1H7EA

The structure of cmp:2-keto-3-deoxy-manno-octonic acid synthetase and of its complexes with substrates and substrate analogues, apo-enzyme
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
245
structure length
245
Chain Sequence
SKAVIVIPARYGSSRLPGKPLLDIVGKPMIQHVYERALQVAGVAEVWVATDDPRVEQAVQAFGGKAIMTRNDHESGTDRLVEVMHKVEADIYINLQGDEPMIRPRDVETLLQGMRDDPALPVATLCHAISAAEAAEPSTVKVVVNTRQDALYFSRSPIPYPRNAEKARYLKHVGIYAYRRDVLQNYSQLPESMPEQAESLEQLRLMNAGINIRTFEVAATGPGVDTPACLEKVRALMAQELAENA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-DEOXY-MANNO-OCTULOSONATE CYTIDYLYLTRANSFERASE
publication title The Structure of Cmp:2-Keto-3-Deoxy-Manno-Octonic Acid Synthetase and of its Complexes with Substrates and Substrate Analogs
pubmed doi rcsb
source organism Escherichia coli
molecule tags Nucleotidyltransferase
total genus 77
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature ec 2.7.7.38: 3-deoxy-manno-octulosonate cytidylyltransferase.
pdb deposition date 2001-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02348 CTP_transf_3 Cytidylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1h7eA00
4CJCA 4FCEA 5BXCA 5FV9A 1VM8A 2RJ9A 4HG6A 4M4KA 3V0OA 1FO9A 1W55A 2D0JA 1R7XA 3SX8A 2FYCB 1GA8A 2PGYA 1LZ0A 2A8WA 5C49A 4NAIA 1H3MA 3EE5A 4JISA 2RJ8A 2GGQA 1S4NA 2E8BA 4G3SA 3I0KA 2D7RA 4FREA 4KQLA 2OEFA 3U2XA 1OMZA 4HOCA 1ZCYA 2YC3A 1R81A 1MP4A 2X65A 2FYDB 1TW5A 4B42A 1O7QA 1O23B 4HO5A 1K4VA 1NKHB 2BO7A 3SX7A 3Q7UA 1H7TA 5C4BA 1INIA 1FRWA 1OQMB 4D11A 1TW1A 4HO9A 3F1YA 3JUKA 5C4CA 2VS5A 1MP5A 4JD0A 2OI6A 2VS3A 1G97A 1HJJA 3R3IA 3V0MA 1FXJA 4B3UA 1G95A 3JTJA 1ZDFA 2O1FA 1ZHJA 1ZI3A 2VFZA 2VXMA 3CKNA 3I0FA 5CQPA 1ZJPA 1H7GA 1INJA 1OMXA 2Y4KA 3OH3A 2AE7A 2V0IA 2W0VA 1VZTA 3NGWA 4CVHA 1ZCVA 3BCVA 2GGOA 1R82A 5L6VA 2VD4A 1G2VA 3V90A 1QWJA 2WVKA 4D0ZA 4CJBA 5AJOA 4ZDQA 2P6WA 1PZYB 2QKXA 2WEEA 2FFVA 3IOJA 1H7LA 1EYRA 4HO3A 3JUJA 3RMWA 4YS8A 2QH5A 3SPTA 4C2SA 2RIYA 1WVCA 4EE4A 4AYLA 3IOHA 4G87A 3V8YA 1E5KA 1VZUA 1H5SD 2QGIA 2YQJA 3D5NA 3T7MA 1KWSA 4FROA 1R80A 3ST8A 2BO8A 4E1KA 5C4EA 3LW6A 2I5EA 3I0IX 2RJ1A 3OH4A 3I0DA 4B4BA 4EVWA 1HV9A 3I0HA 2NXVA 1H4DA 1XZ6A 1H7EA 2RJ7A 5C4FA 2ICXA 3N9WA 1PZTA 3OH0A 1H5SC 5C38A 5C47A 2YQHA 1EZIA 1TVYA 3QVBA 2P72A 2YCMA 2V0JA 1H5SB 4CJ8A 1WT3A 1VPAA 1R7TA 4DDZA 2RIXA 1ZJ3A 4BQHA 1HM8A 1H7QA 5CMIA 2WVMA 1LL0A 5C48A 5AJPA 5CMFX 5C3BA 5EIYA 4KC2A 1H5TB 2CU2A 1LZJA 5EJZA 3OC9A 2WVLA 1HM0A 2VSHA 4M2BA 2Z87A 5CQNX 5DDVA 3V0PA 1WT2A 1WT0A 4NALA 3V8ZA 4Y9XA 4D11C 4FRHA 4Y7TA 1LL3A 4FRQA 4KRVA 2RITA 1QGQA 1TZFA 3SXGA 1NMMB 4KT7A 4NANA 4B5BA 1W57A 2RJ6A 3RMVA 3GUEA 2A8UA 3HL3A 2XWLA 1NF5B 4FCUA 5FYEA 3RSBA 3V0QA 1H4EA 5IDTA 3OAMA 1GWWA 4ECMA 3I0CA 4AC3A 1H5RB 5FUHA 2V0LA 4B2WA 3I0EA 5JQQA 1ZJ0A 3KIAA 1YROB 1JYLA 1G93A 2AM5A 2FY7A 1IINA 4FRPA 4B2XA 1G1LA 1VGTA 2WGZA 4NAKA 5CQOA 1R7UA 4EEAA 1W77A 3Q80A 2YQSA 1NQIB 3I0LA 4Y62A 3V91A 3ZGFA 1FGGA 1H5RA 1G9RA 4EEMA 4ASYA 2PGVA 3CGXA 2RIZA 4XWIA 1FGXA 2JCKA 1ZJOA 1O0RA 2VSIA 2O1GA 4HO0A 1GWVA 1QGSA 1O7OA 3F1CA 4HO8A 3SX5A 2MZBA 3U2WA 1JVGA 4EEGA 3SXCA 5AJNA 2APCA 1FG5N 3U2TA 5DDTA 4ARWA 5HS2A 2ZU9A 5IFYA 2OI5A 5CQLX 4L41C 1VGZA 4P02A 1JVDA 2RJ0A 2E3DA 1ZCUA 3DJ4A 4Y63A 2X60A 1FR8A 3D8VA 3CKJA 1GQ9A 1VH3A 5CMGX 1WT1A 1NWGB 4UEGA 1V84A 2WE9A 3USRA 1JYKA 4IRQA 1WSZA 4IRPA 1LVWA 2JCJA 1S4PA 2DPWA 1FWYA 1VGUA 2XMEA 3SXDA 3SXEA 3I0JA 1Z90A 4FRMA 4K6RA 3DUVA 4Y7UA 1G8OA 4KNXA 3FWWA 2X5SA 2AESA 4HO6A 3SX3A 2FYBA 2XWMA 4HCQA 1V82A 3POLA 2YC5A 5CMHA 5IDSA 1ZJ1A 2Y4LA 1ON6A 4FRLA 1VICA 1ZI4A 1FZWA 1ZI1A 2XWNA 3TZTA 1NHEB 1H5SA 3T7NA 4D0TA 5L6SA 