1H7EA

The structure of cmp:2-keto-3-deoxy-manno-octonic acid synthetase and of its complexes with substrates and substrate analogues, apo-enzyme
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
245
structure length
245
Chain Sequence
SKAVIVIPARYGSSRLPGKPLLDIVGKPMIQHVYERALQVAGVAEVWVATDDPRVEQAVQAFGGKAIMTRNDHESGTDRLVEVMHKVEADIYINLQGDEPMIRPRDVETLLQGMRDDPALPVATLCHAISAAEAAEPSTVKVVVNTRQDALYFSRSPIPYPRNAEKARYLKHVGIYAYRRDVLQNYSQLPESMPEQAESLEQLRLMNAGINIRTFEVAATGPGVDTPACLEKVRALMAQELAENA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleotidyltransferase
molecule keywords 3-DEOXY-MANNO-OCTULOSONATE CYTIDYLYLTRANSFERASE
publication title The Structure of Cmp:2-Keto-3-Deoxy-Manno-Octonic Acid Synthetase and of its Complexes with Substrates and Substrate Analogs
pubmed doi rcsb
source organism Escherichia coli
total genus 77
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature ec 2.7.7.38: 3-deoxy-manno-octulosonate cytidylyltransferase.
pdb deposition date 2001-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02348 CTP_transf_3 Cytidylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1h7eA00
1FGXA 1LZ7A 4ASJA 2RIXA 1EYRA 3E25A 4Y64A 3I0FA 1GWVA 3CKNA 1EZIA 2PGVA 1FG5N 2VS4A 4M2BA 3ZGGA 1MC3A 1VGZA 4FRMA 3T7OA 5C1GA 1JV1A 1ZCTA 4B3UA 1Z90A 3U2UA 2RIZA 3EE5A 3OH1A 3DJ4A 1H5SD 3OAMA 5BXCA 5CQMX 1VZTA 1VH1A 5L6VA 3ZLLA 3GUEA 1LL0A 1ZJ1A 2JCJA 3V0PA 4Y6UA 2FFVA 3V8ZA 4D11C 5FU0A 2RJ8A 3D5NA 1TVYA 2V0JA 2Y6PA 2W0VA 1LVWA 2Z86A 2D7IA 3I0KA 2Q4JA 1XHBA 5FTSA 2VFZA 2ZU9A 4FQWA 1JV3A 4G3SA 2VSHA 1VGTA 4ASYA 3OGZA 3I0LA 2RJ5A 1VZUA 3SXBA 1JVDA 4KXOA 3U2XA 4C2SA 1LL3A 4CJ8A 2P72A 5CMJA 3USRA 2P6WA 2WAWA 2AM5A 1R7VA 5FU8A 5L6SA 1H5SB 1VZXA 2O1FA 4FRBA 4HO5A 4FREA 1ZI5A 4KC2A 1VGUA 1OMZA 1OMXA 3NGWA 1HJJA 4Y7FA 5C3AA 1NHEB 4DE7A 2Y7AA 3Q7UA 1SS9A 4UEGA 5CQPA 2QH5A 1O7OA 3I0GA 2NXVA 2V0HA 2FYDB 4CJBA 1FR9A 2QKXA 3TQDA 1R7XA 3R3IA 1YROB 2AGDA 3IOIA 4NANA 1H7LA 5AJOA 1WT2A 2WE9A 3CKJA 3CKOA 4B4GA 4ARWA 5I1FA 4Y62A 3USQA 1ZI1A 2FYBA 1ZI3A 3V0LA 5C4BA 1R7TA 2YQSA 1S4PA 1HV9A 4D11A 1WT3A 2AE7A 2BO4A 1LZJA 4YS8A 4DDZA 2JCLA 4Y7UA 4KPZA 2WVKA 2GGQA 2VD4A 4LW6A 4FRAA 1HM0A 2APCA 4KRVA 4BMAA 1G2VA 1MP3A 2WVMA 1H7EA 1XZ6A 1W57A 1YP2A 3U0YA 3Q4SA 3V0QA 2VS3A 2WVLA 5CMGX 3SXCA 4FROA 1R80A 2X65A 3PKPA 2PGYA 1S4OA 3SXEA 1I52A 1HM8A 5JQQA 2PX7A 2W0WA 4B2WA 4MNDA 4ZDQA 3BRKX 5CMHA 4B42A 2VXMA 1O23B 3SXGA 5DDTA 2Y4LA 3JUJA 2RJ1A 4KC4A 1WVCA 4P02A 5C1HA 2JCOA 4KT7A 2JCKA 5CMFX 1ZDGA 4NAIA 4EEAA 2OEGA 3DK5A 2YCMA 3I0HA 4Y7GA 2RJ6A 1FO9A 2V0KA 4HO4A 5J49A 4FRDA 2VSIA 4DECA 3SPTA 3SXDA 5C49A 1ZCUA 1ZJ2A 4HO2A 4NAKA 3TZTA 5C38A 2RJ0A 1H5TB 5AJNA 1NWGB 1ZDFA 1FGGA 4D48A 3K8DA 4MYBA 1LZIA 5C4FA 4ECMA 2AM4A 3OH4A 2A8WA 4CJCA 2XMEA 1VPAA 5CMIA 2YC3A 1S4NA 4B2XA 1G3LA 1VICA 4Y63A 4EE4A 4HG6A 3U2WA 1G93A 1ON6A 2Y4KA 3OKRA 4G87A 3V91A 1H4DA 2O1GA 1QWJA 3U2VA 2O1HA 1FO8A 1FOAA 3FOQA 1H5SA 1R7UA 2YQHA 2XMHA 3KIAA 1ZJ0A 4HO8A 3U0XA 4HO6A 4KC1A 4XWIA 3T7NA 3I0IX 4LW3A 3ZGFA 1NF5B 4R7PA 1FRWA 2I5EA 2FYCB 5FYEA 1G1LA 2AH9A 2DPWA 1O7QA 5C4DA 3JTJA 1GX4A 2OI5A 3ST8A 5EJ1A 4JD0A 2Y4MA 2A8UA 4KNXA 3SXAA 4D0ZA 2X60A 3O3PA 3E26A 4KQLA 1H7TA 3ZF8A 1VGWA 1G97A 4NALA 1FXJA 4BQHA 3HL3A 5IDTA 2YESA 4E1KA 3V0MA 3FWWA 4M2AA 1G23A 2VXLA 3F1CA 2XWNA 4HO3A 3CU0A 1ZIZA 1H7QA 3PNNA 1MP5A 2AECA 4J18A 1INJA 1NMMB 3OH0A 1G8OA 5IDSA 1NKHB 2XWMA 2YC5A 1GQ9A 4JISA 2X5SA 3Q80A 1INIA 1PZYB 2YQCA 4AYJA 2Z87A 2PA4A 1R81A 4AYLA 1W77A 5EJZA 1H5RB 1H7GA 1WSZA 4M28A 3IOJA 4HO0A 4B4BA 2RJ7A 1H5SC 4KNRA 4HOCA 4EVWA 1FR8A 4Y7TA 4FRQA 1YP4A 2VS5A 2D7RA 3V0OA 