5C3BA

Crystal structure of abba + udp-c-gal (long soak) + di
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
285
structure length
277
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histo-blood group ABO system transferase
publication title High Resolution Structures of the Human ABO(H) Blood Group Enzymes in Complex with Donor Analogs Reveal That the Enzymes Utilize Multiple Donor Conformations to Bind Substrates in a Stepwise Manner.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 277
sequence length 285
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2015-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5c3bA00
4J18A 5FYEA 1FOAA 1H5SD 1GQ9A 5C4EA 3V90A 2AECA 2I5KA 2QGIA 3V0NA 5L6SA 2X5ZA 2JCOA 5EJ1A 1ZCUA 1XZ6A 1G23A 5DDTA 5C4BA 3ZGGA 4B4GA 1G1LA 5C1LA 1VZXA 2RJ6A 5DDVA 4JISA 1H7QA 4AC3A 4NANA 3ST8A 1FXOA 1MC3A 4B2WA 4B5BA 5AJOA 2FFUA 2XMEA 1LL3A 1MP5A 1TZFA 3PNNA 5JQQA 1NQIB 2BO7A 3EE5A 2FYCB 2OI6A 3OC9A 2VSIA 2V0KA 3Q7UA 4AAWA 3D5NA 2JCLA 2QKXA 3OH1A 3U2XA 1H7TA 1Z90A 5CMJA 2W0WA 1ZI5A 3I0GA 3DK5A 3SXBA 5FTVA 2X60A 4Y9XA 4HO6A 4FRMA 1VGWA 2VD4A 4B4MA 5CMIA 2ZU7A 3OH3A 1HM9A 2VS3A 3JTJA 1PZTA 1W77A 1XHBA 2D0JA 3SX5A 2OI5A 5AJPA 4HO4A 4LW6A 3SX3A 3I0FA 3PKQA 4FRHA 4D11C 1TVYA 4FRPA 4BQHA 5C49A 4Y7TA 1MP4A 1G93A 2AH9A 3T7OA 1TW5A 2RIXA 3F1YA 4LW3A 3CKVA 1G97A 2FY7A 1EZIA 4D0ZA 1H5RB 2VS5A 3I0JA 1FWYA 2VXLA 1VGTA 2VFZA 1WVCA 4KPZA 3DUVA 2WVMA 1QG8A 3RSBA 1H5SC 4HG6A 5C36A 4B3UA 2XWLA 1WT3A 4EEOA 4G87A 3USRA 1H5TB 4B42A 3V0LA 3OH4A 1R80A 3HL3A 1R7YA 1VH1A 1O7OA 5FUHA 5C4CA 3JUKA 3USQA 1LVWA 2WAWA 1GX0A 2E8BA 2RJ4A 3BRKX 4KNRA 3OH2A 1LZ7A 3U2UA 4KPXA 1JVDA 2RIYA 2WEEA 1OQMB 2DPWA 2RJ0A 2Y6PA 1R7TA 1H7HA 1VGZA 4FCUA 5C4DA 1EYRA 4ASYA 1GA8A 1R7VA 4HO9A 1H5RA 4HO8A 1FRWA 3D8VA 3SPTA 4EEGA 3R3IA 4C2SA 1G9RA 3I0DA 1ZJ2A 2P73A 1ON6A 2XWMA 4D11A 4KNXA 3T7MA 1G0RA 1ZDFA 3POLA 4YS8A 4FCEA 4JD0A 3V0OA 5C4FA 4NAIA 1GWWA 2WGZA 1H5TA 3V91A 4G3SA 1FGXA 2OI7A 3SXGA 1MP3A 3GUEA 4EE3A 4FROA 1FR9A 1ZJ1A 3LW6A 2WVKA 1S4OA 5EIYA 4R7PA 2ZU9A 3V0MA 1JYKA 2A8UA 1FXJA 4KC1A 2D7IA 2PA4A 2AESA 4KC4A 2YQCA 4FRDA 2RITA 3CKJA 4Y7VA 2VSHA 3RMVA 4Y6NA 1WT1A 2MZBA 4HO5A 4HO0A 1G8OA 2RJ9A 1ZCYA 4IRQA 2AM3A 4M2AA 4EEAA 3Q80A 2APCA 1H7EA 3OAMA 3RMWA 2Y4JA 3F1CA 1GX4A 5C48A 1FZWA 1WT2A 4EVWA 4FRBA 1H4EA 