1G3LA

The structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (rmla). tdp-l-rhamnose complex.
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
292
structure length
292
Chain Sequence
KRKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLGSASQRQTGASVFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIATLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLLTETVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
publication title The structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (RmlA).
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 100
structure length 292
sequence length 292
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.24: Glucose-1-phosphate thymidylyltransferase.
pdb deposition date 2000-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1g3lA00
1INIA 2WVMA 5C4DA 4E1KA 4HOCA 1H7LA 3I0HA 2VSIA 4DE7A 1EZIA 1HM9A 4HO8A 2Y4MA 2VS4A 3Q80A 2GGOA 3U2TA 2PGYA 5C47A 4JD0A 1YP3A 2AE7A 1ZCTA 1ZJ0A 1H5SA 1ZHJA 4B2WA 3IOJA 5C1LA 4HO5A 2D7RA 2X5SA 1W55A 2RJ1A 2QKXA 4KT7A 3OH4A 5C4EA 2AGDA 3USRA 3V0NA 4Y6UA 5J49A 1G23A 2AECA 3CKNA 4KPZA 1XZ6A 1YP2A 5BXCA 2MZBA 1O7QA 4EEGA 2ICYA 3V90A 5C3DA 3GUEA 4Y7FA 3SXGA 2Q4JA 3Q4SA 1GQ9A 5JQQA 1FO8A 1FZWA 5HS2A 1H5SB 3ZLLA 1H4DA 2FYDB 3ZLKA 4IRPA 1OMXA 1QGQA 1G95A 1NWGB 1TW5A 3RMWA 4C2SA 5L6VA 4FRDA 4FRBA 1JVGA 2RJ9A 1NHEB 3BCVA 1INJA 2PA4A 1VGTA 1R7VA 1FRWA 4B3UA 3U2XA 5L6SA 3I0JA 4MYBA 1VGZA 3OH0A 3IOHA 3ZF8A 1JV1A 2BO4A 2FFUA 1IINA 4NAKA 1JYLA 2JCOA 3NGWA 5CMJA 4FRAA 1HV9A 3SXBA 2WE9A 2WVLA 4EEMA 2V0HA 1W57A 5EJ1A 3SPTA 1ZIZA 1HJJA 3I0DA 4P00A 1MP3A 5FTSA 4B42A 4ECMA 4AAWA 1ZJ1A 3SXDA 1K4VA 1MP4A 3EE5A 1S4NA 2OI5A 4G87A 2RJ5A 2V0IA 4KNXA 5CQPA 4HO2A 5C3AA 2V0LA 3U2VA 2CU2A 1ZCYA 4HO0A 1EYRA 3ZGGA 2ZU9A 1H5SD 1LZJA 4EEAA 2VXMA 3I0LA 4B4BA 2APCA 2O1HA 4FRPA 2O1FA 1WT0A 1HJLA 2XWNA 4L41C 3USQA 4AC3A 4J18A 2YC5A 5C1GA 1VZUA 1ZCVA 3T7MA 1OQMB 5FV9A 4KNRA 4M2BA 4ASJA 2ZU8A 5C48A 2P73A 3SX3A 2XMHA 4KQLA 2WEEA 5EJZA 4M2AA 1JV3A 3HL3A 1VPAA 5DDVA 3OH2A 4KC1A 1H7HA 4FRHA 1H7FA 3CU0A 1VH3A 1FXJA 2OI7A 1TW1A 4HCQA 5C8RA 4Y62A 4HO9A 2RIXA 2P6WA 3O3PA 4R7PA 2Y4JA 5AJPA 1NMMB 3SX5A 3FOQA 1QG8A 1H5SC 4NAIA 4CJBA 4ZDQA 1ZJOA 1G3LA 5C4FA 1VZTA 2AM3A 4XWIA 3SXCA 3TZTA 3U2UA 3F1YA 2VSHA 2A8UA 1WVCA 2D0JA 4CJ8A 1H4EA 1G8OA 1GWVA 5C49A 2XWLA 3DUVA 4EE4A 2E8BA 4CVHA 3JTJA 3DK5A 1G0RA 1ZJ2A 4NANA 4D11A 1H5RA 1R82A 3SX8A 3E25A 5EIYA 5CMIA 2Y6PA 4D11C 1R7XA 3U2WA 1S4PA 2Z87A 4DDZA 1GX4A 1TZFA 4FRMA 4EVWA 2QH5A 1H5TA 1H5RB 4KXOA 2P72A 2ZU7A 4JISA 2Y4KA 3PKQA 3I0EA 4HO6A 3U0XA 3Q7UA 2JCJA 5FU8A 3POLA 4Y6NA 1H7EA 1NQIB 1ZI3A 1VH1A 1LVWA 5C36A 1H5TB 5IDTA 1ZI5A 2OEGA 3T7NA 1WT1A 2X5ZA 2RIZA 4G3SA 5C3BA 2Z86A 4HO4A 1R81A 4Y9XA 2X65A 1HM0A 2PX7A 4UEGA 3V0PA 2RIYA 2YCMA 3K8EA 1G9RA 2V0JA 1JVDA 4NALA 2FYBA 3E26A 3BRKX 5CMHA 3OAMA 1FOAA 4HG6A 2WGZA 5FYEA 3QVBA 3CKOA 3KIAA 4AYJA 1O0RA 4D0TA 1WT2A 4Y7UA 1SS9A 5IFYA 1XHBA 1R7YA 3I0KA 1ZI4A 1FG5N 5CQMX 1LL2A 3R2WA 2FYCB 3I0IX 1GA8A 2W0VA 1GQCA 3JUKA 2RITA 5CQOA 1FXOA 4Y63A 2E3DA 1LL0A 3T7OA 1FGGA 5FUHA 2UX8A 3LW6A 4FCUA 2YQCA 2Y7AA 4M28A 2RJ8A 3D98A 3OGZA 1FR9A 1ZDFA 5AJNA 2AH9A 4M4KA 5AJOA 2X60A 1ZDGA 3ZGFA 2D7IA 3OC9A 1FWYA 1VICA 4YS8A 1LL3A 1PZYB 1LZIA 2Y4LA 4LW3A 1Z90A 4MNDA 3CKQA 2AESA 3CGXA 1H7GA 3PKPA 4GBPA 1GX0A 2YQHA 1KWSA 3IOIA 1R7UA 2PGVA 2RJ6A 4G3QA 4EE5A 2I5KA 1NF5B 3SXAA 4BQHA 4FCEA 4KPXA 5C1HA 1I52A 1R7TA 1MC3A 4K6RA 4G3PA 1NKHB 3K8DA 1V84A 2VD4A 3RMVA 4Y7GA 2GGQA 3U0YA 1H3MA 1VGUA 3CKVA 1V82A 1V83A 4B4MA 2VS5A 1ZJPA 4EEOA 3D8VA 1H7TA 3V0LA 