2OEFA 5C47A 1WT1A 5FTVA 2RITA 2CU2A 1V84A 2V0IA 1E5KA 2AESA 2BO6A 5AJPA 1TW1A 3QVBA 1ON8A 4EE5A 1OQMB 4L41C 3CGXA 3I0DA 2FYAA 1NQIB 1VH3A 4HCQA 2D0JA 4AAWA 1G9RA 1FXOA 1KWSA 1G95A 1K4VA 4FRHA 2WEEA 2OI6A 3I0CA 3D98A 4EEMA 5FUHA 3OC9A 1GX0A 1FZWA 2YQJA 1QGQA 4FRLA 1LZ0A 2RJ9A 5CQLX 3RMVA 3T7MA 1R82A 3SX3A 3I0EA 2ICXA 4K6RA 1H5TA 1ZHJA 1ZJPA 1ZJOA 1VM8A 1GQCA 2E3DA 4CVHA 4HO9A 3N9WA 3CKQA 2ZU7A 1LL2A 2FY7A 1V83A 1MP4A 5HS2A 2GGOA 5C4EA 5CQOA 2BO7A 2ICYA 2RJ4A 3SX5A 1TW5A 3POLA 5IFYA 1GA8A 1TZFA 1HJLA 4G3QA 5EIYA 2AM3A 1JVGA 3CKVA 2OI7A 2I7BA 2RIYA 4EEOA 2E8BA 1ZI4A 5C48A 5C36A 4GBPA 2WGZA 4B5BA 5C8RA 2V0LA 3I0JA 5C1LA 1G0RA 4AC3A 1O0RA 4KPXA 3BCVA 2P73A 5C4CA 3JUKA 4M4KA 1ZCYA 4G3PA 1HM9A 4FRPA 1JYLA 2UX8A 4Y6NA 3IOHA 1QGSA 3V8YA 2QGIA 3SX7A 4FCUA 4P00A 3V90A 3F1YA 1H3MA 3V0NA 1PZTA 1H4EA 3OH2A 5CQNX 1ZJ3A 2X5ZA 1WT0A 2XWLA 3SX8A 1V82A 4B4MA 1R7YA 2MZBA 3ZLKA 1H4CA 3D8VA 5C3DA 2ZU8A 1W55A 1QG8A 3U2TA 2I5KA 4IRQA 3PKQA 5C3BA 1IINA 3LW6A 1YP3A 4Y9XA 3K8EA 3RSBA 2Y4JA 1GWWA 3RMWA 1JYKA 4IRPA 5FV9A 1FWYA 2FFUA 3DUVA 3OH3A 3R2WA 1ZCVA 4D0TA 4FCEA 4EE3A 1H5RA 5DDVA 4Y7VA 4EEGA 1H7FA 2BO8A 1IIMA 1H7HA
chains in the Genus database with same CATH superfamily
1FGXA 1LZ7A 4ASJA 2RIXA 1EYRA 3E25A 4Y64A 3I0FA 1GWVA 3CKNA 1EZIA 2PGVA 1FG5N 2VS4A 4M2BA 3ZGGA 1MC3A 1VGZA 4FRMA 3T7OA 5C1GA 1JV1A 1ZCTA 4B3UA 1Z90A 3U2UA 2RIZA 3EE5A 3OH1A 3DJ4A 1H5SD 3OAMA 5BXCA 5CQMX 1VZTA 1VH1A 5L6VA 3ZLLA 3GUEA 1LL0A 1ZJ1A 2JCJA 3V0PA 4Y6UA 2FFVA 3V8ZA 4D11C 5FU0A 2RJ8A 3D5NA 1TVYA 2V0JA 2Y6PA 2W0VA 1LVWA 2Z86A 2D7IA 3I0KA 2Q4JA 1XHBA 5FTSA 2VFZA 2ZU9A 4FQWA 1JV3A 5D92A 4G3SA 2VSHA 1VGTA 4ASYA 3OGZA 3I0LA 2RJ5A 1VZUA 3SXBA 1JVDA 4KXOA 3U2XA 4C2SA 1LL3A 4CJ8A 2P72A 5CMJA 4O6NA 3USRA 2P6WA 2WAWA 2AM5A 1R7VA 5FU8A 5L6SA 1H5SB 1VZXA 2O1FA 4FRBA 4HO5A 4FREA 1ZI5A 4KC2A 1VGUA 1OMZA 1OMXA 3NGWA 1HJJA 4Y7FA 5C3AA 1NHEB 4DE7A 2Y7AA 3Q7UA 1SS9A 4UEGA 5CQPA 2QH5A 1O7OA 3I0GA 2NXVA 2V0HA 2FYDB 4CJBA 1FR9A 2QKXA 3TQDA 1R7XA 3R3IA 1YROB 2AGDA 3IOIA 4NANA 1H7LA 5AJOA 1WT2A 2WE9A 3CKJA 3CKOA 4B4GA 4ARWA 5I1FA 4Y62A 3USQA 1ZI1A 2FYBA 1ZI3A 3V0LA 5C4BA 1R7TA 2YQSA 1S4PA 1HV9A 4D11A 1WT3A 2AE7A 2BO4A 1LZJA 4YS8A 4DDZA 2JCLA 4Y7UA 4KPZA 2WVKA 2GGQA 2VD4A 4LW6A 4FRAA 1HM0A 2APCA 4KRVA 4BMAA 1G2VA 1MP3A 2WVMA 1H7EA 1XZ6A 1W57A 1YP2A 3U0YA 3Q4SA 3V0QA 2VS3A 2WVLA 5CMGX 3SXCA 4FROA 1R80A 2X65A 3PKPA 2PGYA 1S4OA 3SXEA 1I52A 1HM8A 5JQQA 2PX7A 2W0WA 4B2WA 4MNDA 4ZDQA 3BRKX 5CMHA 4B42A 2VXMA 1O23B 3SXGA 5DDTA 2Y4LA 3JUJA 2RJ1A 4KC4A 1WVCA 4P02A 5C1HA 2JCOA 4KT7A 2JCKA 5CMFX 1ZDGA 4NAIA 4EEAA 2OEGA 3DK5A 2YCMA 3I0HA 4Y7GA 2RJ6A 1FO9A 2V0KA 4HO4A 5J49A 4FRDA 2VSIA 4DECA 4MIXA 3SPTA 3SXDA 5C49A 1ZCUA 1ZJ2A 4HO2A 4NAKA 3TZTA 5C38A 2RJ0A 1H5TB 5AJNA 1NWGB 1ZDFA 1FGGA 4D48A 2J0BA 4FIYA 3K8DA 4MYBA 1LZIA 5C4FA 4ECMA 2AM4A 3OH4A 2A8WA 4CJCA 2XMEA 1VPAA 5CMIA 2YC3A 1S4NA 4B2XA 1G3LA 1VICA 4Y63A 4EE4A 4HG6A 3U2WA 1G93A 1ON6A 2Y4KA 3OKRA 4G87A 3V91A 1H4DA 2O1GA 1QWJA 3U2VA 2O1HA 1FO8A 1FOAA 3FOQA 1H5SA 1R7UA 2YQHA 2XMHA 3KIAA 1ZJ0A 4HO8A 3U0XA 4HO6A 4KC1A 4XWIA 3T7NA 3I0IX 4LW3A 3ZGFA 1NF5B 5D91A 4R7PA 1FRWA 2I5EA 2VK9A 2FYCB 5FYEA 1G1LA 2AH9A 2DPWA 1O7QA 5C4DA 3JTJA 1GX4A 2OI5A 3ST8A 5EJ1A 4FIXA 4JD0A 2Y4MA 2A8UA 4KNXA 3SXAA 4D0ZA 2X60A 3O3PA 3E26A 4KQLA 1H7TA 3ZF8A 1VGWA 1G97A 4NALA 1FXJA 4BQHA 3HL3A 5IDTA 2YESA 4E1KA 3V0MA 3FWWA 4M2AA 1G23A 2VXLA 3F1CA 2XWNA 4HO3A 3CU0A 1ZIZA 1H7QA 3PNNA 1MP5A 2AECA 4J18A 1INJA 1NMMB 3OH0A 1G8OA 5IDSA 1NKHB 2XWMA 2YC5A 1GQ9A 4JISA 2X5SA 3Q80A 1INIA 1PZYB 2YQCA 4AYJA 2J0AA 2Z87A 2PA4A 1R81A 4AYLA 1W77A 5EJZA 1H5RB 1H7GA 1WSZA 