1MC3A 2RJ4A 3OGZA 1ZJ2A 1YP4A 3U0XA 1GQCA 1FR9A 1ZDGA 3V0NA 4R7PA 2W0WA 3ZF8A 3E25A 1ON8A 1H5TA 1G3LA 2JCOA 3PNNA 4DECA 3CKVA 5C1GA 2V0HA 3K8EA 4MNDA 3OH1A 1JV3A 2D7IA 2AH9A 4Y6UA 5FU8A 1JV1A 2VS4A 4G3QA 2PA4A 5C1LA 4FRBA 2UX8A 4Y64A 3T7OA 1QG8A 4KC4A 3E26A 1FOAA 3DK5A 1GX0A 1ZI5A 1VZXA 4LW3A 4LW6A 5FU0A 4Y6NA 3O3PA 1MP3A 3U2UA 1FXOA 1G23A 2VXLA 1IIMA 1GX4A 2FFUA 2OI7A 2YESA 5EJ1A 3K8DA 2BO6A 4P00A 2ICYA 1YP2A 3R2WA 4ASJA 3OH2A 2OEGA 2V0KA 1HJLA 2O1HA 3I0GA 5J49A 1SS9A 3CU0A 3USQA 1FO8A 2BO4A 3U0YA 1XHBA 1R7VA 4Y7GA 3BRKX 1VH1A 2YQCA 2X5ZA 3D98A 5C8RA 4EE5A 5CQMX 2P73A 4M28A 4B4GA 4HO2A 4EEOA 3FOQA 1I52A 3IOIA 3SXBA 2Y4JA 2AM4A 1H7FA 4J18A 2AECA 5C3DA 4FRDA 4AAWA 4DE7A 4KNRA 1H4CA 3OKRA 5C3AA 5CMJA 4KPXA 3SXAA 3TQDA 1V83A 1HM9A 3ZLKA 2RJ5A 2WAWA 3V0LA 1G0RA 2Y6PA 4Y7VA 4D48A 1VGWA 2Z86A 4M2AA 2Y4MA 3CKQA 3PKQA 1S4OA 4KXOA 3ZGGA 1H7HA 5FTVA 4FRAA 4KC1A 2PX7A 1ZIZA 2I7BA 5C4DA 3ZLLA 3U2VA 2AM3A 4GBPA 1ZCTA 4BMAA 2XMHA 3CKOA 2AGDA 4HO4A 4Y7FA 4MYBA 4EE3A 5C36A 1LZ7A 1YP3A 4KPZA 1R7YA 1LL2A 4FQWA 4AYJA 3PKPA 2JCLA 2Y7AA 2FYAA 5I1FA 3Q4SA 5C1HA 1LZIA 2ZU7A 4B4MA 4G3PA 5FTSA 2ZU8A 2I5KA 2Q4JA
chains in the Genus database with same CATH superfamily
4CJCA 4FCEA 5BXCA 5FV9A 1VM8A 2RJ9A 4HG6A 4M4KA 3V0OA 1FO9A 1W55A 2D0JA 1R7XA 3SX8A 2FYCB 1GA8A 2PGYA 1LZ0A 2A8WA 5C49A 4NAIA 1H3MA 3EE5A 4JISA 2RJ8A 2GGQA 1S4NA 2E8BA 4G3SA 3I0KA 2D7RA 4FREA 4KQLA 2OEFA 3U2XA 1OMZA 4HOCA 1ZCYA 2YC3A 1R81A 1MP4A 2X65A 2FYDB 1TW5A 4B42A 1O7QA 1O23B 4HO5A 1K4VA 1NKHB 2BO7A 3SX7A 3Q7UA 1H7TA 5C4BA 1INIA 1FRWA 1OQMB 4D11A 1TW1A 4HO9A 3F1YA 3JUKA 5C4CA 2VS5A 1MP5A 4JD0A 2OI6A 2VS3A 1G97A 1HJJA 3R3IA 3V0MA 1FXJA 4B3UA 1G95A 3JTJA 1ZDFA 2O1FA 1ZHJA 1ZI3A 2VFZA 2VXMA 3CKNA 3I0FA 5CQPA 1ZJPA 1H7GA 1INJA 1OMXA 2Y4KA 3OH3A 2AE7A 2V0IA 2W0VA 1VZTA 3NGWA 4CVHA 1ZCVA 3BCVA 2GGOA 1R82A 5L6VA 2VD4A 1G2VA 3V90A 1QWJA 2WVKA 4D0ZA 4CJBA 5AJOA 4ZDQA 2P6WA 1PZYB 2QKXA 2WEEA 2FFVA 3IOJA 1H7LA 1EYRA 4HO3A 3JUJA 3RMWA 2J0AA 4YS8A 2QH5A 3SPTA 4C2SA 2RIYA 1WVCA 4EE4A 4AYLA 3IOHA 4G87A 3V8YA 1E5KA 1VZUA 1H5SD 2QGIA 2YQJA 3D5NA 3T7MA 1KWSA 4FROA 1R80A 3ST8A 2BO8A 4E1KA 5C4EA 3LW6A 2I5EA 3I0IX 2RJ1A 3OH4A 3I0DA 4B4BA 4EVWA 1HV9A 3I0HA 2NXVA 1H4DA 1XZ6A 1H7EA 2RJ7A 5C4FA 4MIXA 2ICXA 3N9WA 4O6MA 1PZTA 4O6NA 3OH0A 1H5SC 5C38A 5C47A 2YQHA 1EZIA 1TVYA 3QVBA 2P72A 2YCMA 2V0JA 1H5SB 4CJ8A 1WT3A 1VPAA 1R7TA 4DDZA 2RIXA 1ZJ3A 4BQHA 1HM8A 1H7QA 5CMIA 2WVMA 1LL0A 5C48A 5AJPA 5CMFX 5C3BA 5EIYA 4KC2A 1H5TB 2CU2A 1LZJA 5EJZA 3OC9A 2WVLA 5D91A 1HM0A 2VSHA 2C0NA 4M2BA 2Z87A 5CQNX 5DDVA 3V0PA 1WT2A 1WT0A 4NALA 3V8ZA 4Y9XA 4D11C 4FRHA 4Y7TA 1LL3A 4FRQA 4Q7CA 4KRVA 2RITA 1QGQA 1TZFA 3SXGA 1NMMB 4KT7A 4NANA 4B5BA 1W57A 2RJ6A 3RMVA 3GUEA 2A8UA 3HL3A 2XWLA 1NF5B 4FCUA 5FYEA 3RSBA 3V0QA 1H4EA 5IDTA 3OAMA 1GWWA 4ECMA 3I0CA 4AC3A 1H5RB 5FUHA 2V0LA 4B2WA 3I0EA 5JQQA 1ZJ0A 3KIAA 1YROB 1JYLA 1G93A 2AM5A 2FY7A 1IINA 4FRPA 4B2XA 1G1LA 1VGTA 2WGZA 4NAKA 5CQOA 1R7UA 4EEAA 1W77A 3Q80A 2YQSA 1NQIB 3I0LA 4Y62A 3V91A 3ZGFA 1FGGA 1H5RA 1G9RA 4EEMA 4ASYA 2PGVA 3CGXA 2RIZA 4XWIA 1FGXA 2JCKA 1ZJOA 1O0RA 2VSIA 2O1GA 4HO0A 1GWVA 1QGSA 1O7OA 3F1CA 4HO8A 3SX5A 2MZBA 3U2WA 1JVGA 4EEGA 3SXCA 5AJNA 2APCA 1FG5N 3U2TA 5DDTA 4ARWA 5HS2A 2ZU9A 5IFYA 2OI5A 5CQLX 4L41C 1VGZA 4P02A 1JVDA 2RJ0A 2E3DA 1ZCUA 3DJ4A 4Y63A 2X60A 1FR8A 3D8VA 3CKJA 1GQ9A 1VH3A 5CMGX 1WT1A 1NWGB 4UEGA 1V84A 2WE9A 3USRA 1JYKA 4IRQA 1WSZA 4IRPA 1LVWA 2JCJA 1S4PA 2DPWA 1FWYA 1VGUA 2XMEA 3SXDA 3SXEA 3I0JA 1Z90A 4FRMA 4K6RA 3DUVA 4Y7UA 1G8OA 4KNXA 3FWWA 2X5SA 2AESA 4HO6A 3SX3A 2FYBA 2XWMA 4HCQA 1V82A 3POLA 2YC5A 5CMHA 5IDSA 