4D48A 1VGWA 3SXEA 1H4CA 4B5BA 4FROA 4FREA 1VZXA 2WVKA 3JUJA 4KC4A 2XMEA 3OKRA 5FTVA 1JYKA 3I0FA 1ZJ3A 3V0OA 3D5NA 2BO6A 2RJ0A 1ZI1A 3N9WA 5CMFX 1GWWA 2A8WA 2VFZA 5CQNX 1ON6A 2FY7A 1H7QA 1VM8A 2YESA 4LW6A 2FYAA 5CMGX 2VXLA 3PNNA 5DDTA 1YROB 3I0CA 1FO9A 2RJ7A 4D0ZA 1TVYA 2AM4A 3V8YA 3OH1A 4P02A 4EE3A 4FRQA 4HO3A 3FWWA 1QGSA 3R3IA 1G97A 1MP5A 5FU0A 4B4GA 1WT3A 2ICXA 3CKJA 2I7BA 5C4BA 4FRLA 4B2XA 1G1LA 1OMZA 1E5KA 5IDSA 2OEFA 1W77A 4KC2A 3DJ4A 4ASYA 5C38A 2RJ4A 1S4OA 4Y7TA 1R80A 1QWJA 2WAWA 3V8ZA 4IRQA 1WSZA 3RSBA 5CQLX 4FQWA 4KRVA 2O1GA 1LZ0A 1ON8A 2YQSA 2QGIA 5I1FA 1G2VA 4Y64A 1G93A 3V91A 5C4CA 2XWMA 4ARWA 3ST8A 1FGXA 3I0GA 2JCKA 2AM5A 1ZCUA 3OH3A 2YQJA 2V0KA 3F1CA 2YC3A 1HM8A 3TQDA 1LZ7A 3V0QA 2BO7A 1FR8A 1O23B 1O7OA 3V0MA 2I5EA 3SX7A 2W0WA 1YP4A 2BO8A 2NXVA 2FFVA 1PZTA 4Y7VA 4CJCA 4BMAA 2DPWA 2JCLA 1IIMA 2OI6A 4AYLA 4DECA 2VS3A
chains in the Genus database with same CATH superfamily
1INIA 2WVMA 5C4DA 4E1KA 4HOCA 1H7LA 3I0HA 2VSIA 4DE7A 1EZIA 1HM9A 4HO8A 2Y4MA 2VS4A 3Q80A 2GGOA 3U2TA 2PGYA 5C47A 4JD0A 1YP3A 2AE7A 1ZCTA 1ZJ0A 1H5SA 1ZHJA 4B2WA 3IOJA 5C1LA 4HO5A 2D7RA 2X5SA 1W55A 2RJ1A 2QKXA 4KT7A 3OH4A 5C4EA 2AGDA 3USRA 3V0NA 4Y6UA 5J49A 1G23A 2AECA 3CKNA 4KPZA 1XZ6A 1YP2A 5BXCA 2MZBA 1O7QA 4EEGA 2ICYA 3V90A 5C3DA 3GUEA 4Y7FA 3SXGA 2Q4JA 3Q4SA 1GQ9A 5JQQA 1FO8A 1FZWA 5HS2A 1H5SB 3ZLLA 1H4DA 2FYDB 3ZLKA 4IRPA 1OMXA 1QGQA 1G95A 1NWGB 1TW5A 3RMWA 4C2SA 5L6VA 4FRDA 4FRBA 1JVGA 2RJ9A 1NHEB 3BCVA 1INJA 2PA4A 1VGTA 1R7VA 1FRWA 4B3UA 3U2XA 5L6SA 3I0JA 4MYBA 1VGZA 3OH0A 3IOHA 3ZF8A 1JV1A 2BO4A 2FFUA 1IINA 4NAKA 1JYLA 2JCOA 3NGWA 5CMJA 4FRAA 1HV9A 3SXBA 2WE9A 2WVLA 4EEMA 2V0HA 1W57A 5EJ1A 3SPTA 1ZIZA 1HJJA 3I0DA 4P00A 1MP3A 5FTSA 4B42A 4ECMA 4AAWA 1ZJ1A 3SXDA 1K4VA 1MP4A 3EE5A 1S4NA 2OI5A 4G87A 2RJ5A 2V0IA 4KNXA 5CQPA 4HO2A 5C3AA 2V0LA 3U2VA 2CU2A 1ZCYA 4HO0A 1EYRA 3ZGGA 2ZU9A 1H5SD 1LZJA 4FIXA 4EEAA 2VXMA 2J0AA 3I0LA 4B4BA 2APCA 2O1HA 4FRPA 2O1FA 1WT0A 1HJLA 2XWNA 4L41C 3USQA 4AC3A 4J18A 2YC5A 5C1GA 1VZUA 1ZCVA 3T7MA 1OQMB 5FV9A 4KNRA 4M2BA 4ASJA 2ZU8A 5C48A 2P73A 3SX3A 2XMHA 4KQLA 2WEEA 5EJZA 4M2AA 1JV3A 3HL3A 4MIXA 1VPAA 5DDVA 3OH2A 4KC1A 1H7HA 2J0BA 1H7FA 3CU0A 4FRHA 1VH3A 1FXJA 2OI7A 1TW1A 4HCQA 5C8RA 4Y62A 4HO9A 2RIXA 2P6WA 3O3PA 2C0NA 2VK9A 4O6NA 2Y4JA 4R7PA 5AJPA 1NMMB 3SX5A 3FOQA 1QG8A 1H5SC 4NAIA 4CJBA 4ZDQA 1ZJOA 1G3LA 5C4FA 1VZTA 2AM3A 4XWIA 3SXCA 3TZTA 3U2UA 5D92A 3F1YA 2VSHA 2A8UA 1WVCA 2D0JA 4CJ8A 5D91A 1H4EA 1G8OA 1GWVA 5C49A 2XWLA 3DUVA 4EE4A 2E8BA 4CVHA 3JTJA 3DK5A 1G0RA 1ZJ2A 4NANA 4D11A 1H5RA 1R82A 3SX8A 3E25A 5EIYA 5CMIA 2Y6PA 4D11C 1R7XA 3U2WA 1S4PA 2Z87A 4DDZA 1GX4A 1TZFA 4FRMA 4EVWA 2QH5A 1H5TA 1H5RB 4KXOA 2P72A 2ZU7A 4JISA 2Y4KA 3PKQA 3I0EA 4HO6A 3U0XA 3Q7UA 2JCJA 5FU8A 3POLA 4Y6NA 1H7EA 1NQIB 1ZI3A 1VH1A 1LVWA 5C36A 1H5TB 5IDTA 1ZI5A 2OEGA 3T7NA 1WT1A 2X5ZA 2RIZA 4G3SA 5C3BA 2Z86A 4HO4A 1R81A 4Y9XA 2X65A 1HM0A 2PX7A 4UEGA 3V0PA 2RIYA 2YCMA 3K8EA 1G9RA 2V0JA 1JVDA 4NALA 2FYBA 3E26A 3BRKX 5CMHA 3OAMA 1FOAA 4HG6A 2WGZA 5FYEA 3QVBA 3CKOA 3KIAA 4AYJA 1O0RA 4D0TA 1WT2A 4Y7UA 1SS9A 5IFYA 1XHBA 1R7YA 3I0KA 1ZI4A 1FG5N 5CQMX 1LL2A 3R2WA 2FYCB 3I0IX 1GA8A 2W0VA 1GQCA 3JUKA 2RITA 5CQOA 1FXOA 4Y63A 2E3DA 1LL0A 3T7OA 1FGGA 5FUHA 2UX8A 3LW6A 4FCUA 2YQCA 4O6MA 2Y7AA 4M28A 2RJ8A 3D98A 3OGZA 1FR9A 1ZDFA 5AJNA 2AH9A 4M4KA 5AJOA 2X60A 1ZDGA 3ZGFA 2D7IA 3OC9A 1FWYA 1VICA 4YS8A 1LL3A 1PZYB 1LZIA 2Y4LA 4LW3A 1Z90A 4MNDA 3CKQA 2AESA 3CGXA 1H7GA 3PKPA 4Q7CA 4GBPA 1GX0A 2YQHA 1KWSA 3IOIA 1R7UA 2PGVA 2RJ6A 4G3QA 4EE5A 2I5KA 1NF5B 3SXAA 4BQHA 4FCEA 4KPXA 5C1HA 