4M28A 3IOJA 4HO0A 4B4BA 2RJ7A 1H5SC 4KNRA 4HOCA 4EVWA 1FR8A 4Y7TA 4FRQA 1YP4A 2VS5A 2D7RA 3V0OA 2OEFA 5C47A 1WT1A 5FTVA 2RITA 2CU2A 1V84A 2V0IA 1E5KA 2AESA 2BO6A 5AJPA 1TW1A 3QVBA 1ON8A 4EE5A 1OQMB 2C0NA 4L41C 3CGXA 3I0DA 2FYAA 1NQIB 1VH3A 4HCQA 2D0JA 4AAWA 1G9RA 1FXOA 1KWSA 1G95A 1K4VA 4FRHA 2WEEA 2OI6A 3I0CA 3D98A 4EEMA 5FUHA 3OC9A 1GX0A 1FZWA 2YQJA 1QGQA 4FRLA 1LZ0A 2RJ9A 5CQLX 3RMVA 3T7MA 1R82A 3SX3A 3I0EA 2ICXA 4K6RA 1H5TA 1ZHJA 1ZJPA 1ZJOA 1VM8A 1GQCA 2E3DA 4CVHA 4HO9A 3N9WA 3CKQA 2ZU7A 1LL2A 2FY7A 1V83A 1MP4A 5HS2A 2GGOA 5C4EA 5CQOA 2BO7A 2ICYA 2RJ4A 3SX5A 1TW5A 3POLA 5IFYA 1GA8A 1TZFA 1HJLA 4G3QA 5EIYA 2AM3A 1JVGA 3CKVA 2OI7A 2I7BA 2RIYA 4EEOA 2E8BA 1ZI4A 5C48A 5C36A 4GBPA 2WGZA 4B5BA 5C8RA 2V0LA 3I0JA 5C1LA 1G0RA 4AC3A 1O0RA 4KPXA 3BCVA 2P73A 5C4CA 3JUKA 4M4KA 1ZCYA 4G3PA 1HM9A 4FRPA 1JYLA 2UX8A 4Y6NA 3IOHA 1QGSA 3V8YA 2QGIA 3SX7A 4FCUA 4P00A 3V90A 3F1YA 4O6MA 1H3MA 3V0NA 1PZTA 1H4EA 3OH2A 5CQNX 1ZJ3A 2X5ZA 1WT0A 2XWLA 3SX8A 1V82A 4B4MA 1R7YA 2MZBA 3ZLKA 1H4CA 3D8VA 5C3DA 2ZU8A 1W55A 1QG8A 3U2TA 2I5KA 4IRQA 3PKQA 5C3BA 1IINA 3LW6A 1YP3A 4Y9XA 3K8EA 3RSBA 2Y4JA 1GWWA 3RMWA 1JYKA 4IRPA 5FV9A 1FWYA 2FFUA 3DUVA 3OH3A 3R2WA 4Q7CA 1ZCVA 4D0TA 4FCEA 4EE3A 1H5RA 5DDVA 4Y7VA 4EEGA 1H7FA 2BO8A 1IIMA 1H7HA
chains in the Genus database with same CATH topology
1FGXA 1LZ7A 4ASJA 2RIXA 1EYRA 3E25A 4Y64A 3I0FA 1GWVA 3CKNA 1EZIA 2PGVA 1FG5N 2VS4A 4M2BA 3ZGGA 1MC3A 1VGZA 4FRMA 3T7OA 5C1GA 1JV1A 1ZCTA 4B3UA 1Z90A 3U2UA 2RIZA 3EE5A 3OH1A 3DJ4A 1H5SD 3OAMA 5BXCA 5CQMX 1VZTA 1VH1A 5L6VA 3ZLLA 3GUEA 1LL0A 1ZJ1A 2JCJA 3V0PA 4Y6UA 2FFVA 3V8ZA 4D11C 5FU0A 2RJ8A 3D5NA 1TVYA 2V0JA 2Y6PA 2W0VA 1LVWA 2Z86A 2D7IA 3I0KA 2Q4JA 1XHBA 5FTSA 2VFZA 2ZU9A 4FQWA 1JV3A 5D92A 4G3SA 2VSHA 1VGTA 4ASYA 3OGZA 3I0LA 2RJ5A 1VZUA 3SXBA 1JVDA 4KXOA 3U2XA 4C2SA 1LL3A 4CJ8A 2P72A 5CMJA 4O6NA 3USRA 2P6WA 2WAWA 2AM5A 1R7VA 5FU8A 5L6SA 1H5SB 1VZXA 2O1FA 4FRBA 4HO5A 4FREA 1ZI5A 4KC2A 1VGUA 1OMZA 1OMXA 3NGWA 1HJJA 4Y7FA 5C3AA 1NHEB 4DE7A 2Y7AA 3Q7UA 1SS9A 4UEGA 5CQPA 2QH5A 1O7OA 3I0GA 2NXVA 2V0HA 2FYDB 4CJBA 1FR9A 2QKXA 3TQDA 1R7XA 3R3IA 1YROB 2AGDA 3IOIA 4NANA 1H7LA 5AJOA 1WT2A 2WE9A 3CKJA 3CKOA 4B4GA 4ARWA 5I1FA 4Y62A 3USQA 1ZI1A 2FYBA 1ZI3A 3V0LA 5C4BA 1R7TA 2YQSA 1S4PA 1HV9A 4D11A 1WT3A 2AE7A 2BO4A 1LZJA 4YS8A 4DDZA 2JCLA 4Y7UA 4KPZA 2WVKA 2GGQA 2VD4A 4LW6A 4FRAA 1HM0A 2APCA 4KRVA 4BMAA 1G2VA 1MP3A 2WVMA 1H7EA 1XZ6A 1W57A 1YP2A 3U0YA 3Q4SA 3V0QA 2VS3A 2WVLA 5CMGX 3SXCA 4FROA 1R80A 2X65A 3PKPA 2PGYA 1S4OA 3SXEA 1I52A 1HM8A 5JQQA 2PX7A 2W0WA 4B2WA 4MNDA 4ZDQA 3BRKX 5CMHA 4B42A 2VXMA 1O23B 3SXGA 5DDTA 2Y4LA 3JUJA 2RJ1A 4KC4A 1WVCA 4P02A 5C1HA 2JCOA 4KT7A 2JCKA 5CMFX 1ZDGA 4NAIA 4EEAA 2OEGA 3DK5A 2YCMA 3I0HA 4Y7GA 2RJ6A 1FO9A 2V0KA 4HO4A 5J49A 4FRDA 2VSIA 4DECA 4MIXA 3SPTA 3SXDA 5C49A 1ZCUA 1ZJ2A 4HO2A 4NAKA 3TZTA 5C38A 2RJ0A 1H5TB 5AJNA 1NWGB 1ZDFA 1FGGA 4D48A 2J0BA 4FIYA 3K8DA 4MYBA 1LZIA 5C4FA 4ECMA 2AM4A 3OH4A 2A8WA 4CJCA 2XMEA 1VPAA 5CMIA 2YC3A 1S4NA 4B2XA 1G3LA 1VICA 4Y63A 4EE4A 4HG6A 3U2WA 1G93A 1ON6A 2Y4KA 3OKRA 4G87A 3V91A 1H4DA 2O1GA 1QWJA 3U2VA 2O1HA 1FO8A 1FOAA 3FOQA 1H5SA 1R7UA 2YQHA 2XMHA 3KIAA 1ZJ0A 4HO8A 3U0XA 4HO6A 4KC1A 4XWIA 3T7NA 3I0IX 4LW3A 3ZGFA 1NF5B 5D91A 4R7PA 1FRWA 2I5EA 2VK9A 2FYCB 5FYEA 1G1LA 2AH9A 2DPWA 1O7QA 5C4DA 3JTJA 1GX4A 2OI5A 3ST8A 5EJ1A 4FIXA 4JD0A 2Y4MA 2A8UA 4KNXA 3SXAA 4D0ZA 2X60A 3O3PA 3E26A 4KQLA 1H7TA 3ZF8A 1VGWA 1G97A 4NALA 1FXJA 4BQHA 3HL3A 5IDTA 2YESA 4E1KA 3V0MA 3FWWA 4M2AA 1G23A 2VXLA 3F1CA 2XWNA 4HO3A 3CU0A 1ZIZA 1H7QA 3PNNA 1MP5A 2AECA 4J18A 1INJA 1NMMB 3OH0A 1G8OA 5IDSA 1NKHB 