICA 3DJ4A 4LW6A 4ARWA 2PA4A 1H5SC 1I52A 2FYDB 4G3SA 1WSZA 2MZBA 2JCOA 2V0HA 2VSIA 4Y6NA 1O7OA 3OH3A 4G87A 5C4DA 2E8BA 1FZWA 4HO5A 5C1GA 3CU0A 5CMFX 4MIXA 1H7QA 1HJJA 5CQNX 1HM8A 1YP2A 5C47A 1GQCA 4Y7VA 4FCEA 4K6RA 2ICXA 3D5NA 4Y62A 5C1LA 1G95A 2C0NA 2RJ4A 3CGXA 2V0KA 4AAWA 4MNDA 1OMZA 1H7HA 3TQDA 2RJ8A 1QG8A 4JD0A 1VGWA 1V83A 1FRWA 1R80A 3O3PA 3E25A 3HL3A 3U0XA 3D8VA 3DK5A 1H5SA 4O6NA 2BO7A 2J0BA 5C8RA 5C1HA 3R2WA 2OI6A 2DPWA 4M28A 4EE4A 2V0LA 4Y7TA 3K8DA 4EEOA 1VPAA 2E3DA 1GQ9A 3I0IX 4KPXA 5IDSA 2QKXA 1EYRA 1V82A 1H5RB 3CKNA 2UX8A 4B4GA 4EEAA 4B4MA 2YQSA 3Q7UA 3ZGFA 1ZCYA 3SX5A 3D98A 4FRMA 3K8EA 4JISA 5BXCA 5FUHA 5FTSA 1WT2A 2AESA 2AE7A 1LVWA 3SX8A 3SXEA 4AYLA 4B2XA 5CQOA 5EJ1A 1H7LA 1IINA 1ZI5A 1ZHJA 4L41C 5CMHA 1V84A 2P73A 3JUJA 2XWMA 4KRVA 2YESA 4IRPA 4NAKA 1ZIZA 1FR9A 1TW1A 4BQHA 1FO9A 3SXBA 4P02A 2Y6PA 2ZU8A 4MYBA 3SX3A 2Y4MA 4HOCA 1ON6A 1ZDGA 3V0PA 5FYEA 2VXMA 1FGGA 4D48A 4LW3A 4HO8A 2OI5A 3N9WA 3CKVA 4FRHA 4FIYA 1PZYB 1ZI4A 5CMIA 1TW5A 4M4KA 3OH0A 1H7FA 2A8WA 2VS5A 4D11A 1QGSA 1XZ6A 2PX7A 1H5RA 1ZJ1A 4KPZA 5AJNA 4HG6A 1GX4A 4DECA 1S4OA 4HO2A 5D91A 5C49A 3LW6A 3PKQA 5C4FA 1G23A 1ZJ3A 1G9RA 2AECA 2PGVA 5C4CA 3I0CA 4Q7CA 1H7GA 1ZCTA 2GGOA 2ZU9A 3V0LA 1R7TA 1S4PA 2XWNA 4B4BA 3I0EA 1R7YA 4FROA 2D7RA 4HO9A 1H5SB 3KIAA 4ASJA 3ST8A 5C38A 4D0ZA 2BO6A
chains in the Genus database with same CATH topology
2OEGA 1G0RA 2Y7AA 5FU0A 4IRQA 4FRLA 2BO4A 1NF5B 4ZDQA 1W77A 3IOHA 2VK9A 4NANA 2OEFA 5AJPA 1H4EA 1WT0A 4KC4A 5C3AA 3U2TA 1LL3A 3OH1A 3RSBA 1ZJ2A 2VS4A 3DUVA 2P6WA 1VGTA 2APCA 1FO8A 3V0NA 1JVGA 1ZI1A 5C3DA 2X60A 3U2VA 2RIXA 3I0KA 5AJOA 3V0MA 4FQWA 1H4CA 1R7XA 4Y7GA 3EE5A 4KNRA 2Z86A 3T7NA 2YC5A 5CQLX 1TZFA 3I0LA 3ZLKA 4CVHA 1FR8A 1R82A 5IFYA 3OKRA 1MP3A 5EJZA 4Y64A 5L6VA 1MP5A 1Z90A 2RITA 2XWLA 2WGZA 2Y4JA 1VZXA 3F1YA 3RMVA 1PZTA 3IOIA 4G3QA 3SXCA 1ZCUA 1GX0A 1VH3A 1HJLA 2V0JA 4KC1A 5C4EA 3PNNA 3Q4SA 2RJ5A 2A8UA 4HO0A 4EEMA 2BO8A 2XMEA 2AH9A 2WE9A 2W0VA 4CJBA 4FRDA 4ASYA 3I0FA 2JCJA 5DDVA 3ZGGA 3USRA 2ZU7A 1LZIA 2YQHA 2FFUA 2RIYA 4FRPA 4M2BA 3V0QA 1JVDA 1OQMB 2RJ0A 1JYKA 1VGUA 4G3PA 3Q80A 1VZTA 2X65A 3I0JA 1ZCVA 1FOAA 1ZI3A 1O7QA 4Y63A 1H5TB 3IOJA 1NQIB 2V0IA 3U2UA 3U2WA 1LL0A 2RJ7A 1G93A 4FREA 2AM4A 1G97A 4HO3A 2RJ1A 1EZIA 5D92A 2I7BA 1HM9A 3V8YA 4AYJA 1W57A 1W55A 1ON8A 4NALA 1TVYA 1R7UA 2D0JA 1HM0A 3V90A 1MP4A 2RJ9A 4M2AA 1VGZA 2QH5A 2I5KA 4EE5A 4FIXA 1JYLA 3FWWA 1FXJA 1O0RA 1XHBA 4R7PA 1LZ0A 1G1LA 2FYCB 1LZ7A 3FOQA 3POLA 4YS8A 4CJCA 4D0TA 2WVKA 2Q4JA 4FRQA 1G2VA 1JV1A 1GA8A 4Y6UA 1WT1A 1E5KA 3NGWA 3U0YA 2W0WA 4C2SA 4B2WA 5JQQA 2FY7A 3BRKX 1H5TA 2YQCA 2WEEA 5L6SA 2VSHA 3E26A 2QGIA 3R3IA 3SX7A 2YQJA 1WT3A 1ZJPA 4UEGA 4AC3A 1INJA 3JUKA 3T7MA 4B42A 