1I52A 1R7TA 1MC3A 4K6RA 4G3PA 1NKHB 3K8DA 1V84A 2VD4A 3RMVA 4Y7GA 2GGQA 3U0YA 1H3MA 1VGUA 3CKVA 1V82A 1V83A 4B4MA 2VS5A 1ZJPA 4EEOA 3D8VA 4FIYA 1H7TA 3V0LA 4D48A 1VGWA 3SXEA 1H4CA 4B5BA 4FROA 4FREA 1VZXA 2WVKA 3JUJA 4KC4A 2XMEA 3OKRA 5FTVA 1JYKA 3I0FA 1ZJ3A 3V0OA 3D5NA 2BO6A 2RJ0A 1ZI1A 3N9WA 5CMFX 1GWWA 2A8WA 2VFZA 5CQNX 1ON6A 2FY7A 1H7QA 1VM8A 2YESA 4LW6A 2FYAA 5CMGX 2VXLA 3PNNA 5DDTA 1YROB 3I0CA 1FO9A 2RJ7A 4D0ZA 1TVYA 2AM4A 3V8YA 3OH1A 4P02A 4EE3A 4FRQA 4HO3A 3FWWA 1QGSA 3R3IA 1G97A 1MP5A 5FU0A 4B4GA 1WT3A 2ICXA 3CKJA 2I7BA 5C4BA 4FRLA 4B2XA 1G1LA 1OMZA 1E5KA 5IDSA 2OEFA 1W77A 4KC2A 3DJ4A 4ASYA 5C38A 2RJ4A 1S4OA 4Y7TA 1R80A 1QWJA 2WAWA 3V8ZA 4IRQA 1WSZA 3RSBA 5CQLX 4FQWA 4KRVA 2O1GA 1LZ0A 1ON8A 2YQSA 2QGIA 5I1FA 1G2VA 4Y64A 1G93A 3V91A 5C4CA 2XWMA 4ARWA 3ST8A 1FGXA 3I0GA 2JCKA 2AM5A 1ZCUA 3OH3A 2YQJA 2V0KA 3F1CA 2YC3A 1HM8A 3TQDA 1LZ7A 3V0QA 2BO7A 1FR8A 1O23B 1O7OA 3V0MA 2I5EA 3SX7A 2W0WA 1YP4A 2BO8A 2NXVA 2FFVA 1PZTA 4Y7VA 4CJCA 4BMAA 2DPWA 2JCLA 1IIMA 2OI6A 4AYLA 4DECA 2VS3A
chains in the Genus database with same CATH topology
1INIA 2WVMA 5C4DA 4E1KA 4HOCA 1H7LA 3I0HA 2VSIA 4DE7A 1EZIA 1HM9A 4HO8A 2Y4MA 2VS4A 3Q80A 2GGOA 3U2TA 2PGYA 5C47A 4JD0A 1YP3A 2AE7A 1ZCTA 1ZJ0A 1H5SA 1ZHJA 4B2WA 3IOJA 5C1LA 4HO5A 2D7RA 2X5SA 1W55A 2RJ1A 2QKXA 4KT7A 3OH4A 5C4EA 2AGDA 3USRA 3V0NA 4Y6UA 5J49A 1G23A 2AECA 3CKNA 4KPZA 1XZ6A 1YP2A 5BXCA 2MZBA 1O7QA 4EEGA 2ICYA 3V90A 5C3DA 3GUEA 4Y7FA 3SXGA 2Q4JA 3Q4SA 1GQ9A 5JQQA 1FO8A 1FZWA 5HS2A 1H5SB 3ZLLA 1H4DA 2FYDB 3ZLKA 4IRPA 1OMXA 1QGQA 1G95A 1NWGB 1TW5A 3RMWA 4C2SA 5L6VA 4FRDA 4FRBA 1JVGA 2RJ9A 1NHEB 3BCVA 1INJA 2PA4A 1VGTA 1R7VA 1FRWA 4B3UA 3U2XA 5L6SA 3I0JA 4MYBA 1VGZA 3OH0A 3IOHA 3ZF8A 1JV1A 2BO4A 2FFUA 1IINA 4NAKA 1JYLA 2JCOA 3NGWA 5CMJA 4FRAA 1HV9A 3SXBA 2WE9A 2WVLA 4EEMA 2V0HA 1W57A 5EJ1A 3SPTA 1ZIZA 1HJJA 3I0DA 4P00A 1MP3A 5FTSA 4B42A 4ECMA 4AAWA 1ZJ1A 3SXDA 1K4VA 1MP4A 3EE5A 1S4NA 2OI5A 4G87A 2RJ5A 2V0IA 4KNXA 5CQPA 4HO2A 5C3AA 2V0LA 3U2VA 2CU2A 1ZCYA 4HO0A 1EYRA 3ZGGA 2ZU9A 1H5SD 1LZJA 4FIXA 4EEAA 2VXMA 2J0AA 3I0LA 4B4BA 2APCA 2O1HA 4FRPA 2O1FA 1WT0A 1HJLA 2XWNA 4L41C 3USQA 4AC3A 4J18A 2YC5A 5C1GA 1VZUA 1ZCVA 3T7MA 1OQMB 5FV9A 4KNRA 4M2BA 4ASJA 2ZU8A 5C48A 2P73A 3SX3A 2XMHA 4KQLA 2WEEA 5EJZA 4M2AA 1JV3A 3HL3A 4MIXA 1VPAA 5DDVA 3OH2A 4KC1A 1H7HA 2J0BA 1H7FA 3CU0A 4FRHA 1VH3A 1FXJA 2OI7A 1TW1A 4HCQA 5C8RA 4Y62A 4HO9A 2RIXA 2P6WA 3O3PA 2C0NA 2VK9A 4O6NA 2Y4JA 4R7PA 5AJPA 1NMMB 3SX5A 3FOQA 1QG8A 1H5SC 4NAIA 4CJBA 4ZDQA 1ZJOA 1G3LA 5C4FA 1VZTA 2AM3A 4XWIA 3SXCA 3TZTA 3U2UA 5D92A 3F1YA 2VSHA 2A8UA 1WVCA 2D0JA 4CJ8A 5D91A 1H4EA 1G8OA 1GWVA 5C49A 2XWLA 3DUVA 4EE4A 2E8BA 4CVHA 3JTJA 3DK5A 1G0RA 1ZJ2A 4NANA 4D11A 1H5RA 1R82A 3SX8A 3E25A 5EIYA 5CMIA 2Y6PA 4D11C 1R7XA 3U2WA 1S4PA 2Z87A 4DDZA 1GX4A 1TZFA 4FRMA 4EVWA 2QH5A 1H5TA 1H5RB 4KXOA 2P72A 2ZU7A 4JISA 2Y4KA 3PKQA 3I0EA 4HO6A 3U0XA 3Q7UA 2JCJA 5FU8A 3POLA 4Y6NA 1H7EA 1NQIB 1ZI3A 1VH1A 1LVWA 5C36A 1H5TB 5IDTA 1ZI5A 2OEGA 3T7NA 1WT1A 2X5ZA 2RIZA 4G3SA 5C3BA 2Z86A 4HO4A 1R81A 4Y9XA 2X65A 1HM0A 2PX7A 4UEGA 3V0PA 2RIYA 2YCMA 3K8EA 1G9RA 2V0JA 1JVDA 4NALA 2FYBA 3E26A 3BRKX 5CMHA 3OAMA 1FOAA 4HG6A 2WGZA 5FYEA 3QVBA 3CKOA 3KIAA 4AYJA 1O0RA 4D0TA 1WT2A 4Y7UA 1SS9A 5IFYA 1XHBA 1R7YA 3I0KA 1ZI4A 1FG5N 5CQMX 1LL2A 3R2WA 2FYCB 3I0IX 1GA8A 2W0VA 1GQCA 3JUKA 2RITA 5CQOA 1FXOA 4Y63A 2E3DA 1LL0A 3T7OA 1FGGA 5FUHA 2UX8A 3LW6A 4FCUA 2YQCA 4O6MA 2Y7AA 4M28A 2RJ8A 3D98A 3OGZA 1FR9A 1ZDFA 5AJNA 2AH9A 4M4KA 5AJOA 2X60A 1ZDGA 3ZGFA 2D7IA 3OC9A 1FWYA 1VICA 4YS8A 1LL3A 1PZYB 1LZIA 2Y4LA 