2XWMA 2YC5A 1GQ9A 4JISA 2X5SA 3Q80A 1INIA 1PZYB 2YQCA 4AYJA 2J0AA 2Z87A 2PA4A 1R81A 4AYLA 1W77A 5EJZA 1H5RB 1H7GA 1WSZA 4M28A 3IOJA 4HO0A 4B4BA 2RJ7A 1H5SC 4KNRA 4HOCA 4EVWA 1FR8A 4Y7TA 4FRQA 1YP4A 2VS5A 2D7RA 3V0OA 2OEFA 5C47A 1WT1A 5FTVA 2RITA 2CU2A 1V84A 2V0IA 1E5KA 2AESA 2BO6A 5AJPA 1TW1A 3QVBA 1ON8A 4EE5A 1OQMB 2C0NA 4L41C 3CGXA 3I0DA 2FYAA 1NQIB 1VH3A 4HCQA 2D0JA 4AAWA 1G9RA 1FXOA 1KWSA 1G95A 1K4VA 4FRHA 2WEEA 2OI6A 3I0CA 3D98A 4EEMA 5FUHA 3OC9A 1GX0A 1FZWA 2YQJA 1QGQA 4FRLA 1LZ0A 2RJ9A 5CQLX 3RMVA 3T7MA 1R82A 3SX3A 3I0EA 2ICXA 4K6RA 1H5TA 1ZHJA 1ZJPA 1ZJOA 1VM8A 1GQCA 2E3DA 4CVHA 4HO9A 3N9WA 3CKQA 2ZU7A 1LL2A 2FY7A 1V83A 1MP4A 5HS2A 2GGOA 5C4EA 5CQOA 2BO7A 2ICYA 2RJ4A 3SX5A 1TW5A 3POLA 5IFYA 1GA8A 1TZFA 1HJLA 4G3QA 5EIYA 2AM3A 1JVGA 3CKVA 2OI7A 2I7BA 2RIYA 4EEOA 2E8BA 1ZI4A 5C48A 5C36A 4GBPA 2WGZA 4B5BA 5C8RA 2V0LA 3I0JA 5C1LA 1G0RA 4AC3A 1O0RA 4KPXA 3BCVA 2P73A 5C4CA 3JUKA 4M4KA 1ZCYA 4G3PA 1HM9A 4FRPA 1JYLA 2UX8A 4Y6NA 3IOHA 1QGSA 3V8YA 2QGIA 3SX7A 4FCUA 4P00A 3V90A 3F1YA 4O6MA 1H3MA 3V0NA 1PZTA 1H4EA 3OH2A 5CQNX 1ZJ3A 2X5ZA 1WT0A 2XWLA 3SX8A 1V82A 4B4MA 1R7YA 2MZBA 3ZLKA 1H4CA 3D8VA 5C3DA 2ZU8A 1W55A 1QG8A 3U2TA 2I5KA 4IRQA 3PKQA 5C3BA 1IINA 3LW6A 1YP3A 4Y9XA 3K8EA 3RSBA 2Y4JA 1GWWA 3RMWA 1JYKA 4IRPA 5FV9A 1FWYA 2FFUA 3DUVA 3OH3A 3R2WA 4Q7CA 1ZCVA 4D0TA 4FCEA 4EE3A 1H5RA 5DDVA 4Y7VA 4EEGA 1H7FA 2BO8A 1IIMA 1H7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FGX A;  1LZ7 A;  4ASJ A;  2RIX A;  1EYR A;  3E25 A;  4Y64 A;  3I0F A;  1GWV A;  3CKN A;  1EZI A;  2PGV A;  1FG5 N;  2VS4 A;  4M2B A;  3ZGG A;  1MC3 A;  1VGZ A;  4FRM A;  3T7O A;  5C1G A;  1JV1 A;  1ZCT A;  4B3U A;  1Z90 A;  3U2U A;  2RIZ A;  3EE5 A;  3OH1 A;  3DJ4 A;  1H5S D;  3OAM A;  5BXC A;  5CQM X;  1VZT A;  1VH1 A;  5L6V A;  3ZLL A;  3GUE A;  1LL0 A;  1ZJ1 A;  2JCJ A;  3V0P A;  4Y6U A;  2FFV A;  3V8Z A;  4D11 C;  5FU0 A;  2RJ8 A;  3D5N A;  1TVY A;  2V0J A;  2Y6P A;  2W0V A;  1LVW A;  2Z86 A;  2D7I A;  3I0K A;  2Q4J A;  1XHB A;  5FTS A;  2VFZ A;  2ZU9 A;  4FQW A;  1JV3 A;  4G3S A;  2VSH A;  1VGT A;  4ASY A;  3OGZ A;  3I0L A;  2RJ5 A;  1VZU A;  3SXB A;  1JVD A;  4KXO A;  3U2X A;  4C2S A;  1LL3 A;  4CJ8 A;  2P72 A;  5CMJ A;  3USR A;  2P6W A;  2WAW A;  2AM5 A;  1R7V A;  5FU8 A;  5L6S A;  1H5S B;  1VZX A;  2O1F A;  4FRB A;  4HO5 A;  4FRE A;  1ZI5 A;  4KC2 A;  1VGU A;  1OMZ A;  1OMX A;  3NGW A;  1HJJ A;  4Y7F A;  5C3A A;  1NHE B;  4DE7 A;  2Y7A A;  3Q7U A;  1SS9 A;  4UEG A;  5CQP A;  2QH5 A;  1O7O A;  3I0G A;  2NXV A;  2V0H A;  2FYD B;  4CJB A;  1FR9 A;  2QKX A;  3TQD A;  1R7X A;  3R3I A;  1YRO B;  2AGD A;  3IOI A;  4NAN A;  1H7L A;  5AJO A;  1WT2 A;  2WE9 A;  3CKJ A;  3CKO A;  4B4G A;  4ARW A;  5I1F A;  4Y62 A;  3USQ A;  1ZI1 A;  2FYB A;  1ZI3 A;  3V0L A;  5C4B A;  1R7T A;  2YQS A;  1S4P A;  1HV9 A;  4D11 A;  1WT3 A;  2AE7 A;  2BO4 A;  1LZJ A;  4YS8 A;  4DDZ A;  2JCL A;  4Y7U A;  4KPZ A;  2WVK A;  2GGQ A;  2VD4 A;  4LW6 A;  4FRA A;  1HM0 A;  2APC A;  4KRV A;  4BMA A;  1G2V A;  1MP3 A;  2WVM A;  1H7E A;  1XZ6 A;  1W57 A;  1YP2 A;  3U0Y A;  3Q4S A;  3V0Q A;  2VS3 A;  2WVL A;  5CMG X;  3SXC A;  4FRO A;  1R80 A;  2X65 A;  3PKP A;  2PGY A;  1S4O A;  3SXE A;  1I52 A;  1HM8 A;  5JQQ A;  2PX7 A;  2W0W A;  4B2W A;  4MND A;  4ZDQ A;  3BRK X;  5CMH A;  4B42 A;  2VXM A;  1O23 B;  3SXG A;  5DDT A;  2Y4L A;  3JUJ A;  2RJ1 A;  4KC4 A;  1WVC A;  4P02 A;  5C1H A;  2JCO A;  4KT7 A;  2JCK A;  5CMF X;  1ZDG A;  4NAI A;  4EEA A;  2OEG A;  3DK5 A;  2YCM A;  3I0H A;  4Y7G A;  2RJ6 A;  1FO9 A;  2V0K A;  4HO4 A;  5J49 A;  4FRD A;  2VSI A;  4DEC