1R7VA 3CKQA 4FRAA 5J49A 1FG5N 1S4NA 2RJ6A 4HCQA 3GUEA 1NWGB 3OH2A 3USQA 2VXLA 4B5BA 1NKHB 1ZJ0A 3V91A 2O1HA 1LZJA 3SXDA 1NMMB 1OMXA 4FCUA 4O6MA 3RMWA 3V0OA 3F1CA 4KQLA 4KXOA 1ZDFA 3PKPA 3SXAA 3I0DA 1YP4A 5CQPA 4XWIA 1H7EA 1FWYA 1VM8A 4P00A 4HO4A 4KNXA 4HO6A 1QGQA 1K4VA 2I5EA 1VH1A 5C36A 1QWJA 1INIA 2JCLA 1HV9A 3CKJA 1H3MA 2OI7A 2GGQA 5HS2A 1YP3A 3CKOA 2P72A 5EIYA 5FU8A 5IDTA 1G3LA 4Y7UA 1H7TA 3V8ZA 2VS3A 2X5SA 5C3BA 4J18A 3OAMA 4EEGA 3SXGA 1VZUA 4D11C 5FTVA 1ZJOA 1GWWA 1SS9A 2AGDA 4FRBA 3ZLLA 4GBPA 2PGYA 2Z87A 2Y4LA 3U2XA 4NAIA 5DDTA 3OGZA 2VD4A 1JV3A 1GWVA 4B3UA 3OH4A 2FFVA 2O1FA 1O23B 2WVMA 4KC2A 3SPTA 5I1FA 1KWSA 1WVCA 2CU2A 1FGXA 1LL2A 2AM3A 2AM5A 2ICYA 4DE7A 2YCMA 5C48A 2JCKA 4ECMA 1H4DA 2D7IA 3I0GA 3T7OA 1MC3A 2VFZA 1FXOA 5CMJA 1R81A 1G8OA 3BCVA 3QVBA 4EE3A 2O1GA 2X5ZA 2FYBA 2RIZA 2WVLA 2WAWA 4DDZA 1IIMA 2FYAA 5FV9A 4EVWA 3OC9A 2YC3A 4Y7FA 4E1KA 4BMAA 2XMHA 2J0AA 5CMGX 2Y4KA 3JTJA 3I0HA 5CQMX 5C4BA 1YROB 2NXVA 1H5SD 3TZTA 4KT7A 1NHEB 4Y9XA 3ZF8A 4CJ8A 1VICA 3DJ4A 4LW6A 4ARWA 2PA4A 1H5SC 1I52A 2FYDB 4G3SA 1WSZA 2MZBA 2JCOA 2V0HA 2VSIA 4Y6NA 1O7OA 3OH3A 4G87A 5C4DA 2E8BA 1FZWA 4HO5A 5C1GA 3CU0A 5CMFX 4MIXA 1H7QA 1HJJA 5CQNX 1HM8A 1YP2A 5C47A 1GQCA 4Y7VA 4FCEA 4K6RA 2ICXA 3D5NA 4Y62A 5C1LA 1G95A 2C0NA 2RJ4A 3CGXA 2V0KA 4AAWA 4MNDA 1OMZA 1H7HA 3TQDA 2RJ8A 1QG8A 4JD0A 1VGWA 1V83A 1FRWA 1R80A 3O3PA 3E25A 3HL3A 3U0XA 3D8VA 3DK5A 1H5SA 4O6NA 2BO7A 2J0BA 5C8RA 5C1HA 3R2WA 2OI6A 2DPWA 4M28A 4EE4A 2V0LA 4Y7TA 3K8DA 4EEOA 1VPAA 2E3DA 1GQ9A 3I0IX 4KPXA 5IDSA 2QKXA 1EYRA 1V82A 1H5RB 3CKNA 2UX8A 4B4GA 4EEAA 4B4MA 2YQSA 3Q7UA 3ZGFA 1ZCYA 3SX5A 3D98A 4FRMA 3K8EA 4JISA 5BXCA 5FUHA 5FTSA 1WT2A 2AESA 2AE7A 1LVWA 3SX8A 3SXEA 4AYLA 4B2XA 5CQOA 5EJ1A 1H7LA 1IINA 1ZI5A 1ZHJA 4L41C 5CMHA 1V84A 2P73A 3JUJA 2XWMA 4KRVA 2YESA 4IRPA 4NAKA 1ZIZA 1FR9A 1TW1A 4BQHA 1FO9A 3SXBA 4P02A 2Y6PA 2ZU8A 4MYBA 3SX3A 2Y4MA 4HOCA 1ON6A 1ZDGA 3V0PA 5FYEA 2VXMA 1FGGA 4D48A 4LW3A 4HO8A 2OI5A 3N9WA 3CKVA 4FRHA 4FIYA 1PZYB 1ZI4A 5CMIA 1TW5A 4M4KA 3OH0A 1H7FA 2A8WA 2VS5A 4D11A 1QGSA 1XZ6A 2PX7A 1H5RA 1ZJ1A 4KPZA 5AJNA 4HG6A 1GX4A 4DECA 1S4OA 4HO2A 5D91A 5C49A 3LW6A 3PKQA 5C4FA 1G23A 1ZJ3A 1G9RA 2AECA 2PGVA 5C4CA 3I0CA 4Q7CA 1H7GA 1ZCTA 2GGOA 2ZU9A 3V0LA 1R7TA 1S4PA 2XWNA 4B4BA 3I0EA 1R7YA 4FROA 2D7RA 4HO9A 1H5SB 3KIAA 4ASJA 3ST8A 5C38A 4D0ZA 2BO6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OEG A;  1G0R A;  2Y7A A;  5FU0 A;  4IRQ A;  4FRL A;  2BO4 A;  1NF5 B;  4ZDQ A;  1W77 A;  3IOH A;  4NAN A;  2OEF A;  5AJP A;  1H4E A;  1WT0 A;  4KC4 A;  5C3A A;  3U2T A;  1LL3 A;  3OH1 A;  3RSB A;  1ZJ2 A;  2VS4 A;  3DUV A;  2P6W A;  1VGT A;  2APC A;  1FO8 A;  3V0N A;  1JVG A;  1ZI1 A;  5C3D A;  2X60 