4LW3A 1Z90A 4MNDA 3CKQA 2AESA 3CGXA 1H7GA 3PKPA 4Q7CA 4GBPA 1GX0A 2YQHA 1KWSA 3IOIA 1R7UA 2PGVA 2RJ6A 4G3QA 4EE5A 2I5KA 1NF5B 3SXAA 4BQHA 4FCEA 4KPXA 5C1HA 1I52A 1R7TA 1MC3A 4K6RA 4G3PA 1NKHB 3K8DA 1V84A 2VD4A 3RMVA 4Y7GA 2GGQA 3U0YA 1H3MA 1VGUA 3CKVA 1V82A 1V83A 4B4MA 2VS5A 1ZJPA 4EEOA 3D8VA 4FIYA 1H7TA 3V0LA 4D48A 1VGWA 3SXEA 1H4CA 4B5BA 4FROA 4FREA 1VZXA 2WVKA 3JUJA 4KC4A 2XMEA 3OKRA 5FTVA 1JYKA 3I0FA 1ZJ3A 3V0OA 3D5NA 2BO6A 2RJ0A 1ZI1A 3N9WA 5CMFX 1GWWA 2A8WA 2VFZA 5CQNX 1ON6A 2FY7A 1H7QA 1VM8A 2YESA 4LW6A 2FYAA 5CMGX 2VXLA 3PNNA 5DDTA 1YROB 3I0CA 1FO9A 2RJ7A 4D0ZA 1TVYA 2AM4A 3V8YA 3OH1A 4P02A 4EE3A 4FRQA 4HO3A 3FWWA 1QGSA 3R3IA 1G97A 1MP5A 5FU0A 4B4GA 1WT3A 2ICXA 3CKJA 2I7BA 5C4BA 4FRLA 4B2XA 1G1LA 1OMZA 1E5KA 5IDSA 2OEFA 1W77A 4KC2A 3DJ4A 4ASYA 5C38A 2RJ4A 1S4OA 4Y7TA 1R80A 1QWJA 2WAWA 3V8ZA 4IRQA 1WSZA 3RSBA 5CQLX 4FQWA 4KRVA 2O1GA 1LZ0A 1ON8A 2YQSA 2QGIA 5I1FA 1G2VA 4Y64A 1G93A 3V91A 5C4CA 2XWMA 4ARWA 3ST8A 1FGXA 3I0GA 2JCKA 2AM5A 1ZCUA 3OH3A 2YQJA 2V0KA 3F1CA 2YC3A 1HM8A 3TQDA 1LZ7A 3V0QA 2BO7A 1FR8A 1O23B 1O7OA 3V0MA 2I5EA 3SX7A 2W0WA 1YP4A 2BO8A 2NXVA 2FFVA 1PZTA 4Y7VA 4CJCA 4BMAA 2DPWA 2JCLA 1IIMA 2OI6A 4AYLA 4DECA 2VS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1INI A;  2WVM A;  5C4D A;  4E1K A;  4HOC A;  1H7L A;  3I0H A;  2VSI A;  4DE7 A;  1EZI A;  1HM9 A;  4HO8 A;  2Y4M A;  2VS4 A;  3Q80 A;  2GGO A;  3U2T A;  2PGY A;  5C47 A;  4JD0 A;  1YP3 A;  2AE7 A;  1ZCT A;  1ZJ0 A;  1H5S A;  1ZHJ A;  4B2W A;  3IOJ A;  5C1L A;  4HO5 A;  2D7R A;  2X5S A;  1W55 A;  2RJ1 A;  2QKX A;  4KT7 A;  3OH4 A;  5C4E A;  2AGD A;  3USR A;  3V0N A;  4Y6U A;  5J49 A;  1G23 A;  2AEC A;  3CKN A;  4KPZ A;  1XZ6 A;  1YP2 A;  5BXC A;  2MZB A;  1O7Q A;  4EEG A;  2ICY A;  3V90 A;  5C3D A;  3GUE A;  4Y7F A;  3SXG A;  2Q4J A;  3Q4S A;  1GQ9 A;  5JQQ A;  1FO8 A;  1FZW A;  5HS2 A;  1H5S B;  3ZLL A;  1H4D A;  2FYD B;  3ZLK A;  4IRP A;  1OMX A;  1QGQ A;  1G95 A;  1NWG B;  1TW5 A;  3RMW A;  4C2S A;  5L6V A;  4FRD A;  4FRB A;  1JVG A;  2RJ9 A;  1NHE B;  3BCV A;  1INJ A;  2PA4 A;  1VGT A;  1R7V A;  1FRW A;  4B3U A;  3U2X A;  5L6S A;  3I0J A;  4MYB A;  1VGZ A;  3OH0 A;  3IOH A;  3ZF8 A;  1JV1 A;  2BO4 A;  2FFU A;  1IIN A;  4NAK A;  1JYL A;  2JCO A;  3NGW A;  5CMJ A;  4FRA A;  1HV9 A;  3SXB A;  2WE9 A;  2WVL A;  4EEM A;  2V0H A;  1W57 A;  5EJ1 A;  3SPT A;  1ZIZ A;  1HJJ A;  3I0D A;  4P00 A;  1MP3 A;  5FTS A;  4B42 A;  4ECM A;  4AAW A;  1ZJ1 A;  3SXD A;  1K4V A;  1MP4 A;  3EE5 A;  1S4N A;  2OI5 A;  4G87 A;  2RJ5 A;  2V0I A;  4KNX A;  5CQP A;  4HO2 A;  5C3A A;  2V0L A;  3U2V A;  2CU2 A;  1ZCY A;  4HO0 A;  1EYR A;  3ZGG A;  2ZU9 A;  1H5S D;  1LZJ A;  4EEA A;  2VXM A;  3I0L A;  4B4B A;  2APC A;  2O1H A;  4FRP A;  2O1F A;  1WT0 A;  1HJL A;  2XWN A;  4L41 C;  3USQ A;  4AC3 A;  4J18 A;  2YC5 A;  5C1G A;  1VZU A;  1ZCV A;  3T7M A;  1OQM B;  5FV9 A;  4KNR A;  4M2B A;  4ASJ A;  2ZU8 A;  5C48 A;  2P73 A;  3SX3 A;  2XMH A;  4KQL A;  2WEE A;  5EJZ A;  4M2A A;  1JV3 A;  3HL3 A;  1VPA A;  5DDV A;  3OH2 A;  4KC1 A;  1H7H A;  4FRH A;  1H7F A;  3CU0 A;  1VH3 A;  1FXJ A;  2OI7 A;  1TW1 A;  4HCQ A;  5C8R A;  4Y62 A;  4HO9 A;  2RIX A;  2P6W A;  3O3P A;  4R7P A;  2Y4J A;  5AJP A;  1NMM B;  3SX5 A;  3FOQ A;  1QG8 A;  1H5S C;  4NAI A;  4CJB A;  4ZDQ A;  1ZJO A;  1G3L A;  5C4F A;  1VZT A;  2AM3 A;  4XWI A;  3SXC A;  3TZT A;  3U2U A;  3F1Y A;  2VSH A;  2A8U A;  1WVC A;  2D0J A;  4CJ8 A;  1H4E A;  1G8O A;  1GWV A;  5C49 A;  2XWL A;  3DUV A;  4EE4 A;  2E8B A;  4CVH A;  3JTJ A;  3DK5 A;  1G0R A;  1ZJ2 