1ZJ1A 2Y4LA 1ON6A 4FRLA 1VICA 1ZI4A 1FZWA 1ZI1A 2XWNA 3TZTA 1NHEB 1H5SA 3T7NA 4D0TA 5L6SA 1MC3A 2RJ4A 3OGZA 1ZJ2A 1YP4A 3U0XA 1GQCA 1FR9A 1ZDGA 3V0NA 4R7PA 2W0WA 3ZF8A 3E25A 1ON8A 1H5TA 1G3LA 2JCOA 3PNNA 4DECA 3CKVA 5C1GA 2V0HA 3K8EA 4MNDA 3OH1A 1JV3A 2D7IA 2AH9A 4Y6UA 5FU8A 1JV1A 2VS4A 4G3QA 2PA4A 5C1LA 4FRBA 2UX8A 4Y64A 3T7OA 1QG8A 4KC4A 2VK9A 3E26A 1FOAA 3DK5A 1GX0A 1ZI5A 1VZXA 4LW3A 4LW6A 5FU0A 4Y6NA 3O3PA 1MP3A 3U2UA 1FXOA 1G23A 2VXLA 1IIMA 1GX4A 2FFUA 2OI7A 2YESA 5EJ1A 3K8DA 2BO6A 4P00A 2ICYA 1YP2A 3R2WA 4ASJA 3OH2A 2OEGA 2V0KA 1HJLA 2O1HA 3I0GA 5J49A 1SS9A 3CU0A 3USQA 1FO8A 2BO4A 3U0YA 1XHBA 1R7VA 4Y7GA 3BRKX 4FIXA 1VH1A 2YQCA 2X5ZA 3D98A 5C8RA 4EE5A 5CQMX 2P73A 4M28A 4B4GA 4HO2A 4EEOA 3FOQA 5D92A 1I52A 3IOIA 3SXBA 2Y4JA 2AM4A 1H7FA 4J18A 2AECA 5C3DA 4FRDA 4AAWA 4DE7A 4KNRA 2J0BA 1H4CA 3OKRA 5C3AA 5CMJA 4KPXA 3SXAA 3TQDA 1V83A 1HM9A 3ZLKA 2RJ5A 2WAWA 3V0LA 1G0RA 2Y6PA 4Y7VA 4D48A 1VGWA 2Z86A 4M2AA 2Y4MA 3CKQA 3PKQA 1S4OA 4KXOA 3ZGGA 1H7HA 5FTVA 4FRAA 4KC1A 2PX7A 1ZIZA 2I7BA 5C4DA 3ZLLA 3U2VA 2AM3A 4GBPA 1ZCTA 4BMAA 2XMHA 3CKOA 2AGDA 4HO4A 4Y7FA 4MYBA 4EE3A 5C36A 1LZ7A 1YP3A 4KPZA 1R7YA 1LL2A 4FQWA 4AYJA 3PKPA 2JCLA 4FIYA 2Y7AA 2FYAA 5I1FA 3Q4SA 5C1HA 1LZIA 2ZU7A 4B4MA 4G3PA 5FTSA 2ZU8A 2I5KA 2Q4JA
chains in the Genus database with same CATH topology
4CJCA 4FCEA 5BXCA 5FV9A 1VM8A 2RJ9A 4HG6A 4M4KA 3V0OA 1FO9A 1W55A 2D0JA 1R7XA 3SX8A 2FYCB 1GA8A 2PGYA 1LZ0A 2A8WA 5C49A 4NAIA 1H3MA 3EE5A 4JISA 2RJ8A 2GGQA 1S4NA 2E8BA 4G3SA 3I0KA 2D7RA 4FREA 4KQLA 2OEFA 3U2XA 1OMZA 4HOCA 1ZCYA 2YC3A 1R81A 1MP4A 2X65A 2FYDB 1TW5A 4B42A 1O7QA 1O23B 4HO5A 1K4VA 1NKHB 2BO7A 3SX7A 3Q7UA 1H7TA 5C4BA 1INIA 1FRWA 1OQMB 4D11A 1TW1A 4HO9A 3F1YA 3JUKA 5C4CA 2VS5A 1MP5A 4JD0A 2OI6A 2VS3A 1G97A 1HJJA 3R3IA 3V0MA 1FXJA 4B3UA 1G95A 3JTJA 1ZDFA 2O1FA 1ZHJA 1ZI3A 2VFZA 2VXMA 3CKNA 3I0FA 5CQPA 1ZJPA 1H7GA 1INJA 1OMXA 2Y4KA 3OH3A 2AE7A 2V0IA 2W0VA 1VZTA 3NGWA 4CVHA 1ZCVA 3BCVA 2GGOA 1R82A 5L6VA 2VD4A 1G2VA 3V90A 1QWJA 2WVKA 4D0ZA 4CJBA 5AJOA 4ZDQA 2P6WA 1PZYB 2QKXA 2WEEA 2FFVA 3IOJA 1H7LA 1EYRA 4HO3A 3JUJA 3RMWA 2J0AA 4YS8A 2QH5A 3SPTA 4C2SA 2RIYA 1WVCA 4EE4A 4AYLA 3IOHA 4G87A 3V8YA 1E5KA 1VZUA 1H5SD 2QGIA 2YQJA 3D5NA 3T7MA 1KWSA 4FROA 1R80A 3ST8A 2BO8A 4E1KA 5C4EA 3LW6A 2I5EA 3I0IX 2RJ1A 3OH4A 3I0DA 4B4BA 4EVWA 1HV9A 3I0HA 2NXVA 1H4DA 1XZ6A 1H7EA 2RJ7A 5C4FA 4MIXA 2ICXA 3N9WA 4O6MA 1PZTA 4O6NA 3OH0A 1H5SC 5C38A 5C47A 2YQHA 1EZIA 1TVYA 3QVBA 2P72A 2YCMA 2V0JA 1H5SB 4CJ8A 1WT3A 1VPAA 1R7TA 4DDZA 2RIXA 1ZJ3A 4BQHA 1HM8A 1H7QA 5CMIA 2WVMA 1LL0A 5C48A 5AJPA 5CMFX 5C3BA 5EIYA 4KC2A 1H5TB 2CU2A 1LZJA 5EJZA 3OC9A 2WVLA 5D91A 1HM0A 2VSHA 2C0NA 4M2BA 2Z87A 5CQNX 5DDVA 3V0PA 1WT2A 1WT0A 4NALA 3V8ZA 4Y9XA 4D11C 4FRHA 4Y7TA 1LL3A 4FRQA 4Q7CA 4KRVA 2RITA 1QGQA 1TZFA 3SXGA 1NMMB 4KT7A 4NANA 4B5BA 1W57A 2RJ6A 3RMVA 3GUEA 2A8UA 3HL3A 2XWLA 1NF5B 4FCUA 5FYEA 3RSBA 3V0QA 1H4EA 5IDTA 3OAMA 1GWWA 4ECMA 3I0CA 4AC3A 1H5RB 5FUHA 2V0LA 4B2WA 3I0EA 5JQQA 1ZJ0A 3KIAA 1YROB 1JYLA 1G93A 2AM5A 2FY7A 1IINA 4FRPA 4B2XA 1G1LA 1VGTA 2WGZA 4NAKA 5CQOA 1R7UA 4EEAA 1W77A 3Q80A 2YQSA 1NQIB 3I0LA 4Y62A 3V91A 3ZGFA 1FGGA 1H5RA 1G9RA 4EEMA 4ASYA 2PGVA 3CGXA 2RIZA 4XWIA 1FGXA 2JCKA 1ZJOA 1O0RA 2VSIA 2O1GA 4HO0A 1GWVA 1QGSA 1O7OA 3F1CA 4HO8A 3SX5A 2MZBA 3U2WA 1JVGA 4EEGA 3SXCA 5AJNA 2APCA 1FG5N 3U2TA 5DDTA 4ARWA 5HS2A 2ZU9A 5IFYA 2OI5A 5CQLX 4L41C 1VGZA 4P02A 1JVDA 2RJ0A 2E3DA 1ZCUA 3DJ4A 4Y63A 2X60A 1FR8A 3D8VA 3CKJA 1GQ9A 1VH3A 5CMGX 1WT1A 1NWGB 4UEGA 1V84A 2WE9A 3USRA 1JYKA 4IRQA 1WSZA 4IRPA 1LVWA 2JCJA 1S4PA 2DPWA 1FWYA 1VGUA 2XMEA 3SXDA 3SXEA 3I0JA 1Z90A 