A;  3U2V A;  2RIX A;  3I0K A;  5AJO A;  3V0M A;  4FQW A;  1H4C A;  1R7X A;  4Y7G A;  3EE5 A;  4KNR A;  2Z86 A;  3T7N A;  2YC5 A;  5CQL X;  1TZF A;  3I0L A;  3ZLK A;  4CVH A;  1FR8 A;  1R82 A;  5IFY A;  3OKR A;  1MP3 A;  5EJZ A;  4Y64 A;  5L6V A;  1MP5 A;  1Z90 A;  2RIT A;  2XWL A;  2WGZ A;  2Y4J A;  1VZX A;  3F1Y A;  3RMV A;  1PZT A;  3IOI A;  4G3Q A;  3SXC A;  1ZCU A;  1GX0 A;  1VH3 A;  1HJL A;  2V0J A;  4KC1 A;  5C4E A;  3PNN A;  3Q4S A;  2RJ5 A;  2A8U A;  4HO0 A;  4EEM A;  2BO8 A;  2XME A;  2AH9 A;  2WE9 A;  2W0V A;  4CJB A;  4FRD A;  4ASY A;  3I0F A;  2JCJ A;  5DDV A;  3ZGG A;  3USR A;  2ZU7 A;  1LZI A;  2YQH A;  2FFU A;  2RIY A;  4FRP A;  4M2B A;  3V0Q A;  1JVD A;  1OQM B;  2RJ0 A;  1JYK A;  1VGU A;  4G3P A;  3Q80 A;  1VZT A;  2X65 A;  3I0J A;  1ZCV A;  1FOA A;  1ZI3 A;  1O7Q A;  4Y63 A;  1H5T B;  3IOJ A;  1NQI B;  2V0I A;  3U2U A;  3U2W A;  1LL0 A;  2RJ7 A;  1G93 A;  4FRE A;  2AM4 A;  1G97 A;  4HO3 A;  2RJ1 A;  1EZI A;  2I7B A;  1HM9 A;  3V8Y A;  4AYJ A;  1W57 A;  1W55 A;  1ON8 A;  4NAL A;  1TVY A;  1R7U A;  2D0J A;  1HM0 A;  3V90 A;  1MP4 A;  2RJ9 A;  4M2A A;  1VGZ A;  2QH5 A;  2I5K A;  4EE5 A;  1JYL A;  3FWW A;  1FXJ A;  1O0R A;  1XHB A;  4R7P A;  1LZ0 A;  1G1L A;  2FYC B;  1LZ7 A;  3FOQ A;  3POL A;  4YS8 A;  4CJC A;  4D0T A;  2WVK A;  2Q4J A;  4FRQ A;  1G2V A;  1JV1 A;  1GA8 A;  4Y6U A;  1WT1 A;  1E5K A;  3NGW A;  3U0Y A;  2W0W A;  4C2S A;  4B2W A;  5JQQ A;  2FY7 A;  3BRK X;  1H5T A;  2YQC A;  2WEE A;  5L6S A;  2VSH A;  3E26 A;  2QGI A;  3R3I A;  3SX7 A;  2YQJ A;  1WT3 A;  1ZJP A;  4UEG A;  4AC3 A;  1INJ A;  3JUK A;  3T7M A;  4B42 A;  1R7V A;  3CKQ A;  4FRA A;  5J49 A;  1FG5 N;  1S4N A;  2RJ6 A;  4HCQ A;  3GUE A;  1NWG B;  3OH2 A;  3USQ A;  2VXL A;  4B5B A;  1NKH B;  1ZJ0 A;  3V91 A;  2O1H A;  1LZJ A;  3SXD A;  1NMM B;  1OMX A;  4FCU A;  3V0O A;  3RMW A;  3F1C A;  4KQL A;  4KXO A;  1ZDF A;  3PKP A;  3SXA A;  3I0D A;  1YP4 A;  5CQP A;  4XWI A;  1H7E A;  1FWY A;  1VM8 A;  4P00 A;  4HO4 A;  4KNX A;  4HO6 A;  1QGQ A;  1K4V A;  2I5E A;  1VH1 A;  5C36 A;  1QWJ A;  1INI A;  2JCL A;  1HV9 A;  3CKJ A;  1H3M A;  2OI7 A;  2GGQ A;  5HS2 A;  1YP3 A;  3CKO A;  2P72 A;  5EIY A;  5FU8 A;  5IDT A;  1G3L A;  4Y7U A;  1H7T A;  3V8Z A;  2VS3 A;  2X5S A;  5C3B A;  4J18 A;  3OAM A;  4EEG A;  3SXG A;  1VZU A;  4D11 C;  5FTV A;  1ZJO A;  1GWW A;  1SS9 A;  2AGD A;  4FRB A;  3ZLL A;  4GBP A;  2PGY A;  2Z87 A;  2Y4L A;  3U2X A;  4NAI A;  5DDT A;  3OGZ A;  2VD4 A;  1JV3 A;  1GWV A;  4B3U A;  3OH4 A;  2FFV A;  2O1F A;  1O23 B;  2WVM A;  4KC2 A;  3SPT A;  5I1F A;  1KWS A;  1WVC A;  2CU2 A;  1FGX A;  1LL2 A;  2AM3 A;  2AM5 A;  2ICY A;  4DE7 A;  2YCM A;  5C48 A;  