A;  4NAN A;  4D11 A;  1H5R A;  1R82 A;  3SX8 A;  3E25 A;  5EIY A;  5CMI A;  2Y6P A;  4D11 C;  1R7X A;  3U2W A;  1S4P A;  2Z87 A;  4DDZ A;  1GX4 A;  1TZF A;  4FRM A;  4EVW A;  2QH5 A;  1H5T A;  1H5R B;  4KXO A;  2P72 A;  2ZU7 A;  4JIS A;  2Y4K A;  3PKQ A;  3I0E A;  4HO6 A;  3U0X A;  3Q7U A;  2JCJ A;  5FU8 A;  3POL A;  4Y6N A;  1H7E A;  1NQI B;  1ZI3 A;  1VH1 A;  1LVW A;  5C36 A;  1H5T B;  5IDT A;  1ZI5 A;  2OEG A;  3T7N A;  1WT1 A;  2X5Z A;  2RIZ A;  4G3S A;  5C3B A;  2Z86 A;  4HO4 A;  1R81 A;  4Y9X A;  2X65 A;  1HM0 A;  2PX7 A;  4UEG A;  3V0P A;  2RIY A;  2YCM A;  3K8E A;  1G9R A;  2V0J A;  1JVD A;  4NAL A;  2FYB A;  3E26 A;  3BRK X;  5CMH A;  3OAM A;  1FOA A;  4HG6 A;  2WGZ A;  5FYE A;  3QVB A;  3CKO A;  3KIA A;  4AYJ A;  1O0R A;  4D0T A;  1WT2 A;  4Y7U A;  1SS9 A;  5IFY A;  1XHB A;  1R7Y A;  3I0K A;  1ZI4 A;  1FG5 N;  5CQM X;  1LL2 A;  3R2W A;  2FYC B;  3I0I X;  1GA8 A;  2W0V A;  1GQC A;  3JUK A;  2RIT A;  5CQO A;  1FXO A;  4Y63 A;  2E3D A;  1LL0 A;  3T7O A;  1FGG A;  5FUH A;  2UX8 A;  3LW6 A;  4FCU A;  2YQC A;  2Y7A A;  4M28 A;  2RJ8 A;  3D98 A;  3OGZ A;  1FR9 A;  1ZDF A;  5AJN A;  2AH9 A;  4M4K A;  5AJO A;  2X60 A;  1ZDG A;  3ZGF A;  2D7I A;  3OC9 A;  1FWY A;  1VIC A;  4YS8 A;  1LL3 A;  1PZY B;  1LZI A;  2Y4L A;  4LW3 A;  1Z90 A;  4MND A;  3CKQ A;  2AES A;  3CGX A;  1H7G A;  3PKP A;  4GBP A;  1GX0 A;  2YQH A;  1KWS A;  3IOI A;  1R7U A;  2PGV A;  2RJ6 A;  4G3Q A;  4EE5 A;  2I5K A;  1NF5 B;  3SXA A;  4BQH A;  4FCE A;  4KPX A;  5C1H A;  1I52 A;  1R7T A;  1MC3 A;  4K6R A;  4G3P A;  1NKH B;  3K8D A;  1V84 A;  2VD4 A;  3RMV A;  4Y7G A;  2GGQ A;  3U0Y A;  1H3M A;  1VGU A;  3CKV A;  1V82 A;  1V83 A;  4B4M A;  2VS5 A;  1ZJP A;  4EEO A;  3D8V A;  1H7T A;  3V0L A;  4D48 A;  1VGW A;  3SXE A;  1H4C A;  4B5B A;  4FRO A;  4FRE A;  1VZX A;  2WVK A;  3JUJ A;  4KC4 A;  2XME A;  3OKR A;  5FTV A;  1JYK A;  3I0F A;  1ZJ3 A;  3V0O A;  3D5N A;  2BO6 A;  2RJ0 A;  1ZI1 A;  3N9W A;  5CMF X;  1GWW A;  2A8W A;  2VFZ A;  5CQN X;  1ON6 A;  2FY7 A;  1H7Q A;  1VM8 A;  2YES A;  4LW6 A;  2FYA A;  5CMG X;  2VXL A;  3PNN A;  5DDT A;  1YRO B;  3I0C A;  1FO9 A;  2RJ7 A;  4D0Z A;  1TVY A;  2AM4 A;  3V8Y A;  3OH1 A;  4P02 A;  4EE3 A;  4FRQ A;  4HO3 A;  3FWW A;  1QGS A;  3R3I A;  1G97 A;  1MP5 A;  5FU0 A;  4B4G A;  1WT3 A;  2ICX A;  3CKJ A;  2I7B A;  5C4B A;  4FRL A;  4B2X A;  1G1L A;  1OMZ A;  1E5K A;  5IDS A;  2OEF A;  1W77 A;  4KC2 A;  3DJ4 A;  4ASY A;  5C38 A;  2RJ4 A;  1S4O A;  4Y7T A;  1R80 A;  1QWJ A;  2WAW A;  3V8Z A;  4IRQ A;  1WSZ A;  3RSB A;  5CQL X;  4FQW A;  4KRV A;  2O1G A;  1LZ0 A;  1ON8 A;  2YQS A;  2QGI A;  5I1F A;  1G2V A;  4Y64 A;  1G93 A;  3V91 A;  5C4C A;  2XWM A;  4ARW A;  3ST8 A;  1FGX A;  3I0G A;  2JCK A;  2AM5 A;  1ZCU A;  3OH3 A;  2YQJ A;  2V0K A;  3F1C A;  2YC3 A;  1HM8 A;  3TQD A;  1LZ7 A;  3V0Q A;  2BO7 A;  1FR8 A;  1O23 B;  1O7O A;  3V0M A;  2I5E A;  3SX7 A;  2W0W A;  1YP4 A;  2BO8 A;  2NXV A;  2FFV A;  1PZT A;  4Y7V A;  4CJC A;  4BMA A;  2DPW A;  2JCL A;  1IIM A;  2OI6 A;  4AYL A;  4DEC A;  2VS3 A; 
#chains in the Genus database with same CATH topology