4FRMA 4K6RA 3DUVA 4Y7UA 1G8OA 4KNXA 3FWWA 2X5SA 2AESA 4HO6A 3SX3A 2FYBA 2XWMA 4HCQA 1V82A 3POLA 2YC5A 5CMHA 5IDSA 1ZJ1A 2Y4LA 1ON6A 4FRLA 1VICA 1ZI4A 1FZWA 1ZI1A 2XWNA 3TZTA 1NHEB 1H5SA 3T7NA 4D0TA 5L6SA 1MC3A 2RJ4A 3OGZA 1ZJ2A 1YP4A 3U0XA 1GQCA 1FR9A 1ZDGA 3V0NA 4R7PA 2W0WA 3ZF8A 3E25A 1ON8A 1H5TA 1G3LA 2JCOA 3PNNA 4DECA 3CKVA 5C1GA 2V0HA 3K8EA 4MNDA 3OH1A 1JV3A 2D7IA 2AH9A 4Y6UA 5FU8A 1JV1A 2VS4A 4G3QA 2PA4A 5C1LA 4FRBA 2UX8A 4Y64A 3T7OA 1QG8A 4KC4A 2VK9A 3E26A 1FOAA 3DK5A 1GX0A 1ZI5A 1VZXA 4LW3A 4LW6A 5FU0A 4Y6NA 3O3PA 1MP3A 3U2UA 1FXOA 1G23A 2VXLA 1IIMA 1GX4A 2FFUA 2OI7A 2YESA 5EJ1A 3K8DA 2BO6A 4P00A 2ICYA 1YP2A 3R2WA 4ASJA 3OH2A 2OEGA 2V0KA 1HJLA 2O1HA 3I0GA 5J49A 1SS9A 3CU0A 3USQA 1FO8A 2BO4A 3U0YA 1XHBA 1R7VA 4Y7GA 3BRKX 4FIXA 1VH1A 2YQCA 2X5ZA 3D98A 5C8RA 4EE5A 5CQMX 2P73A 4M28A 4B4GA 4HO2A 4EEOA 3FOQA 5D92A 1I52A 3IOIA 3SXBA 2Y4JA 2AM4A 1H7FA 4J18A 2AECA 5C3DA 4FRDA 4AAWA 4DE7A 4KNRA 2J0BA 1H4CA 3OKRA 5C3AA 5CMJA 4KPXA 3SXAA 3TQDA 1V83A 1HM9A 3ZLKA 2RJ5A 2WAWA 3V0LA 1G0RA 2Y6PA 4Y7VA 4D48A 1VGWA 2Z86A 4M2AA 2Y4MA 3CKQA 3PKQA 1S4OA 4KXOA 3ZGGA 1H7HA 5FTVA 4FRAA 4KC1A 2PX7A 1ZIZA 2I7BA 5C4DA 3ZLLA 3U2VA 2AM3A 4GBPA 1ZCTA 4BMAA 2XMHA 3CKOA 2AGDA 4HO4A 4Y7FA 4MYBA 4EE3A 5C36A 1LZ7A 1YP3A 4KPZA 1R7YA 1LL2A 4FQWA 4AYJA 3PKPA 2JCLA 4FIYA 2Y7AA 2FYAA 5I1FA 3Q4SA 5C1HA 1LZIA 2ZU7A 4B4MA 4G3PA 5FTSA 2ZU8A 2I5KA 2Q4JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CJC A;  4FCE A;  5BXC A;  5FV9 A;  1VM8 A;  2RJ9 A;  4HG6 A;  4M4K A;  3V0O A;  1FO9 A;  1W55 A;  2D0J A;  1R7X A;  3SX8 A;  2FYC B;  1GA8 A;  2PGY A;  1LZ0 A;  2A8W A;  5C49 A;  4NAI A;  1H3M A;  3EE5 A;  4JIS A;  2RJ8 A;  2GGQ A;  1S4N A;  2E8B A;  4G3S A;  3I0K A;  2D7R A;  4FRE A;  4KQL A;  2OEF A;  3U2X A;  1OMZ A;  4HOC A;  1ZCY A;  2YC3 A;  1R81 A;  1MP4 A;  2X65 A;  2FYD B;  1TW5 A;  4B42 A;  1O7Q A;  1O23 B;  4HO5 A;  1K4V A;  1NKH B;  2BO7 A;  3SX7 A;  3Q7U A;  1H7T A;  5C4B A;  1INI A;  1FRW A;  1OQM B;  4D11 A;  1TW1 A;  4HO9 A;  3F1Y A;  3JUK A;  5C4C A;  2VS5 A;  1MP5 A;  4JD0 A;  2OI6 A;  2VS3 A;  1G97 A;  1HJJ A;  3R3I A;  3V0M A;  1FXJ A;  4B3U A;  1G95 A;  3JTJ A;  1ZDF A;  2O1F A;  1ZHJ A;  1ZI3 A;  2VFZ A;  2VXM A;  3CKN A;  3I0F A;  5CQP A;  1ZJP A;  1H7G A;  1INJ A;  1OMX A;  2Y4K A;  3OH3 A;  2AE7 A;  2V0I A;  2W0V A;  1VZT A;  3NGW A;  4CVH A;  1ZCV A;  3BCV A;  2GGO A;  1R82 A;  5L6V A;  2VD4 A;  1G2V A;  3V90 A;  1QWJ A;  2WVK A;  4D0Z A;  4CJB A;  5AJO A;  4ZDQ A;  2P6W A;  1PZY B;  2QKX A;  2WEE A;  2FFV A;  3IOJ A;  1H7L A;  1EYR A;  4HO3 A;  3JUJ A;  3RMW A;  4YS8 A;  2QH5 A;  3SPT A;  4C2S A;  2RIY A;  1WVC A;  4EE4 A;  4AYL A;  3IOH A;  4G87 A;  3V8Y A;  1E5K A;  1VZU A;  1H5S D;  2QGI A;  2YQJ A;  3D5N A;  3T7M A;  1KWS A;  4FRO A;  1R80 A;  3ST8 A;  2BO8 A;  4E1K A;  5C4E A;  3LW6 A;  2I5E A;  3I0I X;  2RJ1 A;  3OH4 A;  3I0D A;  4B4B A;  4EVW A;  1HV9 A;  3I0H A;  2NXV A;  1H4D A;  1XZ6 A;  1H7E A;  2RJ7 A;  5C4F A;  2ICX A;  3N9W A;  1PZT A;  3OH0 A;  1H5S C;  5C38 A;  5C47 A;  2YQH A;  1EZI A;  1TVY A;  3QVB A;  2P72 A;  2YCM A;  2V0J A;  1H5S B;  4CJ8 A;  1WT3 A;  1VPA A;  1R7T A;  4DDZ A;  2RIX A;  1ZJ3 A;  4BQH A;  1HM8 A;  1H7Q A;  5CMI A;  2WVM A;  1LL0 A;  5C48 A;  5AJP A;  5CMF X;  5C3B A;  5EIY A;  4KC2 A;  1H5T B;  2CU2 A;  1LZJ A;  5EJZ A;  3OC9 A;  2WVL A;  1HM0 A;  2VSH A;  4M2B A;  2Z87 A;  5CQN X;  5DDV A;  3V0P A;  1WT2 A;  1WT0 A;  4NAL A;  3V8Z A;  4Y9X A;  4D11 C;  4FRH A;  4Y7T A;  1LL3 A;  4FRQ A;  4KRV A;  2RIT A;  1QGQ A;  1TZF A;  3SXG A;  1NMM B;  4KT7 A;  4NAN