2JCK A;  4ECM A;  1H4D A;  2D7I A;  3I0G A;  3T7O A;  1MC3 A;  2VFZ A;  1FXO A;  5CMJ A;  1R81 A;  1G8O A;  3BCV A;  3QVB A;  4EE3 A;  2O1G A;  2X5Z A;  2FYB A;  2RIZ A;  2WVL A;  2WAW A;  4DDZ A;  1IIM A;  2FYA A;  5FV9 A;  4EVW A;  3OC9 A;  2YC3 A;  4Y7F A;  4E1K A;  4BMA A;  2XMH A;  5CMG X;  2Y4K A;  3JTJ A;  3I0H A;  5CQM X;  5C4B A;  1YRO B;  2NXV A;  1H5S D;  3TZT A;  4KT7 A;  1NHE B;  4Y9X A;  3ZF8 A;  4CJ8 A;  1VIC A;  3DJ4 A;  4LW6 A;  4ARW A;  2PA4 A;  1H5S C;  1I52 A;  2FYD B;  4G3S A;  1WSZ A;  2MZB A;  2JCO A;  2V0H A;  2VSI A;  4Y6N A;  1O7O A;  3OH3 A;  4G87 A;  5C4D A;  2E8B A;  1FZW A;  4HO5 A;  5C1G A;  3CU0 A;  5CMF X;  1H7Q A;  1HJJ A;  5CQN X;  1HM8 A;  1YP2 A;  5C47 A;  1GQC A;  4Y7V A;  4FCE A;  4K6R A;  2ICX A;  3D5N A;  4Y62 A;  5C1L A;  1G95 A;  2RJ4 A;  3CGX A;  2V0K A;  4AAW A;  4MND A;  1OMZ A;  1H7H A;  3TQD A;  2RJ8 A;  1QG8 A;  4JD0 A;  1VGW A;  1V83 A;  1FRW A;  1R80 A;  3O3P A;  3E25 A;  3HL3 A;  3U0X A;  3D8V A;  3DK5 A;  1H5S A;  2BO7 A;  5C8R A;  5C1H A;  3R2W A;  2OI6 A;  2DPW A;  4M28 A;  4EE4 A;  2V0L A;  4Y7T A;  3K8D A;  4EEO A;  1VPA A;  2E3D A;  1GQ9 A;  3I0I X;  4KPX A;  5IDS A;  2QKX A;  1EYR A;  1V82 A;  1H5R B;  3CKN A;  2UX8 A;  4B4G A;  4EEA A;  4B4M A;  2YQS A;  3Q7U A;  3ZGF A;  1ZCY A;  3SX5 A;  3D98 A;  4FRM A;  3K8E A;  4JIS A;  5BXC A;  5FUH A;  5FTS A;  1WT2 A;  2AES A;  2AE7 A;  1LVW A;  3SX8 A;  3SXE A;  4AYL A;  4B2X A;  5CQO A;  5EJ1 A;  1H7L A;  1IIN A;  1ZI5 A;  1ZHJ A;  4L41 C;  5CMH A;  1V84 A;  2P73 A;  3JUJ A;  2XWM A;  4KRV A;  2YES A;  4IRP A;  4NAK A;  1ZIZ A;  1FR9 A;  1TW1 A;  4BQH A;  1FO9 A;  3SXB A;  4P02 A;  2Y6P A;  2ZU8 A;  4MYB A;  3SX3 A;  2Y4M A;  4HOC A;  1ON6 A;  1ZDG A;  3V0P A;  5FYE A;  2VXM A;  1FGG A;  4D48 A;  4LW3 A;  4HO8 A;  2OI5 A;  3N9W A;  3CKV A;  4FRH A;  1PZY B;  1ZI4 A;  5CMI A;  1TW5 A;  4M4K A;  3OH0 A;  1H7F A;  2A8W A;  2VS5 A;  4D11 A;  1QGS A;  1XZ6 A;  2PX7 A;  1H5R A;  1ZJ1 A;  4KPZ A;  5AJN A;  4HG6 A;  1GX4 A;  4DEC A;  1S4O A;  4HO2 A;  5C49 A;  3LW6 A;  3PKQ A;  5C4F A;  1G23 A;  1ZJ3 A;  1G9R A;  2AEC A;  2PGV A;  5C4C A;  3I0C A;  1H7G A;  1ZCT A;  2GGO A;  2ZU9 A;  3V0L A;  1R7T A;  1S4P A;  2XWN A;  4B4B A;  3I0E A;  1R7Y A;  4FRO A;  2D7R A;  4HO9 A;  1H5S B;  3KIA A;  4ASJ A;  3ST8 A;  5C38 A;  4D0Z A;  2BO6 A; 
#chains in the Genus database with same CATH topology