 1INI A;  2WVM A;  5C4D A;  4E1K A;  4HOC A;  1H7L A;  3I0H A;  2VSI A;  4DE7 A;  1EZI A;  1HM9 A;  4HO8 A;  2Y4M A;  2VS4 A;  3Q80 A;  2GGO A;  3U2T A;  2PGY A;  5C47 A;  4JD0 A;  1YP3 A;  2AE7 A;  1ZCT A;  1ZJ0 A;  1H5S A;  1ZHJ A;  4B2W A;  3IOJ A;  5C1L A;  4HO5 A;  2D7R A;  2X5S A;  1W55 A;  2RJ1 A;  2QKX A;  4KT7 A;  3OH4 A;  5C4E A;  2AGD A;  3USR A;  3V0N A;  4Y6U A;  5J49 A;  1G23 A;  2AEC A;  3CKN A;  4KPZ A;  1XZ6 A;  1YP2 A;  5BXC A;  2MZB A;  1O7Q A;  4EEG A;  2ICY A;  3V90 A;  5C3D A;  3GUE A;  4Y7F A;  3SXG A;  2Q4J A;  3Q4S A;  1GQ9 A;  5JQQ A;  1FO8 A;  1FZW A;  5HS2 A;  1H5S B;  3ZLL A;  1H4D A;  2FYD B;  3ZLK A;  4IRP A;  1OMX A;  1QGQ A;  1G95 A;  1NWG B;  1TW5 A;  3RMW A;  4C2S A;  5L6V A;  4FRD A;  4FRB A;  1JVG A;  2RJ9 A;  1NHE B;  3BCV A;  1INJ A;  2PA4 A;  1VGT A;  1R7V A;  1FRW A;  4B3U A;  3U2X A;  5L6S A;  3I0J A;  4MYB A;  1VGZ A;  3OH0 A;  3IOH A;  3ZF8 A;  1JV1 A;  2BO4 A;  2FFU A;  1IIN A;  4NAK A;  1JYL A;  2JCO A;  3NGW A;  5CMJ A;  4FRA A;  1HV9 A;  3SXB A;  2WE9 A;  2WVL A;  4EEM A;  2V0H A;  1W57 A;  5EJ1 A;  3SPT A;  1ZIZ A;  1HJJ A;  3I0D A;  4P00 A;  1MP3 A;  5FTS A;  4B42 A;  4ECM A;  4AAW A;  1ZJ1 A;  3SXD A;  1K4V A;  1MP4 A;  3EE5 A;  1S4N A;  2OI5 A;  4G87 A;  2RJ5 A;  2V0I A;  4KNX A;  5CQP A;  4HO2 A;  5C3A A;  2V0L A;  3U2V A;  2CU2 A;  1ZCY A;  4HO0 A;  1EYR A;  3ZGG A;  2ZU9 A;  1H5S D;  1LZJ A;  4FIX A;  4EEA A;  2VXM A;  2J0A A;  3I0L A;  4B4B A;  2APC A;  2O1H A;  4FRP A;  2O1F A;  1WT0 A;  1HJL A;  2XWN A;  4L41 C;  3USQ A;  4AC3 A;  4J18 A;  2YC5 A;  5C1G A;  1VZU A;  1ZCV A;  3T7M A;  1OQM B;  5FV9 A;  4KNR A;  4M2B A;  4ASJ A;  2ZU8 A;  5C48 A;  2P73 A;  3SX3 A;  2XMH A;  4KQL A;  2WEE A;  5EJZ A;  4M2A A;  1JV3 A;  3HL3 A;  4MIX A;  1VPA A;  5DDV A;  3OH2 A;  4KC1 A;  1H7H A;  2J0B A;  1H7F A;  3CU0 A;  4FRH A;  1VH3 A;  1FXJ A;  2OI7 A;  1TW1 A;  4HCQ A;  5C8R A;  4Y62 A;  4HO9 A;  2RIX A;  2P6W A;  3O3P A;  2C0N A;  2VK9 A;  4O6N A;  2Y4J A;  4R7P A;  5AJP A;  1NMM B;  3SX5 A;  3FOQ A;  1QG8 A;  1H5S C;  4NAI A;  4CJB A;  4ZDQ A;  1ZJO A;  1G3L A;  5C4F A;  1VZT A;  2AM3 A;  4XWI A;  3SXC A;  3TZT A;  3U2U A;  5D92 A;  3F1Y A;  2VSH A;  2A8U A;  1WVC A;  2D0J A;  4CJ8 A;  5D91 A;  1H4E A;  1G8O A;  1GWV A;  5C49 A;  2XWL A;  3DUV A;  4EE4 A;  2E8B A;  4CVH A;  3JTJ A;  3DK5 A;  1G0R A;  1ZJ2 A;  4NAN A;  4D11 A;  1H5R A;  1R82 A;  3SX8 A;  3E25 A;  5EIY A;  5CMI A;  2Y6P A;  4D11 C;  1R7X A;  3U2W A;  1S4P A;  2Z87 A;  4DDZ A;  1GX4 A;  1TZF A;  4FRM A;  4EVW A;  2QH5 A;  1H5T A;  1H5R B;  4KXO A;  2P72 A;  2ZU7 A;  4JIS A;  2Y4K A;  3PKQ A;  3I0E A;  4HO6 A;  3U0X A;  3Q7U A;  2JCJ A;  5FU8 A;  3POL A;  4Y6N A;  1H7E A;  1NQI B;  1ZI3 A;  1VH1 A;  1LVW A;  5C36 A;  1H5T B;  5IDT A;  1ZI5 A;  2OEG A;  3T7N A;  1WT1 A;  2X5Z A;  2RIZ A;  4G3S A;  5C3B A;  2Z86 A;  4HO4 A;  1R81 A;  4Y9X A;  2X65 A;  1HM0 A;  2PX7 A;  4UEG A;  3V0P A;  2RIY A;  2YCM A;  3K8E A;  1G9R A;  2V0J A;  1JVD A;  4NAL A;  2FYB A;  3E26 A;  3BRK X;  5CMH A;  3OAM A;  1FOA A;  4HG6 A;  2WGZ A;  5FYE A;  3QVB A;  3CKO A;  3KIA A;  4AYJ A;  1O0R A;  4D0T A;  1WT2 A;  4Y7U A;  1SS9 A;  5IFY A;  1XHB A;  1R7Y A;  3I0K A;  1ZI4 A;  1FG5 N;  5CQM X;  1LL2 A;  3R2W A;  2FYC B;  3I0I X;  1GA8 A;  2W0V A;  1GQC A;  3JUK A;  2RIT A;  5CQO A;  1FXO A;  4Y63 A;  2E3D A;  1LL0 A;  3T7O A;  1FGG A;  5FUH A;  2UX8 A;  3LW6 A;  4FCU A;  2YQC A;  4O6M A;  2Y7A A;  4M28 A;  2RJ8 A;  3D98 A;  3OGZ A;  1FR9 A;  1ZDF A;  5AJN A;  2AH9 A;  4M4K A;  5AJO A;  2X60 A;  1ZDG A;  3ZGF A;  2D7I A;  3OC9 A;  1FWY A;  1VIC A;  4YS8 A;  1LL3 A;  1PZY B;  1LZI A;  2Y4L A;  4LW3 A;  1Z90 A;  4MND A;  3CKQ A;  2AES A;  3CGX A;  1H7G A;  3PKP A;  4Q7C A;  4GBP A;  1GX0 A;  2YQH A;  1KWS A;  3IOI A;  1R7U A;  2PGV A;  2RJ6 A;  4G3Q A;  4EE5 A;  2I5K A;  1NF5 B;  3SXA A;  4BQH A;  4FCE A;  4KPX A;  5C1H A;  1I52 A;  1R7T A;  1MC3 A;  4K6R A;  4G3P A;  