A;  3SPT A;  3SXD A;  5C49 A;  1ZCU A;  1ZJ2 A;  4HO2 A;  4NAK A;  3TZT A;  5C38 A;  2RJ0 A;  1H5T B;  5AJN A;  1NWG B;  1ZDF A;  1FGG A;  4D48 A;  3K8D A;  4MYB A;  1LZI A;  5C4F A;  4ECM A;  2AM4 A;  3OH4 A;  2A8W A;  4CJC A;  2XME A;  1VPA A;  5CMI A;  2YC3 A;  1S4N A;  4B2X A;  1G3L A;  1VIC A;  4Y63 A;  4EE4 A;  4HG6 A;  3U2W A;  1G93 A;  1ON6 A;  2Y4K A;  3OKR A;  4G87 A;  3V91 A;  1H4D A;  2O1G A;  1QWJ A;  3U2V A;  2O1H A;  1FO8 A;  1FOA A;  3FOQ A;  1H5S A;  1R7U A;  2YQH A;  2XMH A;  3KIA A;  1ZJ0 A;  4HO8 A;  3U0X A;  4HO6 A;  4KC1 A;  4XWI A;  3T7N A;  3I0I X;  4LW3 A;  3ZGF A;  1NF5 B;  4R7P A;  1FRW A;  2I5E A;  2FYC B;  5FYE A;  1G1L A;  2AH9 A;  2DPW A;  1O7Q A;  5C4D A;  3JTJ A;  1GX4 A;  2OI5 A;  3ST8 A;  5EJ1 A;  4JD0 A;  2Y4M A;  2A8U A;  4KNX A;  3SXA A;  4D0Z A;  2X60 A;  3O3P A;  3E26 A;  4KQL A;  1H7T A;  3ZF8 A;  1VGW A;  1G97 A;  4NAL A;  1FXJ A;  4BQH A;  3HL3 A;  5IDT A;  2YES A;  4E1K A;  3V0M A;  3FWW A;  4M2A A;  1G23 A;  2VXL A;  3F1C A;  2XWN A;  4HO3 A;  3CU0 A;  1ZIZ A;  1H7Q A;  3PNN A;  1MP5 A;  2AEC A;  4J18 A;  1INJ A;  1NMM B;  3OH0 A;  1G8O A;  5IDS A;  1NKH B;  2XWM A;  2YC5 A;  1GQ9 A;  4JIS A;  2X5S A;  3Q80 A;  1INI A;  1PZY B;  2YQC A;  4AYJ A;  2Z87 A;  2PA4 A;  1R81 A;  4AYL A;  1W77 A;  5EJZ A;  1H5R B;  1H7G A;  1WSZ A;  4M28 A;  3IOJ A;  4HO0 A;  4B4B A;  2RJ7 A;  1H5S C;  4KNR A;  4HOC A;  4EVW A;  1FR8 A;  4Y7T A;  4FRQ A;  1YP4 A;  2VS5 A;  2D7R A;  3V0O A;  2OEF A;  5C47 A;  1WT1 A;  5FTV A;  2RIT A;  2CU2 A;  1V84 A;  2V0I A;  1E5K A;  2AES A;  2BO6 A;  5AJP A;  1TW1 A;  3QVB A;  1ON8 A;  4EE5 A;  1OQM B;  4L41 C;  3CGX A;  3I0D A;  2FYA A;  1NQI B;  1VH3 A;  4HCQ A;  2D0J A;  4AAW A;  1G9R A;  1FXO A;  1KWS A;  1G95 A;  1K4V A;  4FRH A;  2WEE A;  2OI6 A;  3I0C A;  3D98 A;  4EEM A;  5FUH A;  3OC9 A;  1GX0 A;  1FZW A;  2YQJ A;  1QGQ A;  4FRL A;  1LZ0 A;  2RJ9 A;  5CQL X;  3RMV A;  3T7M A;  1R82 A;  3SX3 A;  3I0E A;  2ICX A;  4K6R A;  1H5T A;  1ZHJ A;  1ZJP A;  1ZJO A;  1VM8 A;  1GQC A;  2E3D A;  4CVH A;  4HO9 A;  3N9W A;  3CKQ A;  2ZU7 A;  1LL2 A;  2FY7 A;  1V83 A;  1MP4 A;  5HS2 A;  2GGO A;  5C4E A;  5CQO A;  2BO7 A;  2ICY A;  2RJ4 A;  3SX5 A;  1TW5 A;  3POL A;  5IFY A;  1GA8 A;  1TZF A;  1HJL A;  4G3Q A;  5EIY A;  2AM3 A;  1JVG A;  3CKV A;  2OI7 A;  2I7B A;  2RIY A;  4EEO A;  2E8B A;  1ZI4 A;  5C48 A;  5C36 A;  4GBP A;  2WGZ A;  4B5B A;  5C8R A;  2V0L A;  3I0J A;  5C1L A;  1G0R A;  4AC3 A;  1O0R A;  4KPX A;  3BCV A;  2P73 A;  5C4C A;  3JUK A;  4M4K A;  1ZCY A;  4G3P A;  1HM9 A;  4FRP A;  1JYL A;  2UX8 A;  4Y6N A;  3IOH A;  1QGS A;  3V8Y A;  2QGI A;  3SX7 A;  4FCU A;  4P00 A;  3V90 A;  3F1Y A;  1H3M A;  3V0N A;  1PZT A;  1H4E A;  3OH2 A;  5CQN X;  1ZJ3 A;  2X5Z A;  1WT0 A;  2XWL A;  3SX8 A;  1V82 A;  4B4M A;  1R7Y A;  2MZB A;  3ZLK A;  1H4C A;  3D8V A;  5C3D A;  2ZU8 A;  1W55 A;  1QG8 A;  3U2T A;  2I5K A;  4IRQ A;  3PKQ A;  5C3B A;  1IIN A;  3LW6 A;  1YP3 A;  4Y9X A;  3K8E A;  3RSB A;  2Y4J A;  1GWW A;  3RMW A;  1JYK A;  4IRP A;  5FV9 A;  1FWY A;  2FFU A;  3DUV A;  3OH3 A;  3R2W A;  1ZCV A;  4D0T A;  4FCE A;  4EE3 A;  1H5R A;  5DDV A;  4Y7V A;  4EEG A;  1H7F A;  2BO8 A;  1IIM A;  1H7H A; 
#chains in the Genus database with same CATH topology