A;  4B5B A;  1W57 A;  2RJ6 A;  3RMV A;  3GUE A;  2A8U A;  3HL3 A;  2XWL A;  1NF5 B;  4FCU A;  5FYE A;  3RSB A;  3V0Q A;  1H4E A;  5IDT A;  3OAM A;  1GWW A;  4ECM A;  3I0C A;  4AC3 A;  1H5R B;  5FUH A;  2V0L A;  4B2W A;  3I0E A;  5JQQ A;  1ZJ0 A;  3KIA A;  1YRO B;  1JYL A;  1G93 A;  2AM5 A;  2FY7 A;  1IIN A;  4FRP A;  4B2X A;  1G1L A;  1VGT A;  2WGZ A;  4NAK A;  5CQO A;  1R7U A;  4EEA A;  1W77 A;  3Q80 A;  2YQS A;  1NQI B;  3I0L A;  4Y62 A;  3V91 A;  3ZGF A;  1FGG A;  1H5R A;  1G9R A;  4EEM A;  4ASY A;  2PGV A;  3CGX A;  2RIZ A;  4XWI A;  1FGX A;  2JCK A;  1ZJO A;  1O0R A;  2VSI A;  2O1G A;  4HO0 A;  1GWV A;  1QGS A;  1O7O A;  3F1C A;  4HO8 A;  3SX5 A;  2MZB A;  3U2W A;  1JVG A;  4EEG A;  3SXC A;  5AJN A;  2APC A;  1FG5 N;  3U2T A;  5DDT A;  4ARW A;  5HS2 A;  2ZU9 A;  5IFY A;  2OI5 A;  5CQL X;  4L41 C;  1VGZ A;  4P02 A;  1JVD A;  2RJ0 A;  2E3D A;  1ZCU A;  3DJ4 A;  4Y63 A;  2X60 A;  1FR8 A;  3D8V A;  3CKJ A;  1GQ9 A;  1VH3 A;  5CMG X;  1WT1 A;  1NWG B;  4UEG A;  1V84 A;  2WE9 A;  3USR A;  1JYK A;  4IRQ A;  1WSZ A;  4IRP A;  1LVW A;  2JCJ A;  1S4P A;  2DPW A;  1FWY A;  1VGU A;  2XME A;  3SXD A;  3SXE A;  3I0J A;  1Z90 A;  4FRM A;  4K6R A;  3DUV A;  4Y7U A;  1G8O A;  4KNX A;  3FWW A;  2X5S A;  2AES A;  4HO6 A;  3SX3 A;  2FYB A;  2XWM A;  4HCQ A;  1V82 A;  3POL A;  2YC5 A;  5CMH A;  5IDS A;  1ZJ1 A;  2Y4L A;  1ON6 A;  4FRL A;  1VIC A;  1ZI4 A;  1FZW A;  1ZI1 A;  2XWN A;  3TZT A;  1NHE B;  1H5S A;  3T7N A;  4D0T A;  5L6S A;  1MC3 A;  2RJ4 A;  3OGZ A;  1ZJ2 A;  1YP4 A;  3U0X A;  1GQC A;  1FR9 A;  1ZDG A;  3V0N A;  4R7P A;  2W0W A;  3ZF8 A;  3E25 A;  1ON8 A;  1H5T A;  1G3L A;  2JCO A;  3PNN A;  4DEC A;  3CKV A;  5C1G A;  2V0H A;  3K8E A;  4MND A;  3OH1 A;  1JV3 A;  2D7I A;  2AH9 A;  4Y6U A;  5FU8 A;  1JV1 A;  2VS4 A;  4G3Q A;  2PA4 A;  5C1L A;  4FRB A;  2UX8 A;  4Y64 A;  3T7O A;  1QG8 A;  4KC4 A;  3E26 A;  1FOA A;  3DK5 A;  1GX0 A;  1ZI5 A;  1VZX A;  4LW3 A;  4LW6 A;  5FU0 A;  4Y6N A;  3O3P A;  1MP3 A;  3U2U A;  1FXO A;  1G23 A;  2VXL A;  1IIM A;  1GX4 A;  2FFU A;  2OI7 A;  2YES A;  5EJ1 A;  3K8D A;  2BO6 A;  4P00 A;  2ICY A;  1YP2 A;  3R2W A;  4ASJ A;  3OH2 A;  2OEG A;  2V0K A;  1HJL A;  2O1H A;  3I0G A;  5J49 A;  1SS9 A;  3CU0 A;  3USQ A;  1FO8 A;  2BO4 A;  3U0Y A;  1XHB A;  1R7V A;  4Y7G A;  3BRK X;  1VH1 A;  2YQC A;  2X5Z A;  3D98 A;  5C8R A;  4EE5 A;  5CQM X;  2P73 A;  4M28 A;  4B4G A;  4HO2 A;  4EEO A;  3FOQ A;  1I52 A;  3IOI A;  3SXB A;  2Y4J A;  2AM4 A;  1H7F A;  4J18 A;  2AEC A;  5C3D A;  4FRD A;  4AAW A;  4DE7 A;  4KNR A;  1H4C A;  3OKR A;  5C3A A;  5CMJ A;  4KPX A;  3SXA A;  3TQD A;  1V83 A;  1HM9 A;  3ZLK A;  2RJ5 A;  2WAW A;  3V0L A;  1G0R A;  2Y6P A;  4Y7V A;  4D48 A;  1VGW A;  2Z86 A;  4M2A A;  2Y4M A;  3CKQ A;  3PKQ A;  1S4O A;  4KXO A;  3ZGG A;  1H7H A;  5FTV A;  4FRA A;  4KC1 A;  2PX7 A;  1ZIZ A;  2I7B A;  5C4D A;  3ZLL A;  3U2V A;  2AM3 A;  4GBP A;  1ZCT A;  4BMA A;  2XMH A;  3CKO A;  2AGD A;  4HO4 A;  4Y7F A;  4MYB A;  4EE3 A;  5C36 A;  1LZ7 A;  1YP3 A;  4KPZ A;  1R7Y A;  1LL2 A;  4FQW A;  4AYJ A;  3PKP A;  2JCL A;  2Y7A A;  2FYA A;  5I1F A;  3Q4S A;  5C1H A;  1LZI A;  2ZU7 A;  4B4M A;  4G3P A;  5FTS A;  2ZU8 A;  2I5K A;  2Q4J A; 
#chains in the Genus database with same CATH topology