 2OEG A;  1G0R A;  2Y7A A;  5FU0 A;  4IRQ A;  4FRL A;  2BO4 A;  1NF5 B;  4ZDQ A;  1W77 A;  3IOH A;  2VK9 A;  4NAN A;  2OEF A;  5AJP A;  1H4E A;  1WT0 A;  4KC4 A;  5C3A A;  3U2T A;  1LL3 A;  3OH1 A;  3RSB A;  1ZJ2 A;  2VS4 A;  3DUV A;  2P6W A;  1VGT A;  2APC A;  1FO8 A;  3V0N A;  1JVG A;  1ZI1 A;  5C3D A;  2X60 A;  3U2V A;  2RIX A;  3I0K A;  5AJO A;  3V0M A;  4FQW A;  1H4C A;  1R7X A;  4Y7G A;  3EE5 A;  4KNR A;  2Z86 A;  3T7N A;  2YC5 A;  5CQL X;  1TZF A;  3I0L A;  3ZLK A;  4CVH A;  1FR8 A;  1R82 A;  5IFY A;  3OKR A;  1MP3 A;  5EJZ A;  4Y64 A;  5L6V A;  1MP5 A;  1Z90 A;  2RIT A;  2XWL A;  2WGZ A;  2Y4J A;  1VZX A;  3F1Y A;  3RMV A;  1PZT A;  3IOI A;  4G3Q A;  3SXC A;  1ZCU A;  1GX0 A;  1VH3 A;  1HJL A;  2V0J A;  4KC1 A;  5C4E A;  3PNN A;  3Q4S A;  2RJ5 A;  2A8U A;  4HO0 A;  4EEM A;  2BO8 A;  2XME A;  2AH9 A;  2WE9 A;  2W0V A;  4CJB A;  4FRD A;  4ASY A;  3I0F A;  2JCJ A;  5DDV A;  3ZGG A;  3USR A;  2ZU7 A;  1LZI A;  2YQH A;  2FFU A;  2RIY A;  4FRP A;  4M2B A;  3V0Q A;  1JVD A;  1OQM B;  2RJ0 A;  1JYK A;  1VGU A;  4G3P A;  3Q80 A;  1VZT A;  2X65 A;  3I0J A;  1ZCV A;  1FOA A;  1ZI3 A;  1O7Q A;  4Y63 A;  1H5T B;  3IOJ A;  1NQI B;  2V0I A;  3U2U A;  3U2W A;  1LL0 A;  2RJ7 A;  1G93 A;  4FRE A;  2AM4 A;  1G97 A;  4HO3 A;  2RJ1 A;  1EZI A;  5D92 A;  2I7B A;  1HM9 A;  3V8Y A;  4AYJ A;  1W57 A;  1W55 A;  1ON8 A;  4NAL A;  1TVY A;  1R7U A;  2D0J A;  1HM0 A;  3V90 A;  1MP4 A;  2RJ9 A;  4M2A A;  1VGZ A;  2QH5 A;  2I5K A;  4EE5 A;  4FIX A;  1JYL A;  3FWW A;  1FXJ A;  1O0R A;  1XHB A;  4R7P A;  1LZ0 A;  1G1L A;  2FYC B;  1LZ7 A;  3FOQ A;  3POL A;  4YS8 A;  4CJC A;  4D0T A;  2WVK A;  2Q4J A;  4FRQ A;  1G2V A;  1JV1 A;  1GA8 A;  4Y6U A;  1WT1 A;  1E5K A;  3NGW A;  3U0Y A;  2W0W A;  4C2S A;  4B2W A;  5JQQ A;  2FY7 A;  3BRK X;  1H5T A;  2YQC A;  2WEE A;  5L6S A;  2VSH A;  3E26 A;  2QGI A;  3R3I A;  3SX7 A;  2YQJ A;  1WT3 A;  1ZJP A;  4UEG A;  4AC3 A;  1INJ A;  3JUK A;  3T7M A;  4B42 A;  1R7V A;  3CKQ A;  4FRA A;  5J49 A;  1FG5 N;  1S4N A;  2RJ6 A;  4HCQ A;  3GUE A;  1NWG B;  3OH2 A;  3USQ A;  2VXL A;  4B5B A;  1NKH B;  1ZJ0 A;  3V91 A;  2O1H A;  1LZJ A;  3SXD A;  1NMM B;  1OMX A;  4FCU A;  4O6M A;  3RMW A;  3V0O A;  3F1C A;  4KQL A;  4KXO A;  1ZDF A;  3PKP A;  3SXA A;  3I0D A;  1YP4 A;  5CQP A;  4XWI A;  1H7E A;  1FWY A;  1VM8 A;  4P00 A;  4HO4 A;  4KNX A;  4HO6 A;  1QGQ A;  1K4V A;  2I5E A;  1VH1 A;  5C36 A;  1QWJ A;  1INI A;  2JCL A;  1HV9 A;  3CKJ A;  1H3M A;  2OI7 A;  2GGQ A;  5HS2 A;  1YP3 A;  3CKO A;  2P72 A;  5EIY A;  5FU8 A;  5IDT A;  1G3L A;  4Y7U A;  1H7T A;  3V8Z A;  2VS3 A;  2X5S A;  5C3B A;  4J18 A;  3OAM A;  4EEG A;  3SXG A;  1VZU A;  4D11 C;  5FTV A;  1ZJO A;  1GWW A;  1SS9 A;  2AGD A;  4FRB A;  3ZLL A;  4GBP A;  2PGY A;  2Z87 A;  2Y4L A;  3U2X A;  4NAI A;  5DDT A;  3OGZ A;  2VD4 A;  1JV3 A;  1GWV A;  4B3U A;  3OH4 A;  2FFV A;  2O1F A;  1O23 B;  2WVM A;  4KC2 A;  3SPT A;  5I1F A;  1KWS A;  1WVC A;  2CU2 A;  1FGX A;  