 1FGX A;  1LZ7 A;  4ASJ A;  2RIX A;  1EYR A;  3E25 A;  4Y64 A;  3I0F A;  1GWV A;  3CKN A;  1EZI A;  2PGV A;  1FG5 N;  2VS4 A;  4M2B A;  3ZGG A;  1MC3 A;  1VGZ A;  4FRM A;  3T7O A;  5C1G A;  1JV1 A;  1ZCT A;  4B3U A;  1Z90 A;  3U2U A;  2RIZ A;  3EE5 A;  3OH1 A;  3DJ4 A;  1H5S D;  3OAM A;  5BXC A;  5CQM X;  1VZT A;  1VH1 A;  5L6V A;  3ZLL A;  3GUE A;  1LL0 A;  1ZJ1 A;  2JCJ A;  3V0P A;  4Y6U A;  2FFV A;  3V8Z A;  4D11 C;  5FU0 A;  2RJ8 A;  3D5N A;  1TVY A;  2V0J A;  2Y6P A;  2W0V A;  1LVW A;  2Z86 A;  2D7I A;  3I0K A;  2Q4J A;  1XHB A;  5FTS A;  2VFZ A;  2ZU9 A;  4FQW A;  1JV3 A;  5D92 A;  4G3S A;  2VSH A;  1VGT A;  4ASY A;  3OGZ A;  3I0L A;  2RJ5 A;  1VZU A;  3SXB A;  1JVD A;  4KXO A;  3U2X A;  4C2S A;  1LL3 A;  4CJ8 A;  2P72 A;  5CMJ A;  4O6N A;  3USR A;  2P6W A;  2WAW A;  2AM5 A;  1R7V A;  5FU8 A;  5L6S A;  1H5S B;  1VZX A;  2O1F A;  4FRB A;  4HO5 A;  4FRE A;  1ZI5 A;  4KC2 A;  1VGU A;  1OMZ A;  1OMX A;  3NGW A;  1HJJ A;  4Y7F A;  5C3A A;  1NHE B;  4DE7 A;  2Y7A A;  3Q7U A;  1SS9 A;  4UEG A;  5CQP A;  2QH5 A;  1O7O A;  3I0G A;  2NXV A;  2V0H A;  2FYD B;  4CJB A;  1FR9 A;  2QKX A;  3TQD A;  1R7X A;  3R3I A;  1YRO B;  2AGD A;  3IOI A;  4NAN A;  1H7L A;  5AJO A;  1WT2 A;  2WE9 A;  3CKJ A;  3CKO A;  4B4G A;  4ARW A;  5I1F A;  4Y62 A;  3USQ A;  1ZI1 A;  2FYB A;  1ZI3 A;  3V0L A;  5C4B A;  1R7T A;  2YQS A;  1S4P A;  1HV9 A;  4D11 A;  1WT3 A;  2AE7 A;  2BO4 A;  1LZJ A;  4YS8 A;  4DDZ A;  2JCL A;  4Y7U A;  4KPZ A;  2WVK A;  2GGQ A;  2VD4 A;  4LW6 A;  4FRA A;  1HM0 A;  2APC A;  4KRV A;  4BMA A;  1G2V A;  1MP3 A;  2WVM A;  1H7E A;  1XZ6 A;  1W57 A;  1YP2 A;  3U0Y A;  3Q4S A;  3V0Q A;  2VS3 A;  2WVL A;  5CMG X;  3SXC A;  4FRO A;  1R80 A;  2X65 A;  3PKP A;  2PGY A;  1S4O A;  3SXE A;  1I52 A;  1HM8 A;  5JQQ A;  2PX7 A;  2W0W A;  4B2W A;  4MND A;  4ZDQ A;  3BRK X;  5CMH A;  4B42 A;  2VXM A;  1O23 B;  3SXG A;  5DDT A;  2Y4L A;  3JUJ A;  2RJ1 A;  4KC4 A;  1WVC A;  4P02 A;  5C1H A;  2JCO A;  4KT7 A;  2JCK A;  5CMF X;  1ZDG A;  4NAI A;  4EEA A;  2OEG A;  3DK5 A;  2YCM A;  3I0H A;  4Y7G A;  2RJ6 A;  1FO9 A;  2V0K A;  4HO4 A;  5J49 A;  4FRD A;  2VSI A;  4DEC A;  4MIX A;  3SPT A;  3SXD A;  5C49 A;  1ZCU A;  1ZJ2 A;  4HO2 A;  4NAK A;  3TZT A;  5C38 A;  2RJ0 A;  1H5T B;  5AJN A;  1NWG B;  1ZDF A;  1FGG A;  4D48 A;  2J0B A;  4FIY A;  3K8D A;  4MYB A;  1LZI A;  5C4F A;  4ECM A;  2AM4 A;  3OH4 A;  2A8W A;  4CJC A;  2XME A;  1VPA A;  5CMI A;  2YC3 A;  1S4N A;  4B2X A;  1G3L A;  1VIC A;  4Y63 A;  4EE4 A;  4HG6 A;  3U2W A;  1G93 A;  1ON6 A;  2Y4K A;  3OKR A;  4G87 A;  3V91 A;  1H4D A;  2O1G A;  1QWJ A;  3U2V A;  2O1H A;  1FO8 A;  1FOA A;  3FOQ A;  1H5S A;  1R7U A;  2YQH A;  2XMH A;  3KIA A;  1ZJ0 A;  4HO8 A;  3U0X A;  4HO6 A;  4KC1 A;  4XWI A;  3T7N A;  3I0I X;  4LW3 A;  3ZGF A;  1NF5 B;  5D91 A;  4R7P A;  1FRW A;  2I5E A;  2VK9 A;  2FYC B;  5FYE A;  1G1L A;  2AH9 A;  2DPW A;  1O7Q A;  5C4D A;  3JTJ A;  1GX4 A;  2OI5 A;  3ST8 A;  5EJ1 A;  4FIX A;  4JD0 A;  2Y4M A;  2A8U A;  4KNX A;  3SXA A;  4D0Z A;  2X60 A;  3O3P A;  3E26 A;  4KQL A;  1H7T A;  3ZF8 A;  1VGW A;  1G97 A;  4NAL A;  1FXJ A;  4BQH A;  3HL3 A;  5IDT A;  2YES A;  4E1K A;  3V0M A;  3FWW A;  4M2A A;  1G23 A;  2VXL A;  3F1C A;  2XWN A;  4HO3 A;  3CU0 A;  1ZIZ A;  1H7Q A;  3PNN A;  1MP5 A;  2AEC A;  4J18 A;  1INJ A;  1NMM B;  3OH0 A;  1G8O A;  5IDS A;  1NKH B;  2XWM A;  2YC5 A;  1GQ9 A;  4JIS A;  2X5S A;  3Q80 A;  1INI A;  1PZY B;  2YQC A;  4AYJ A;  2J0A A;  2Z87 A;  2PA4 A;  1R81 A;  4AYL A;  1W77 A;  5EJZ A;  1H5R B;  1H7G A;  1WSZ A;  4M28 A;  3IOJ A;  4HO0 A;  4B4B A;  2RJ7 A;  1H5S C;  4KNR A;  4HOC A;  4EVW A;  1FR8 A;  4Y7T A;  4FRQ A;  1YP4 A;  2VS5 A;  2D7R A;  3V0O A;  2OEF A;  5C47 A;  1WT1 A;  5FTV A;  2RIT A;  2CU2 A;  1V84 A;  2V0I A;  1E5K A;  2AES A;  2BO6 A;  5AJP A;  1TW1 A;  3QVB A;  1ON8 A;  4EE5 A;  1OQM B;  2C0N A;  4L41 