 4CJC A;  4FCE A;  5BXC A;  5FV9 A;  1VM8 A;  2RJ9 A;  4HG6 A;  4M4K A;  3V0O A;  1FO9 A;  1W55 A;  2D0J A;  1R7X A;  3SX8 A;  2FYC B;  1GA8 A;  2PGY A;  1LZ0 A;  2A8W A;  5C49 A;  4NAI A;  1H3M A;  3EE5 A;  4JIS A;  2RJ8 A;  2GGQ A;  1S4N A;  2E8B A;  4G3S A;  3I0K A;  2D7R A;  4FRE A;  4KQL A;  2OEF A;  3U2X A;  1OMZ A;  4HOC A;  1ZCY A;  2YC3 A;  1R81 A;  1MP4 A;  2X65 A;  2FYD B;  1TW5 A;  4B42 A;  1O7Q A;  1O23 B;  4HO5 A;  1K4V A;  1NKH B;  2BO7 A;  3SX7 A;  3Q7U A;  1H7T A;  5C4B A;  1INI A;  1FRW A;  1OQM B;  4D11 A;  1TW1 A;  4HO9 A;  3F1Y A;  3JUK A;  5C4C A;  2VS5 A;  1MP5 A;  4JD0 A;  2OI6 A;  2VS3 A;  1G97 A;  1HJJ A;  3R3I A;  3V0M A;  1FXJ A;  4B3U A;  1G95 A;  3JTJ A;  1ZDF A;  2O1F A;  1ZHJ A;  1ZI3 A;  2VFZ A;  2VXM A;  3CKN A;  3I0F A;  5CQP A;  1ZJP A;  1H7G A;  1INJ A;  1OMX A;  2Y4K A;  3OH3 A;  2AE7 A;  2V0I A;  2W0V A;  1VZT A;  3NGW A;  4CVH A;  1ZCV A;  3BCV A;  2GGO A;  1R82 A;  5L6V A;  2VD4 A;  1G2V A;  3V90 A;  1QWJ A;  2WVK A;  4D0Z A;  4CJB A;  5AJO A;  4ZDQ A;  2P6W A;  1PZY B;  2QKX A;  2WEE A;  2FFV A;  3IOJ A;  1H7L A;  1EYR A;  4HO3 A;  3JUJ A;  3RMW A;  2J0A A;  4YS8 A;  2QH5 A;  3SPT A;  4C2S A;  2RIY A;  1WVC A;  4EE4 A;  4AYL A;  3IOH A;  4G87 A;  3V8Y A;  1E5K A;  1VZU A;  1H5S D;  2QGI A;  2YQJ A;  3D5N A;  3T7M A;  1KWS A;  4FRO A;  1R80 A;  3ST8 A;  2BO8 A;  4E1K A;  5C4E A;  3LW6 A;  2I5E A;  3I0I X;  2RJ1 A;  3OH4 A;  3I0D A;  4B4B A;  4EVW A;  1HV9 A;  3I0H A;  2NXV A;  1H4D A;  1XZ6 A;  1H7E A;  2RJ7 A;  5C4F A;  4MIX A;  2ICX A;  3N9W A;  4O6M A;  1PZT A;  4O6N A;  3OH0 A;  1H5S C;  5C38 A;  5C47 A;  2YQH A;  1EZI A;  1TVY A;  3QVB A;  2P72 A;  2YCM A;  2V0J A;  1H5S B;  4CJ8 A;  1WT3 A;  1VPA A;  1R7T A;  4DDZ A;  2RIX A;  1ZJ3 A;  4BQH A;  1HM8 A;  1H7Q A;  5CMI A;  2WVM A;  1LL0 A;  5C48 A;  5AJP A;  5CMF X;  5C3B A;  5EIY A;  4KC2 A;  1H5T B;  2CU2 A;  1LZJ A;  5EJZ A;  3OC9 A;  2WVL A;  5D91 A;  1HM0 A;  2VSH A;  2C0N A;  4M2B A;  2Z87 A;  5CQN X;  5DDV A;  3V0P A;  1WT2 A;  1WT0 A;  4NAL A;  3V8Z A;  4Y9X A;  4D11 C;  4FRH A;  4Y7T A;  1LL3 A;  4FRQ A;  4Q7C A;  4KRV A;  2RIT A;  1QGQ A;  1TZF A;  3SXG A;  1NMM B;  4KT7 A;  4NAN A;  4B5B A;  1W57 A;  2RJ6 A;  3RMV A;  3GUE A;  2A8U A;  3HL3 A;  2XWL A;  1NF5 B;  4FCU A;  5FYE A;  3RSB A;  3V0Q A;  1H4E A;  5IDT A;  3OAM A;  1GWW A;  4ECM A;  3I0C A;  4AC3 A;  1H5R B;  5FUH A;  2V0L A;  4B2W A;  3I0E A;  5JQQ A;  1ZJ0 A;  3KIA A;  1YRO B;  1JYL A;  1G93 A;  2AM5 A;  2FY7 A;  1IIN A;  4FRP A;  4B2X A;  1G1L A;  1VGT A;  2WGZ A;  4NAK A;  5CQO A;  1R7U A;  4EEA A;  1W77 A;  3Q80 A;  2YQS A;  1NQI B;  3I0L A;  4Y62 A;  3V91 A;  3ZGF A;  1FGG A;  1H5R A;  1G9R A;  4EEM A;  4ASY A;  2PGV A;  3CGX A;  2RIZ A;  4XWI A;  1FGX A;  2JCK A;  1ZJO A;  1O0R A;  2VSI A;  2O1G A;  4HO0 A;  1GWV A;  1QGS A;  1O7O A;  3F1C A;  4HO8 A;  3SX5 A;  2MZB A;  3U2W A;  1JVG A;  4EEG A;  3SXC A;  5AJN A;  2APC A;  1FG5 N;  3U2T A;  5DDT A;  4ARW A;  5HS2 A;  2ZU9 A;  5IFY A;  2OI5 A;  5CQL X;  4L41 C;  1VGZ A;  4P02 A;  1JVD A;  2RJ0 A;  2E3D A;  1ZCU A;  3DJ4 A;  4Y63 A;  2X60 A;  1FR8 A;  3D8V A;  3CKJ A;  1GQ9 A;  1VH3 A;  5CMG X;  1WT1 A;  1NWG B;  4UEG A;  1V84 A;  2WE9 A;  3USR A;  1JYK A;  4IRQ A;  1WSZ A;  4IRP A;  1LVW A;  2JCJ A;  1S4P A;  2DPW A;  1FWY A;  1VGU A;  2XME A;  3SXD A;  3SXE A;  3I0J A;  1Z90 A;  4FRM A;  4K6R A;  3DUV A;  4Y7U A;  1G8O A;  4KNX A;  3FWW A;  2X5S A;  2AES A;  4HO6 A;  3SX3 A;  2FYB A;  2XWM A;  4HCQ A;  1V82 A;  3POL A;  2YC5 A;  5CMH A;  5IDS A;  1ZJ1 A;  2Y4L A;  1ON6 A;  4FRL A;  1VIC A;  1ZI4 A;  1FZW A;  1ZI1 A;  2XWN A;  3TZT A;  1NHE B;  1H5S A;  3T7N A;  4D0T A;  5L6S A;  1MC3 A;  2RJ4 A;  3OGZ A;  1ZJ2 A;  1YP4 A;  3U0X A;  1GQC A;  1FR9 A;  1ZDG A;  3V0N A;  4R7P A;  2W0W A;  3ZF8 A;  3E25 A;  1ON8 A;  1H5T A;  1G3L A;  2JCO A;  3PNN A;  4DEC