1LL2 A;  2AM3 A;  2AM5 A;  2ICY A;  4DE7 A;  2YCM A;  5C48 A;  2JCK A;  4ECM A;  1H4D A;  2D7I A;  3I0G A;  3T7O A;  1MC3 A;  2VFZ A;  1FXO A;  5CMJ A;  1R81 A;  1G8O A;  3BCV A;  3QVB A;  4EE3 A;  2O1G A;  2X5Z A;  2FYB A;  2RIZ A;  2WVL A;  2WAW A;  4DDZ A;  1IIM A;  2FYA A;  5FV9 A;  4EVW A;  3OC9 A;  2YC3 A;  4Y7F A;  4E1K A;  4BMA A;  2XMH A;  2J0A A;  5CMG X;  2Y4K A;  3JTJ A;  3I0H A;  5CQM X;  5C4B A;  1YRO B;  2NXV A;  1H5S D;  3TZT A;  4KT7 A;  1NHE B;  4Y9X A;  3ZF8 A;  4CJ8 A;  1VIC A;  3DJ4 A;  4LW6 A;  4ARW A;  2PA4 A;  1H5S C;  1I52 A;  2FYD B;  4G3S A;  1WSZ A;  2MZB A;  2JCO A;  2V0H A;  2VSI A;  4Y6N A;  1O7O A;  3OH3 A;  4G87 A;  5C4D A;  2E8B A;  1FZW A;  4HO5 A;  5C1G A;  3CU0 A;  5CMF X;  4MIX A;  1H7Q A;  1HJJ A;  5CQN X;  1HM8 A;  1YP2 A;  5C47 A;  1GQC A;  4Y7V A;  4FCE A;  4K6R A;  2ICX A;  3D5N A;  4Y62 A;  5C1L A;  1G95 A;  2C0N A;  2RJ4 A;  3CGX A;  2V0K A;  4AAW A;  4MND A;  1OMZ A;  1H7H A;  3TQD A;  2RJ8 A;  1QG8 A;  4JD0 A;  1VGW A;  1V83 A;  1FRW A;  1R80 A;  3O3P A;  3E25 A;  3HL3 A;  3U0X A;  3D8V A;  3DK5 A;  1H5S A;  4O6N A;  2BO7 A;  2J0B A;  5C8R A;  5C1H A;  3R2W A;  2OI6 A;  2DPW A;  4M28 A;  4EE4 A;  2V0L A;  4Y7T A;  3K8D A;  4EEO A;  1VPA A;  2E3D A;  1GQ9 A;  3I0I X;  4KPX A;  5IDS A;  2QKX A;  1EYR A;  1V82 A;  1H5R B;  3CKN A;  2UX8 A;  4B4G A;  4EEA A;  4B4M A;  2YQS A;  3Q7U A;  3ZGF A;  1ZCY A;  3SX5 A;  3D98 A;  4FRM A;  3K8E A;  4JIS A;  5BXC A;  5FUH A;  5FTS A;  1WT2 A;  2AES A;  2AE7 A;  1LVW A;  3SX8 A;  3SXE A;  4AYL A;  4B2X A;  5CQO A;  5EJ1 A;  1H7L A;  1IIN A;  1ZI5 A;  1ZHJ A;  4L41 C;  5CMH A;  1V84 A;  2P73 A;  3JUJ A;  2XWM A;  4KRV A;  2YES A;  4IRP A;  4NAK A;  1ZIZ A;  1FR9 A;  1TW1 A;  4BQH A;  1FO9 A;  3SXB A;  4P02 A;  2Y6P A;  2ZU8 A;  4MYB A;  3SX3 A;  2Y4M A;  4HOC A;  1ON6 A;  1ZDG A;  3V0P A;  5FYE A;  2VXM A;  1FGG A;  4D48 A;  4LW3 A;  4HO8 A;  2OI5 A;  3N9W A;  3CKV A;  4FRH A;  4FIY A;  1PZY B;  1ZI4 A;  5CMI A;  1TW5 A;  4M4K A;  3OH0 A;  1H7F A;  2A8W A;  2VS5 A;  4D11 A;  1QGS A;  1XZ6 A;  2PX7 A;  1H5R A;  1ZJ1 A;  4KPZ A;  5AJN A;  4HG6 A;  1GX4 A;  4DEC A;  1S4O A;  4HO2 A;  5D91 A;  5C49 A;  3LW6 A;  3PKQ A;  5C4F A;  1G23 A;  1ZJ3 A;  1G9R A;  2AEC A;  2PGV A;  5C4C A;  3I0C A;  4Q7C A;  1H7G A;  1ZCT A;  2GGO A;  2ZU9 A;  3V0L A;  1R7T A;  1S4P A;  2XWN A;  4B4B A;  3I0E A;  1R7Y A;  4FRO A;  2D7R A;  4HO9 A;  1H5S B;  3KIA A;  4ASJ A;  3ST8 A;  5C38 A;  4D0Z A;  2BO6 A; 
#chains in the Genus database with same CATH homology