C;  3CGX A;  3I0D A;  2FYA A;  1NQI B;  1VH3 A;  4HCQ A;  2D0J A;  4AAW A;  1G9R A;  1FXO A;  1KWS A;  1G95 A;  1K4V A;  4FRH A;  2WEE A;  2OI6 A;  3I0C A;  3D98 A;  4EEM A;  5FUH A;  3OC9 A;  1GX0 A;  1FZW A;  2YQJ A;  1QGQ A;  4FRL A;  1LZ0 A;  2RJ9 A;  5CQL X;  3RMV A;  3T7M A;  1R82 A;  3SX3 A;  3I0E A;  2ICX A;  4K6R A;  1H5T A;  1ZHJ A;  1ZJP A;  1ZJO A;  1VM8 A;  1GQC A;  2E3D A;  4CVH A;  4HO9 A;  3N9W A;  3CKQ A;  2ZU7 A;  1LL2 A;  2FY7 A;  1V83 A;  1MP4 A;  5HS2 A;  2GGO A;  5C4E A;  5CQO A;  2BO7 A;  2ICY A;  2RJ4 A;  3SX5 A;  1TW5 A;  3POL A;  5IFY A;  1GA8 A;  1TZF A;  1HJL A;  4G3Q A;  5EIY A;  2AM3 A;  1JVG A;  3CKV A;  2OI7 A;  2I7B A;  2RIY A;  4EEO A;  2E8B A;  1ZI4 A;  5C48 A;  5C36 A;  4GBP A;  2WGZ A;  4B5B A;  5C8R A;  2V0L A;  3I0J A;  5C1L A;  1G0R A;  4AC3 A;  1O0R A;  4KPX A;  3BCV A;  2P73 A;  5C4C A;  3JUK A;  4M4K A;  1ZCY A;  4G3P A;  1HM9 A;  4FRP A;  1JYL A;  2UX8 A;  4Y6N A;  3IOH A;  1QGS A;  3V8Y A;  2QGI A;  3SX7 A;  4FCU A;  4P00 A;  3V90 A;  3F1Y A;  4O6M A;  1H3M A;  3V0N A;  1PZT A;  1H4E A;  3OH2 A;  5CQN X;  1ZJ3 A;  2X5Z A;  1WT0 A;  2XWL A;  3SX8 A;  1V82 A;  4B4M A;  1R7Y A;  2MZB A;  3ZLK A;  1H4C A;  3D8V A;  5C3D A;  2ZU8 A;  1W55 A;  1QG8 A;  3U2T A;  2I5K A;  4IRQ A;  3PKQ A;  5C3B A;  1IIN A;  3LW6 A;  1YP3 A;  4Y9X A;  3K8E A;  3RSB A;  2Y4J A;  1GWW A;  3RMW A;  1JYK A;  4IRP A;  5FV9 A;  1FWY A;  2FFU A;  3DUV A;  3OH3 A;  3R2W A;  4Q7C A;  1ZCV A;  4D0T A;  4FCE A;  4EE3 A;  1H5R A;  5DDV A;  4Y7V A;  4EEG A;  1H7F A;  2BO8 A;  1IIM A;  1H7H A; 
#chains in the Genus database with same CATH homology
 1FGX A;  1LZ7 A;  4ASJ A;  2RIX A;  1EYR A;  3E25 A;  4Y64 A;  3I0F A;  1GWV A;  3CKN A;  1EZI A;  2PGV A;  1FG5 N;  2VS4 A;  4M2B A;  3ZGG A;  1MC3 A;  1VGZ A;  4FRM A;  3T7O A;  5C1G A;  1JV1 A;  1ZCT A;  4B3U A;  1Z90 A;  3U2U A;  2RIZ A;  3EE5 A;  3OH1 A;  3DJ4 A;  1H5S D;  3OAM A;  5BXC A;  5CQM X;  1VZT A;  1VH1 A;  5L6V A;  3ZLL A;  3GUE A;  1LL0 A;  1ZJ1 A;  2JCJ A;  3V0P A;  4Y6U A;  2FFV A;  3V8Z A;  4D11 C;  5FU0 A;  2RJ8 A;  3D5N A;  1TVY A;  2V0J A;  2Y6P A;  2W0V A;  1LVW A;  2Z86 A;  2D7I A;  3I0K A;  2Q4J A;  1XHB A;  5FTS A;  2VFZ A;  2ZU9 A;  4FQW A;  1JV3 A;  5D92 A;  4G3S A;  2VSH A;  1VGT A;  4ASY A;  3OGZ A;  3I0L A;  2RJ5 A;  1VZU A;  3SXB A;  1JVD A;  4KXO A;  3U2X A;  4C2S A;  1LL3 A;  4CJ8 A;  2P72 A;  5CMJ A;  4O6N A;  3USR A;  2P6W A;  2WAW A;  2AM5 A;  1R7V A;  5FU8 A;  5L6S A;  1H5S B;  1VZX A;  2O1F A;  4FRB A;  4HO5 A;  4FRE A;  1ZI5 A;  4KC2 A;  1VGU A;  1OMZ A;  1OMX A;  3NGW A;  1HJJ A;  4Y7F A;  5C3A A;  1NHE B;  4DE7 A;  2Y7A A;  3Q7U A;  1SS9 A;  4UEG A;  5CQP A;  2QH5 A;  1O7O A;  3I0G A;  2NXV A;  2V0H A;  2FYD B;  4CJB A;  1FR9 A;  2QKX A;  3TQD A;  1R7X A;  3R3I A;  1YRO B;  2AGD A;  3IOI A;  4NAN A;  1H7L A;  5AJO A;  1WT2 A;  2WE9 A;  3CKJ A;  3CKO A;  4B4G A;  4ARW A;  5I1F A;  4Y62 A;  3USQ A;  1ZI1 A;  2FYB A;  1ZI3 A;  3V0L A;  5C4B A;  1R7T A;  2YQS A;  1S4P A;  1HV9 A;  4D11 A;  1WT3 A;  2AE7 A;  2BO4 A;  1LZJ A;  4YS8 A;  4DDZ A;  2JCL A;  4Y7U A;  4KPZ A;  2WVK A;  2GGQ A;  2VD4 A;  4LW6 A;  4FRA A;  1HM0 A;  2APC A;  4KRV A;  4BMA A;  1G2V A;  1MP3 A;  2WVM A;  1H7E A;  1XZ6 A;  1W57 A;  1YP2 A;  3U0Y A;  3Q4S A;  3V0Q A;  2VS3 A;  2WVL A;  5CMG X;  3SXC A;  4FRO A;  1R80 A;  2X65 A;  3PKP A;  2PGY A;  1S4O A;  3SXE A;  1I52 A;  1HM8 A;  5JQQ A;  2PX7 A;  2W0W A;  4B2W A;  4MND A;  4ZDQ A;  3BRK X;  5CMH A;  4B42 A;  2VXM A;  1O23 B;  3SXG A;  5DDT A;  2Y4L A;  3JUJ A;  2RJ1 A;  4KC4 