A;  3CKV A;  5C1G A;  2V0H A;  3K8E A;  4MND A;  3OH1 A;  1JV3 A;  2D7I A;  2AH9 A;  4Y6U A;  5FU8 A;  1JV1 A;  2VS4 A;  4G3Q A;  2PA4 A;  5C1L A;  4FRB A;  2UX8 A;  4Y64 A;  3T7O A;  1QG8 A;  4KC4 A;  2VK9 A;  3E26 A;  1FOA A;  3DK5 A;  1GX0 A;  1ZI5 A;  1VZX A;  4LW3 A;  4LW6 A;  5FU0 A;  4Y6N A;  3O3P A;  1MP3 A;  3U2U A;  1FXO A;  1G23 A;  2VXL A;  1IIM A;  1GX4 A;  2FFU A;  2OI7 A;  2YES A;  5EJ1 A;  3K8D A;  2BO6 A;  4P00 A;  2ICY A;  1YP2 A;  3R2W A;  4ASJ A;  3OH2 A;  2OEG A;  2V0K A;  1HJL A;  2O1H A;  3I0G A;  5J49 A;  1SS9 A;  3CU0 A;  3USQ A;  1FO8 A;  2BO4 A;  3U0Y A;  1XHB A;  1R7V A;  4Y7G A;  3BRK X;  4FIX A;  1VH1 A;  2YQC A;  2X5Z A;  3D98 A;  5C8R A;  4EE5 A;  5CQM X;  2P73 A;  4M28 A;  4B4G A;  4HO2 A;  4EEO A;  3FOQ A;  5D92 A;  1I52 A;  3IOI A;  3SXB A;  2Y4J A;  2AM4 A;  1H7F A;  4J18 A;  2AEC A;  5C3D A;  4FRD A;  4AAW A;  4DE7 A;  4KNR A;  2J0B A;  1H4C A;  3OKR A;  5C3A A;  5CMJ A;  4KPX A;  3SXA A;  3TQD A;  1V83 A;  1HM9 A;  3ZLK A;  2RJ5 A;  2WAW A;  3V0L A;  1G0R A;  2Y6P A;  4Y7V A;  4D48 A;  1VGW A;  2Z86 A;  4M2A A;  2Y4M A;  3CKQ A;  3PKQ A;  1S4O A;  4KXO A;  3ZGG A;  1H7H A;  5FTV A;  4FRA A;  4KC1 A;  2PX7 A;  1ZIZ A;  2I7B A;  5C4D A;  3ZLL A;  3U2V A;  2AM3 A;  4GBP A;  1ZCT A;  4BMA A;  2XMH A;  3CKO A;  2AGD A;  4HO4 A;  4Y7F A;  4MYB A;  4EE3 A;  5C36 A;  1LZ7 A;  1YP3 A;  4KPZ A;  1R7Y A;  1LL2 A;  4FQW A;  4AYJ A;  3PKP A;  2JCL A;  4FIY A;  2Y7A A;  2FYA A;  5I1F A;  3Q4S A;  5C1H A;  1LZI A;  2ZU7 A;  4B4M A;  4G3P A;  5FTS A;  2ZU8 A;  2I5K A;  2Q4J A; 
#chains in the Genus database with same CATH homology
 4CJC A;  4FCE A;  5BXC A;  5FV9 A;  1VM8 A;  2RJ9 A;  4HG6 A;  4M4K A;  3V0O A;  1FO9 A;  1W55 A;  2D0J A;  1R7X A;  3SX8 A;  2FYC B;  1GA8 A;  2PGY A;  1LZ0 A;  2A8W A;  5C49 A;  4NAI A;  1H3M A;  3EE5 A;  4JIS A;  2RJ8 A;  2GGQ A;  1S4N A;  2E8B A;  4G3S A;  3I0K A;  2D7R A;  4FRE A;  4KQL A;  2OEF A;  3U2X A;  1OMZ A;  4HOC A;  1ZCY A;  2YC3 A;  1R81 A;  1MP4 A;  2X65 A;  2FYD B;  1TW5 A;  4B42 A;  1O7Q A;  1O23 B;  4HO5 A;  1K4V A;  1NKH B;  2BO7 A;  3SX7 A;  3Q7U A;  1H7T A;  5C4B A;  1INI A;  1FRW A;  1OQM B;  4D11 A;  1TW1 A;  4HO9 A;  3F1Y A;  3JUK A;  5C4C A;  2VS5 A;  1MP5 A;  4JD0 A;  2OI6 A;  2VS3 A;  1G97 A;  1HJJ A;  3R3I A;  3V0M A;  1FXJ A;  4B3U A;  1G95 A;  3JTJ A;  1ZDF A;  2O1F A;  1ZHJ A;  1ZI3 A;  2VFZ A;  2VXM A;  3CKN A;  3I0F A;  5CQP A;  1ZJP A;  1H7G A;  1INJ A;  1OMX A;  2Y4K A;  3OH3 A;  2AE7 A;  2V0I A;  2W0V A;  1VZT A;  3NGW A;  4CVH A;  1ZCV A;  3BCV A;  2GGO A;  1R82 A;  5L6V A;  2VD4 A;  1G2V A;  3V90 A;  1QWJ A;  2WVK A;  4D0Z A;  4CJB A;  5AJO A;  4ZDQ A;  2P6W A;  1PZY B;  2QKX A;  2WEE A;  2FFV A;  3IOJ A;  1H7L A;  1EYR A;  4HO3 A;  3JUJ A;  3RMW A;  2J0A A;  4YS8 A;  2QH5 A;  3SPT A;  4C2S A;  2RIY A;  1WVC A;  4EE4 A;  4AYL A;  3IOH A;  4G87 A;  3V8Y A;  1E5K A;  1VZU A;  1H5S D;  2QGI A;  2YQJ A;  3D5N A;  3T7M A;  1KWS A;  4FRO A;  1R80 A;  3ST8 A;  2BO8 A;  4E1K A;  5C4E A;  3LW6 A;  2I5E A;  3I0I X;  2RJ1 A;  3OH4 A;  3I0D A;  4B4B A;  4EVW A;  1HV9 A;  3I0H A;  2NXV A;  1H4D A;  1XZ6 A;  1H7E A;  2RJ7 A;  5C4F A;  4MIX A;  2ICX A;  3N9W A;  4O6M A;  1PZT A;  4O6N A;  3OH0 A;  1H5S C;  5C38 A;  5C47 A;  2YQH A;  1EZI A;  1TVY A;  3QVB A;  2P72 A;  2YCM A;  2V0J A;  1H5S B;  4CJ8 A;  1WT3 A;  1VPA A;  1R7T A;  4DDZ A;  2RIX A;  1ZJ3 A;  4BQH A;  1HM8 A;  1H7Q A;  5CMI A;  2WVM A;  1LL0 A;  5C48 A;  5AJP A;  5CMF X;  5C3B A;  5EIY A;  4KC2 A;  1H5T B;  2CU2 A;  1LZJ A;  5EJZ A;  3OC9 A;  2WVL