 2OEG A;  1G0R A;  2Y7A A;  5FU0 A;  4IRQ A;  4FRL A;  2BO4 A;  1NF5 B;  4ZDQ A;  1W77 A;  3IOH A;  2VK9 A;  4NAN A;  2OEF A;  5AJP A;  1H4E A;  1WT0 A;  4KC4 A;  5C3A A;  3U2T A;  1LL3 A;  3OH1 A;  3RSB A;  1ZJ2 A;  2VS4 A;  3DUV A;  2P6W A;  1VGT A;  2APC A;  1FO8 A;  3V0N A;  1JVG A;  1ZI1 A;  5C3D A;  2X60 A;  3U2V A;  2RIX A;  3I0K A;  5AJO A;  3V0M A;  4FQW A;  1H4C A;  1R7X A;  4Y7G A;  3EE5 A;  4KNR A;  2Z86 A;  3T7N A;  2YC5 A;  5CQL X;  1TZF A;  3I0L A;  3ZLK A;  4CVH A;  1FR8 A;  1R82 A;  5IFY A;  3OKR A;  1MP3 A;  5EJZ A;  4Y64 A;  5L6V A;  1MP5 A;  1Z90 A;  2RIT A;  2XWL A;  2WGZ A;  2Y4J A;  1VZX A;  3F1Y A;  3RMV A;  1PZT A;  3IOI A;  4G3Q A;  3SXC A;  1ZCU A;  1GX0 A;  1VH3 A;  1HJL A;  2V0J A;  4KC1 A;  5C4E A;  3PNN A;  3Q4S A;  2RJ5 A;  2A8U A;  4HO0 A;  4EEM A;  2BO8 A;  2XME A;  2AH9 A;  2WE9 A;  2W0V A;  4CJB A;  4FRD A;  4ASY A;  3I0F A;  2JCJ A;  5DDV A;  3ZGG A;  3USR A;  2ZU7 A;  1LZI A;  2YQH A;  2FFU A;  2RIY A;  4FRP A;  4M2B A;  3V0Q A;  1JVD A;  1OQM B;  2RJ0 A;  1JYK A;  1VGU A;  4G3P A;  3Q80 A;  1VZT A;  2X65 A;  3I0J A;  1ZCV A;  1FOA A;  1ZI3 A;  1O7Q A;  4Y63 A;  1H5T B;  3IOJ A;  1NQI B;  2V0I A;  3U2U A;  3U2W A;  1LL0 A;  2RJ7 A;  1G93 A;  4FRE A;  2AM4 A;  1G97 A;  4HO3 A;  2RJ1 A;  1EZI A;  5D92 A;  2I7B A;  1HM9 A;  3V8Y A;  4AYJ A;  1W57 A;  1W55 A;  1ON8 A;  4NAL A;  1TVY A;  1R7U A;  2D0J A;  1HM0 A;  3V90 A;  1MP4 A;  2RJ9 A;  4M2A A;  1VGZ A;  2QH5 A;  2I5K A;  4EE5 A;  4FIX A;  1JYL A;  3FWW A;  1FXJ A;  1O0R A;  1XHB A;  4R7P A;  1LZ0 A;  1G1L A;  2FYC B;  1LZ7 A;  3FOQ A;  3POL A;  4YS8 A;  4CJC A;  4D0T A;  2WVK A;  2Q4J A;  4FRQ A;  1G2V A;  1JV1 A;  1GA8 A;  4Y6U A;  1WT1 A;  1E5K A;  3NGW A;  3U0Y A;  2W0W A;  4C2S A;  4B2W A;  5JQQ A;  2FY7 A;  3BRK X;  1H5T A;  2YQC A;  2WEE A;  5L6S A;  2VSH A;  3E26 A;  2QGI A;  3R3I A;  3SX7 A;  2YQJ A;  1WT3 A;  1ZJP A;  4UEG A;  4AC3 A;  1INJ A;  3JUK A;  3T7M A;  4B42 A;  1R7V A;  3CKQ A;  4FRA A;  5J49 A;  1FG5 N;  1S4N A;  2RJ6 A;  4HCQ A;  3GUE A;  1NWG B;  3OH2 A;  3USQ A;  2VXL A;  4B5B A;  1NKH B;  1ZJ0 A;  3V91 A;  2O1H A;  1LZJ A;  3SXD A;  1NMM B;  1OMX A;  4FCU A;  4O6M A;  3RMW A;  3V0O A;  3F1C A;  4KQL A;  4KXO A;  1ZDF A;  3PKP A;  3SXA A;  3I0D A;  1YP4 A;  5CQP A;  4XWI A;  1H7E A;  1FWY A;  1VM8 A;  4P00 A;  4HO4 A;  4KNX A;  4HO6 A;  1QGQ A;  1K4V A;  2I5E A;  1VH1 A;  5C36 A;  1QWJ A;  1INI A;  2JCL A;  1HV9 A;  3CKJ A;  1H3M A;  2OI7 A;  2GGQ A;  5HS2 A;  1YP3 A;  3CKO A;  2P72 A;  5EIY A;  5FU8 A;  5IDT A;  1G3L A;  4Y7U A;  1H7T A;  3V8Z A;  2VS3 A;  2X5S A;  5C3B A;  4J18 A;  3OAM A;  4EEG A;  3SXG A;  1VZU A;  4D11 C;  5FTV A;  1ZJO A;  1GWW A;  1SS9 A;  2AGD A;  4FRB A;  3ZLL A;  4GBP A;  2PGY A;  2Z87 A;  2Y4L A;  3U2X A;  4NAI A;  5DDT A;  3OGZ A;  2VD4 