A;  1WVC A;  4P02 A;  5C1H A;  2JCO A;  4KT7 A;  2JCK A;  5CMF X;  1ZDG A;  4NAI A;  4EEA A;  2OEG A;  3DK5 A;  2YCM A;  3I0H A;  4Y7G A;  2RJ6 A;  1FO9 A;  2V0K A;  4HO4 A;  5J49 A;  4FRD A;  2VSI A;  4DEC A;  4MIX A;  3SPT A;  3SXD A;  5C49 A;  1ZCU A;  1ZJ2 A;  4HO2 A;  4NAK A;  3TZT A;  5C38 A;  2RJ0 A;  1H5T B;  5AJN A;  1NWG B;  1ZDF A;  1FGG A;  4D48 A;  2J0B A;  4FIY A;  3K8D A;  4MYB A;  1LZI A;  5C4F A;  4ECM A;  2AM4 A;  3OH4 A;  2A8W A;  4CJC A;  2XME A;  1VPA A;  5CMI A;  2YC3 A;  1S4N A;  4B2X A;  1G3L A;  1VIC A;  4Y63 A;  4EE4 A;  4HG6 A;  3U2W A;  1G93 A;  1ON6 A;  2Y4K A;  3OKR A;  4G87 A;  3V91 A;  1H4D A;  2O1G A;  1QWJ A;  3U2V A;  2O1H A;  1FO8 A;  1FOA A;  3FOQ A;  1H5S A;  1R7U A;  2YQH A;  2XMH A;  3KIA A;  1ZJ0 A;  4HO8 A;  3U0X A;  4HO6 A;  4KC1 A;  4XWI A;  3T7N A;  3I0I X;  4LW3 A;  3ZGF A;  1NF5 B;  5D91 A;  4R7P A;  1FRW A;  2I5E A;  2VK9 A;  2FYC B;  5FYE A;  1G1L A;  2AH9 A;  2DPW A;  1O7Q A;  5C4D A;  3JTJ A;  1GX4 A;  2OI5 A;  3ST8 A;  5EJ1 A;  4FIX A;  4JD0 A;  2Y4M A;  2A8U A;  4KNX A;  3SXA A;  4D0Z A;  2X60 A;  3O3P A;  3E26 A;  4KQL A;  1H7T A;  3ZF8 A;  1VGW A;  1G97 A;  4NAL A;  1FXJ A;  4BQH A;  3HL3 A;  5IDT A;  2YES A;  4E1K A;  3V0M A;  3FWW A;  4M2A A;  1G23 A;  2VXL A;  3F1C A;  2XWN A;  4HO3 A;  3CU0 A;  1ZIZ A;  1H7Q A;  3PNN A;  1MP5 A;  2AEC A;  4J18 A;  1INJ A;  1NMM B;  3OH0 A;  1G8O A;  5IDS A;  1NKH B;  2XWM A;  2YC5 A;  1GQ9 A;  4JIS A;  2X5S A;  3Q80 A;  1INI A;  1PZY B;  2YQC A;  4AYJ A;  2J0A A;  2Z87 A;  2PA4 A;  1R81 A;  4AYL A;  1W77 A;  5EJZ A;  1H5R B;  1H7G A;  1WSZ A;  4M28 A;  3IOJ A;  4HO0 A;  4B4B A;  2RJ7 A;  1H5S C;  4KNR A;  4HOC A;  4EVW A;  1FR8 A;  4Y7T A;  4FRQ A;  1YP4 A;  2VS5 A;  2D7R A;  3V0O A;  2OEF A;  5C47 A;  1WT1 A;  5FTV A;  2RIT A;  2CU2 A;  1V84 A;  2V0I A;  1E5K A;  2AES A;  2BO6 A;  5AJP A;  1TW1 A;  3QVB A;  1ON8 A;  4EE5 A;  1OQM B;  2C0N A;  4L41 C;  3CGX A;  3I0D A;  2FYA A;  1NQI B;  1VH3 A;  4HCQ A;  2D0J A;  4AAW A;  1G9R A;  1FXO A;  1KWS A;  1G95 A;  1K4V A;  4FRH A;  2WEE A;  2OI6 A;  3I0C A;  3D98 A;  4EEM A;  5FUH A;  3OC9 A;  1GX0 A;  1FZW A;  2YQJ A;  1QGQ A;  4FRL A;  1LZ0 A;  2RJ9 A;  5CQL X;  3RMV A;  3T7M A;  1R82 A;  3SX3 A;  3I0E A;  2ICX A;  4K6R A;  1H5T A;  1ZHJ A;  1ZJP A;  1ZJO A;  1VM8 A;  1GQC A;  2E3D A;  4CVH A;  4HO9 A;  3N9W A;  3CKQ A;  2ZU7 A;  1LL2 A;  2FY7 A;  1V83 A;  1MP4 A;  5HS2 A;  2GGO A;  5C4E A;  5CQO A;  2BO7 A;  2ICY A;  2RJ4 A;  3SX5 A;  1TW5 A;  3POL A;  5IFY A;  1GA8 A;  1TZF A;  1HJL A;  4G3Q A;  5EIY A;  2AM3 A;  1JVG A;  3CKV A;  2OI7 A;  2I7B A;  2RIY A;  4EEO A;  2E8B A;  1ZI4 A;  5C48 A;  5C36 A;  4GBP A;  2WGZ A;  4B5B A;  5C8R A;  2V0L A;  3I0J A;  5C1L A;  1G0R A;  4AC3 A;  1O0R A;  4KPX A;  3BCV A;  2P73 A;  5C4C A;  3JUK A;  4M4K A;  1ZCY A;  4G3P A;  1HM9 A;  4FRP A;  1JYL A;  2UX8 A;  4Y6N A;  3IOH A;  1QGS A;  3V8Y A;  2QGI A;  3SX7 A;  4FCU A;  4P00 A;  3V90 A;  3F1Y A;  4O6M A;  1H3M A;  3V0N A;  1PZT A;  1H4E A;  3OH2 A;  5CQN X;  1ZJ3 A;  2X5Z A;  1WT0 A;  2XWL A;  3SX8 A;  1V82 A;  4B4M A;  1R7Y A;  2MZB A;  3ZLK A;  1H4C A;  3D8V A;  5C3D A;  2ZU8 A;  1W55 A;  1QG8 A;  3U2T A;  2I5K A;  4IRQ A;  3PKQ A;  5C3B A;  1IIN A;  3LW6 A;  1YP3 A;  4Y9X A;  3K8E A;  3RSB A;  2Y4J A;  1GWW A;  3RMW A;  1JYK A;  4IRP A;  5FV9 A;  1FWY A;  2FFU A;  3DUV A;  3OH3 A;  3R2W A;  4Q7C A;  1ZCV A;  4D0T A;  4FCE A;  4EE3 A;  1H5R A;  5DDV A;  4Y7V A;  4EEG A;  1H7F A;  2BO8 A;  1IIM A;  1H7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...