1NKH B;  3K8D A;  1V84 A;  2VD4 A;  3RMV A;  4Y7G A;  2GGQ A;  3U0Y A;  1H3M A;  1VGU A;  3CKV A;  1V82 A;  1V83 A;  4B4M A;  2VS5 A;  1ZJP A;  4EEO A;  3D8V A;  4FIY A;  1H7T A;  3V0L A;  4D48 A;  1VGW A;  3SXE A;  1H4C A;  4B5B A;  4FRO A;  4FRE A;  1VZX A;  2WVK A;  3JUJ A;  4KC4 A;  2XME A;  3OKR A;  5FTV A;  1JYK A;  3I0F A;  1ZJ3 A;  3V0O A;  3D5N A;  2BO6 A;  2RJ0 A;  1ZI1 A;  3N9W A;  5CMF X;  1GWW A;  2A8W A;  2VFZ A;  5CQN X;  1ON6 A;  2FY7 A;  1H7Q A;  1VM8 A;  2YES A;  4LW6 A;  2FYA A;  5CMG X;  2VXL A;  3PNN A;  5DDT A;  1YRO B;  3I0C A;  1FO9 A;  2RJ7 A;  4D0Z A;  1TVY A;  2AM4 A;  3V8Y A;  3OH1 A;  4P02 A;  4EE3 A;  4FRQ A;  4HO3 A;  3FWW A;  1QGS A;  3R3I A;  1G97 A;  1MP5 A;  5FU0 A;  4B4G A;  1WT3 A;  2ICX A;  3CKJ A;  2I7B A;  5C4B A;  4FRL A;  4B2X A;  1G1L A;  1OMZ A;  1E5K A;  5IDS A;  2OEF A;  1W77 A;  4KC2 A;  3DJ4 A;  4ASY A;  5C38 A;  2RJ4 A;  1S4O A;  4Y7T A;  1R80 A;  1QWJ A;  2WAW A;  3V8Z A;  4IRQ A;  1WSZ A;  3RSB A;  5CQL X;  4FQW A;  4KRV A;  2O1G A;  1LZ0 A;  1ON8 A;  2YQS A;  2QGI A;  5I1F A;  1G2V A;  4Y64 A;  1G93 A;  3V91 A;  5C4C A;  2XWM A;  4ARW A;  3ST8 A;  1FGX A;  3I0G A;  2JCK A;  2AM5 A;  1ZCU A;  3OH3 A;  2YQJ A;  2V0K A;  3F1C A;  2YC3 A;  1HM8 A;  3TQD A;  1LZ7 A;  3V0Q A;  2BO7 A;  1FR8 A;  1O23 B;  1O7O A;  3V0M A;  2I5E A;  3SX7 A;  2W0W A;  1YP4 A;  2BO8 A;  2NXV A;  2FFV A;  1PZT A;  4Y7V A;  4CJC A;  4BMA A;  2DPW A;  2JCL A;  1IIM A;  2OI6 A;  4AYL A;  4DEC A;  2VS3 A; 
#chains in the Genus database with same CATH homology
 1INI A;  2WVM A;  5C4D A;  4E1K A;  4HOC A;  1H7L A;  3I0H A;  2VSI A;  4DE7 A;  1EZI A;  1HM9 A;  4HO8 A;  2Y4M A;  2VS4 A;  3Q80 A;  2GGO A;  3U2T A;  2PGY A;  5C47 A;  4JD0 A;  1YP3 A;  2AE7 A;  1ZCT A;  1ZJ0 A;  1H5S A;  1ZHJ A;  4B2W A;  3IOJ A;  5C1L A;  4HO5 A;  2D7R A;  2X5S A;  1W55 A;  2RJ1 A;  2QKX A;  4KT7 A;  3OH4 A;  5C4E A;  2AGD A;  3USR A;  3V0N A;  4Y6U A;  5J49 A;  1G23 A;  2AEC A;  3CKN A;  4KPZ A;  1XZ6 A;  1YP2 A;  5BXC A;  2MZB A;  1O7Q A;  4EEG A;  2ICY A;  3V90 A;  5C3D A;  3GUE A;  4Y7F A;  3SXG A;  2Q4J A;  3Q4S A;  1GQ9 A;  5JQQ A;  1FO8 A;  1FZW A;  5HS2 A;  1H5S B;  3ZLL A;  1H4D A;  2FYD B;  3ZLK A;  4IRP A;  1OMX A;  1QGQ A;  1G95 A;  1NWG B;  1TW5 A;  3RMW A;  4C2S A;  5L6V A;  4FRD A;  4FRB A;  1JVG A;  2RJ9 A;  1NHE B;  3BCV A;  1INJ A;  2PA4 A;  1VGT A;  1R7V A;  1FRW A;  4B3U A;  3U2X A;  5L6S A;  3I0J A;  4MYB A;  1VGZ A;  3OH0 A;  3IOH A;  3ZF8 A;  1JV1 A;  2BO4 A;  2FFU A;  1IIN A;  4NAK A;  1JYL A;  2JCO A;  3NGW A;  5CMJ A;  4FRA A;  1HV9 A;  3SXB A;  2WE9 A;  2WVL A;  4EEM A;  2V0H A;  1W57 A;  5EJ1 A;  3SPT A;  1ZIZ A;  1HJJ A;  3I0D A;  4P00 A;  1MP3 A;  5FTS A;  4B42 A;  4ECM A;  4AAW A;  1ZJ1 A;  3SXD A;  1K4V A;  1MP4 A;  3EE5 A;  1S4N A;  2OI5 A;  4G87 A;  2RJ5 A;  2V0I A;  4KNX A;  5CQP A;  4HO2 A;  5C3A A;  2V0L A;  3U2V A;  2CU2 A;  1ZCY A;  4HO0 A;  1EYR A;  3ZGG A;  2ZU9 A;  1H5S D;  1LZJ A;  4FIX A;  4EEA A;  2VXM A;  2J0A A;  3I0L A;  4B4B A;  2APC A;  2O1H A;  4FRP A;  2O1F A;  1WT0 A;  1HJL A;  2XWN A;  4L41 C;  3USQ A;  4AC3 A;  4J18 A;  2YC5 A;  5C1G A;  1VZU A;  1ZCV A;  3T7M A;  1OQM B;  5FV9 A;  4KNR A;  4M2B A;  4ASJ A;  2ZU8 A;  5C48 A;  2P73 A;  3SX3 A;  2XMH A;  4KQL A;  2WEE A;  5EJZ A;  4M2A A;  1JV3 A;  3HL3 A;  4MIX A;  1VPA A;  5DDV A;  3OH2 A;  4KC1 A;  1H7H A;  2J0B A;  1H7F A;  3CU0 A;  4FRH A;  1VH3 A;  1FXJ A;  2OI7 A;  1TW1 A;  4HCQ A;  5C8R A;  4Y62 A;  4HO9 A;  2RIX A;  2P6W A;  3O3P A;  2C0N