A;  5D91 A;  1HM0 A;  2VSH A;  2C0N A;  4M2B A;  2Z87 A;  5CQN X;  5DDV A;  3V0P A;  1WT2 A;  1WT0 A;  4NAL A;  3V8Z A;  4Y9X A;  4D11 C;  4FRH A;  4Y7T A;  1LL3 A;  4FRQ A;  4Q7C A;  4KRV A;  2RIT A;  1QGQ A;  1TZF A;  3SXG A;  1NMM B;  4KT7 A;  4NAN A;  4B5B A;  1W57 A;  2RJ6 A;  3RMV A;  3GUE A;  2A8U A;  3HL3 A;  2XWL A;  1NF5 B;  4FCU A;  5FYE A;  3RSB A;  3V0Q A;  1H4E A;  5IDT A;  3OAM A;  1GWW A;  4ECM A;  3I0C A;  4AC3 A;  1H5R B;  5FUH A;  2V0L A;  4B2W A;  3I0E A;  5JQQ A;  1ZJ0 A;  3KIA A;  1YRO B;  1JYL A;  1G93 A;  2AM5 A;  2FY7 A;  1IIN A;  4FRP A;  4B2X A;  1G1L A;  1VGT A;  2WGZ A;  4NAK A;  5CQO A;  1R7U A;  4EEA A;  1W77 A;  3Q80 A;  2YQS A;  1NQI B;  3I0L A;  4Y62 A;  3V91 A;  3ZGF A;  1FGG A;  1H5R A;  1G9R A;  4EEM A;  4ASY A;  2PGV A;  3CGX A;  2RIZ A;  4XWI A;  1FGX A;  2JCK A;  1ZJO A;  1O0R A;  2VSI A;  2O1G A;  4HO0 A;  1GWV A;  1QGS A;  1O7O A;  3F1C A;  4HO8 A;  3SX5 A;  2MZB A;  3U2W A;  1JVG A;  4EEG A;  3SXC A;  5AJN A;  2APC A;  1FG5 N;  3U2T A;  5DDT A;  4ARW A;  5HS2 A;  2ZU9 A;  5IFY A;  2OI5 A;  5CQL X;  4L41 C;  1VGZ A;  4P02 A;  1JVD A;  2RJ0 A;  2E3D A;  1ZCU A;  3DJ4 A;  4Y63 A;  2X60 A;  1FR8 A;  3D8V A;  3CKJ A;  1GQ9 A;  1VH3 A;  5CMG X;  1WT1 A;  1NWG B;  4UEG A;  1V84 A;  2WE9 A;  3USR A;  1JYK A;  4IRQ A;  1WSZ A;  4IRP A;  1LVW A;  2JCJ A;  1S4P A;  2DPW A;  1FWY A;  1VGU A;  2XME A;  3SXD A;  3SXE A;  3I0J A;  1Z90 A;  4FRM A;  4K6R A;  3DUV A;  4Y7U A;  1G8O A;  4KNX A;  3FWW A;  2X5S A;  2AES A;  4HO6 A;  3SX3 A;  2FYB A;  2XWM A;  4HCQ A;  1V82 A;  3POL A;  2YC5 A;  5CMH A;  5IDS A;  1ZJ1 A;  2Y4L A;  1ON6 A;  4FRL A;  1VIC A;  1ZI4 A;  1FZW A;  1ZI1 A;  2XWN A;  3TZT A;  1NHE B;  1H5S A;  3T7N A;  4D0T A;  5L6S A;  1MC3 A;  2RJ4 A;  3OGZ A;  1ZJ2 A;  1YP4 A;  3U0X A;  1GQC A;  1FR9 A;  1ZDG A;  3V0N A;  4R7P A;  2W0W A;  3ZF8 A;  3E25 A;  1ON8 A;  1H5T A;  1G3L A;  2JCO A;  3PNN A;  4DEC A;  3CKV A;  5C1G A;  2V0H A;  3K8E A;  4MND A;  3OH1 A;  1JV3 A;  2D7I A;  2AH9 A;  4Y6U A;  5FU8 A;  1JV1 A;  2VS4 A;  4G3Q A;  2PA4 A;  5C1L A;  4FRB A;  2UX8 A;  4Y64 A;  3T7O A;  1QG8 A;  4KC4 A;  2VK9 A;  3E26 A;  1FOA A;  3DK5 A;  1GX0 A;  1ZI5 A;  1VZX A;  4LW3 A;  4LW6 A;  5FU0 A;  4Y6N A;  3O3P A;  1MP3 A;  3U2U A;  1FXO A;  1G23 A;  2VXL A;  1IIM A;  1GX4 A;  2FFU A;  2OI7 A;  2YES A;  5EJ1 A;  3K8D A;  2BO6 A;  4P00 A;  2ICY A;  1YP2 A;  3R2W A;  4ASJ A;  3OH2 A;  2OEG A;  2V0K A;  1HJL A;  2O1H A;  3I0G A;  5J49 A;  1SS9 A;  3CU0 A;  3USQ A;  1FO8 A;  2BO4 A;  3U0Y A;  1XHB A;  1R7V A;  4Y7G A;  3BRK X;  4FIX A;  1VH1 A;  2YQC A;  2X5Z A;  3D98 A;  5C8R A;  4EE5 A;  5CQM X;  2P73 A;  4M28 A;  4B4G A;  4HO2 A;  4EEO A;  3FOQ A;  5D92 A;  1I52 A;  3IOI A;  3SXB A;  2Y4J A;  2AM4 A;  1H7F A;  4J18 A;  2AEC A;  5C3D A;  4FRD A;  4AAW A;  4DE7 A;  4KNR A;  2J0B A;  1H4C A;  3OKR A;  5C3A A;  5CMJ A;  4KPX A;  3SXA A;  3TQD A;  1V83 A;  1HM9 A;  3ZLK A;  2RJ5 A;  2WAW A;  3V0L A;  1G0R A;  2Y6P A;  4Y7V A;  4D48 A;  1VGW A;  2Z86 A;  4M2A A;  2Y4M A;  3CKQ A;  3PKQ A;  1S4O A;  4KXO A;  3ZGG A;  1H7H A;  5FTV A;  4FRA A;  4KC1 A;  2PX7 A;  1ZIZ A;  2I7B A;  5C4D A;  3ZLL A;  3U2V A;  2AM3 A;  4GBP A;  1ZCT A;  4BMA A;  2XMH A;  3CKO A;  2AGD A;  4HO4 A;  4Y7F A;  4MYB A;  4EE3 A;  5C36 A;  1LZ7 A;  1YP3 A;  4KPZ A;  1R7Y A;  1LL2 A;  4FQW A;  4AYJ A;  3PKP A;  2JCL A;  4FIY A;  2Y7A A;  2FYA A;  5I1F A;  3Q4S A;  5C1H A;  1LZI A;  2ZU7 A;  4B4M A;  4G3P A;  5FTS A;  2ZU8 A;  2I5K A;  2Q4J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...