A;  1JV3 A;  1GWV A;  4B3U A;  3OH4 A;  2FFV A;  2O1F A;  1O23 B;  2WVM A;  4KC2 A;  3SPT A;  5I1F A;  1KWS A;  1WVC A;  2CU2 A;  1FGX A;  1LL2 A;  2AM3 A;  2AM5 A;  2ICY A;  4DE7 A;  2YCM A;  5C48 A;  2JCK A;  4ECM A;  1H4D A;  2D7I A;  3I0G A;  3T7O A;  1MC3 A;  2VFZ A;  1FXO A;  5CMJ A;  1R81 A;  1G8O A;  3BCV A;  3QVB A;  4EE3 A;  2O1G A;  2X5Z A;  2FYB A;  2RIZ A;  2WVL A;  2WAW A;  4DDZ A;  1IIM A;  2FYA A;  5FV9 A;  4EVW A;  3OC9 A;  2YC3 A;  4Y7F A;  4E1K A;  4BMA A;  2XMH A;  2J0A A;  5CMG X;  2Y4K A;  3JTJ A;  3I0H A;  5CQM X;  5C4B A;  1YRO B;  2NXV A;  1H5S D;  3TZT A;  4KT7 A;  1NHE B;  4Y9X A;  3ZF8 A;  4CJ8 A;  1VIC A;  3DJ4 A;  4LW6 A;  4ARW A;  2PA4 A;  1H5S C;  1I52 A;  2FYD B;  4G3S A;  1WSZ A;  2MZB A;  2JCO A;  2V0H A;  2VSI A;  4Y6N A;  1O7O A;  3OH3 A;  4G87 A;  5C4D A;  2E8B A;  1FZW A;  4HO5 A;  5C1G A;  3CU0 A;  5CMF X;  4MIX A;  1H7Q A;  1HJJ A;  5CQN X;  1HM8 A;  1YP2 A;  5C47 A;  1GQC A;  4Y7V A;  4FCE A;  4K6R A;  2ICX A;  3D5N A;  4Y62 A;  5C1L A;  1G95 A;  2C0N A;  2RJ4 A;  3CGX A;  2V0K A;  4AAW A;  4MND A;  1OMZ A;  1H7H A;  3TQD A;  2RJ8 A;  1QG8 A;  4JD0 A;  1VGW A;  1V83 A;  1FRW A;  1R80 A;  3O3P A;  3E25 A;  3HL3 A;  3U0X A;  3D8V A;  3DK5 A;  1H5S A;  4O6N A;  2BO7 A;  2J0B A;  5C8R A;  5C1H A;  3R2W A;  2OI6 A;  2DPW A;  4M28 A;  4EE4 A;  2V0L A;  4Y7T A;  3K8D A;  4EEO A;  1VPA A;  2E3D A;  1GQ9 A;  3I0I X;  4KPX A;  5IDS A;  2QKX A;  1EYR A;  1V82 A;  1H5R B;  3CKN A;  2UX8 A;  4B4G A;  4EEA A;  4B4M A;  2YQS A;  3Q7U A;  3ZGF A;  1ZCY A;  3SX5 A;  3D98 A;  4FRM A;  3K8E A;  4JIS A;  5BXC A;  5FUH A;  5FTS A;  1WT2 A;  2AES A;  2AE7 A;  1LVW A;  3SX8 A;  3SXE A;  4AYL A;  4B2X A;  5CQO A;  5EJ1 A;  1H7L A;  1IIN A;  1ZI5 A;  1ZHJ A;  4L41 C;  5CMH A;  1V84 A;  2P73 A;  3JUJ A;  2XWM A;  4KRV A;  2YES A;  4IRP A;  4NAK A;  1ZIZ A;  1FR9 A;  1TW1 A;  4BQH A;  1FO9 A;  3SXB A;  4P02 A;  2Y6P A;  2ZU8 A;  4MYB A;  3SX3 A;  2Y4M A;  4HOC A;  1ON6 A;  1ZDG A;  3V0P A;  5FYE A;  2VXM A;  1FGG A;  4D48 A;  4LW3 A;  4HO8 A;  2OI5 A;  3N9W A;  3CKV A;  4FRH A;  4FIY A;  1PZY B;  1ZI4 A;  5CMI A;  1TW5 A;  4M4K A;  3OH0 A;  1H7F A;  2A8W A;  2VS5 A;  4D11 A;  1QGS A;  1XZ6 A;  2PX7 A;  1H5R A;  1ZJ1 A;  4KPZ A;  5AJN A;  4HG6 A;  1GX4 A;  4DEC A;  1S4O A;  4HO2 A;  5D91 A;  5C49 A;  3LW6 A;  3PKQ A;  5C4F A;  1G23 A;  1ZJ3 A;  1G9R A;  2AEC A;  2PGV A;  5C4C A;  3I0C A;  4Q7C A;  1H7G A;  1ZCT A;  2GGO A;  2ZU9 A;  3V0L A;  1R7T A;  1S4P A;  2XWN A;  4B4B A;  3I0E A;  1R7Y A;  4FRO A;  2D7R A;  4HO9 A;  1H5S B;  3KIA A;  4ASJ A;  3ST8 A;  5C38 A;  4D0Z A;  2BO6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...