A;  2VK9 A;  4O6N A;  2Y4J A;  4R7P A;  5AJP A;  1NMM B;  3SX5 A;  3FOQ A;  1QG8 A;  1H5S C;  4NAI A;  4CJB A;  4ZDQ A;  1ZJO A;  1G3L A;  5C4F A;  1VZT A;  2AM3 A;  4XWI A;  3SXC A;  3TZT A;  3U2U A;  5D92 A;  3F1Y A;  2VSH A;  2A8U A;  1WVC A;  2D0J A;  4CJ8 A;  5D91 A;  1H4E A;  1G8O A;  1GWV A;  5C49 A;  2XWL A;  3DUV A;  4EE4 A;  2E8B A;  4CVH A;  3JTJ A;  3DK5 A;  1G0R A;  1ZJ2 A;  4NAN A;  4D11 A;  1H5R A;  1R82 A;  3SX8 A;  3E25 A;  5EIY A;  5CMI A;  2Y6P A;  4D11 C;  1R7X A;  3U2W A;  1S4P A;  2Z87 A;  4DDZ A;  1GX4 A;  1TZF A;  4FRM A;  4EVW A;  2QH5 A;  1H5T A;  1H5R B;  4KXO A;  2P72 A;  2ZU7 A;  4JIS A;  2Y4K A;  3PKQ A;  3I0E A;  4HO6 A;  3U0X A;  3Q7U A;  2JCJ A;  5FU8 A;  3POL A;  4Y6N A;  1H7E A;  1NQI B;  1ZI3 A;  1VH1 A;  1LVW A;  5C36 A;  1H5T B;  5IDT A;  1ZI5 A;  2OEG A;  3T7N A;  1WT1 A;  2X5Z A;  2RIZ A;  4G3S A;  5C3B A;  2Z86 A;  4HO4 A;  1R81 A;  4Y9X A;  2X65 A;  1HM0 A;  2PX7 A;  4UEG A;  3V0P A;  2RIY A;  2YCM A;  3K8E A;  1G9R A;  2V0J A;  1JVD A;  4NAL A;  2FYB A;  3E26 A;  3BRK X;  5CMH A;  3OAM A;  1FOA A;  4HG6 A;  2WGZ A;  5FYE A;  3QVB A;  3CKO A;  3KIA A;  4AYJ A;  1O0R A;  4D0T A;  1WT2 A;  4Y7U A;  1SS9 A;  5IFY A;  1XHB A;  1R7Y A;  3I0K A;  1ZI4 A;  1FG5 N;  5CQM X;  1LL2 A;  3R2W A;  2FYC B;  3I0I X;  1GA8 A;  2W0V A;  1GQC A;  3JUK A;  2RIT A;  5CQO A;  1FXO A;  4Y63 A;  2E3D A;  1LL0 A;  3T7O A;  1FGG A;  5FUH A;  2UX8 A;  3LW6 A;  4FCU A;  2YQC A;  4O6M A;  2Y7A A;  4M28 A;  2RJ8 A;  3D98 A;  3OGZ A;  1FR9 A;  1ZDF A;  5AJN A;  2AH9 A;  4M4K A;  5AJO A;  2X60 A;  1ZDG A;  3ZGF A;  2D7I A;  3OC9 A;  1FWY A;  1VIC A;  4YS8 A;  1LL3 A;  1PZY B;  1LZI A;  2Y4L A;  4LW3 A;  1Z90 A;  4MND A;  3CKQ A;  2AES A;  3CGX A;  1H7G A;  3PKP A;  4Q7C A;  4GBP A;  1GX0 A;  2YQH A;  1KWS A;  3IOI A;  1R7U A;  2PGV A;  2RJ6 A;  4G3Q A;  4EE5 A;  2I5K A;  1NF5 B;  3SXA A;  4BQH A;  4FCE A;  4KPX A;  5C1H A;  1I52 A;  1R7T A;  1MC3 A;  4K6R A;  4G3P A;  1NKH B;  3K8D A;  1V84 A;  2VD4 A;  3RMV A;  4Y7G A;  2GGQ A;  3U0Y A;  1H3M A;  1VGU A;  3CKV A;  1V82 A;  1V83 A;  4B4M A;  2VS5 A;  1ZJP A;  4EEO A;  3D8V A;  4FIY A;  1H7T A;  3V0L A;  4D48 A;  1VGW A;  3SXE A;  1H4C A;  4B5B A;  4FRO A;  4FRE A;  1VZX A;  2WVK A;  3JUJ A;  4KC4 A;  2XME A;  3OKR A;  5FTV A;  1JYK A;  3I0F A;  1ZJ3 A;  3V0O A;  3D5N A;  2BO6 A;  2RJ0 A;  1ZI1 A;  3N9W A;  5CMF X;  1GWW A;  2A8W A;  2VFZ A;  5CQN X;  1ON6 A;  2FY7 A;  1H7Q A;  1VM8 A;  2YES A;  4LW6 A;  2FYA A;  5CMG X;  2VXL A;  3PNN A;  5DDT A;  1YRO B;  3I0C A;  1FO9 A;  2RJ7 A;  4D0Z A;  1TVY A;  2AM4 A;  3V8Y A;  3OH1 A;  4P02 A;  4EE3 A;  4FRQ A;  4HO3 A;  3FWW A;  1QGS A;  3R3I A;  1G97 A;  1MP5 A;  5FU0 A;  4B4G A;  1WT3 A;  2ICX A;  3CKJ A;  2I7B A;  5C4B A;  4FRL A;  4B2X A;  1G1L A;  1OMZ A;  1E5K A;  5IDS A;  2OEF A;  1W77 A;  4KC2 A;  3DJ4 A;  4ASY A;  5C38 A;  2RJ4 A;  1S4O A;  4Y7T A;  1R80 A;  1QWJ A;  2WAW A;  3V8Z A;  4IRQ A;  1WSZ A;  3RSB A;  5CQL X;  4FQW A;  4KRV A;  2O1G A;  1LZ0 A;  1ON8 A;  2YQS A;  2QGI A;  5I1F A;  1G2V A;  4Y64 A;  1G93 A;  3V91 A;  5C4C A;  2XWM A;  4ARW A;  3ST8 A;  1FGX A;  3I0G A;  2JCK A;  2AM5 A;  1ZCU A;  3OH3 A;  2YQJ A;  2V0K A;  3F1C A;  2YC3 A;  1HM8 A;  3TQD A;  1LZ7 A;  3V0Q A;  2BO7 A;  1FR8 A;  1O23 B;  1O7O A;  3V0M A;  2I5E A;  3SX7 A;  2W0W A;  1YP4 A;  2BO8 A;  2NXV A;  2FFV A;  1PZT A;  4Y7V A;  4CJC A;  4BMA A;  2DPW A;  2JCL A;  1IIM A;  2OI6 A;  4AYL A;  4DEC A;  2VS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...