1ZJ0A 4HO2A 1WSZA 3U0YA 4M4KA 4GBPA 1JV1A 1OMXA 2VXMA 1SS9A 3CKQA 3OGZA 3V0PA 1ZJOA 5CQMX 3I0IX 1ZCVA 2QH5A 1INJA 1O23B 4G3PA 2Y4KA 4DECA 1YP2A 2V0JA 3CKNA 1G95A 1G2VA 1KWSA 2ICYA 1VPAA 2YCMA 2GGQA 1JVGA 2P6WA 2A8WA 2VS4A 2ICXA 5IDTA 4Y63A 1NMMB 1W55A 3SX7A 5C8RA 1LZIA 4K6RA 2X5SA 3ZF8A 3FOQA 3V8ZA 1WT0A 2AGDA 4ARWA 2ZU8A 2PGYA 3U2TA 3TZTA 5FV9A 2FYBA 5CQOA 4HO3A 4KRVA 2UX8A 3I0CA 4FRLA 4KQLA 1ZJPA 2GGOA 1YROB 5CQPA 3V0QA 5AJNA 3TQDA 3QVBA 2O1GA 2YC5A 4B2XA 4Y64A 4BMAA 4CVHA 1ZI3A 4AYLA 1NKHB 3IOJA 3Q4SA 2X65A 2AE7A 2W0VA 3DJ4A 4CJ8A 1GQCA 4P02A 1YP4A 4KT7A 3SXCA 5IFYA 2Y4LA 1H5SB 1E5KA 2Z87A 3JUJA 5CQLX 1H3MA 1H7GA 1LL2A 3O3PA 3ZLLA 3I0LA 2YQJA 3IOIA 3SXEA 1I52A 1LZ0A 3D98A 2P72A 4NALA 4MNDA 1R7XA 1S4NA 5FU0A 1VZUA 4DE7A 2WE9A 5J49A 4L41C 4NAKA 4Y62A 1R82A 5C38A 4FRQA 2YESA 1ZIZA 1V83A 3N9WA 5BXCA 2XWNA 1V82A 3K8EA 3R2WA 1H7FA 2Y4MA 1R7UA 3T7NA 2PX7A 2JCKA 3SXAA 2V0HA 2D7RA 3CU0A 1GWVA 5FU8A 2RJ7A 1R81A 4Y7FA 5CMGX 3FWWA 4HOCA 2XMHA 1H5SA 1YP3A 4FRAA 2JCJA 3ZLKA 1VICA 1VGUA 3U2WA 1FR8A 1W57A 5C3DA 2RJ1A 4XWIA 5C3BA 1FO9A 1V84A 1ZHJA 2V0LA 4D48A 1FO8A 1PZYB 5FTSA 4EE4A 4CJBA 1JYLA 2PGVA 3OH0A 2YQSA 2Q4JA 2YQHA 1QGSA 1ZDGA 3IOHA 2V0IA 1HM8A 5CQNX 1O0RA 1S4PA 3I0EA 1ZI4A 2BO6A 5L6VA 1INIA 1ZI1A 2I7BA 4AYJA 3OKRA 4M2BA 2FYDB 2BO8A 4MYBA 2OEFA 2Z86A 4E1KA 1HJLA 5EJZA 1IIMA 1VZTA 3V8YA 1ON8A 5C1GA 2WVLA 3BCVA 1NWGB 3U0XA 1QWJA 1HJJA 4M28A 2AM4A 1JV3A 1K4VA 1QGQA 2FFVA 3I0KA 2YC3A 2O1FA 3K8DA 3KIAA 4EE5A 3CGXA 2RJ8A 5C3AA 4KXOA 5IDSA 3E25A 5CMFX 2AM5A 1ZCTA 4HCQA 4ZDQA 1VM8A 4ASJA 1H4DA 2E3DA 1H7LA 1LZJA 1NF5B 5CMHA 3PKPA 2I5EA 1G3LA 3E26A 2FYAA 5HS2A 1FG5N 3SXDA 4B4BA 4IRPA 1FGGA 4Y7UA 5C47A 4ECMA 5C1HA 1LL0A 3ZGFA 1HM0A 1IINA 1VH3A 3SX8A 4D0TA 4UEGA 4Y7GA 2CU2A 2RIZA 4P00A 1TW1A 4Y6UA 4DDZA 4FQWA 1NHEB 4FREA 2NXVA 2Y7AA 4CJCA 3NGWA 2OEGA 1OMZA 5I1FA 2O1HA 4KC2A 3U2VA 3I0HA 1O7QA 2RJ5A 1H4CA 1ZJ3A 1HV9A 3CKOA 4G3QA 4EEMA 2BO4A
chains in the Genus database with same CATH superfamily
4J18A 5FYEA 1FOAA 1H5SD 1GQ9A 5C4EA 3V90A 2AECA 2I5KA 2QGIA 3V0NA 5L6SA 2X5ZA 2JCOA 5EJ1A 1ZCUA 1XZ6A 1G23A 5DDTA 5C4BA 3ZGGA 4B4GA 1G1LA 5C1LA 1VZXA 2RJ6A 5DDVA 4JISA 1H7QA 4AC3A 4NANA 3ST8A 1FXOA 1MC3A 4B2WA 4B5BA 5AJOA 2FFUA 2XMEA 1LL3A 1MP5A 1TZFA 3PNNA 5JQQA 1NQIB 2BO7A 3EE5A 2FYCB 2OI6A 3OC9A 2VSIA 2V0KA 3Q7UA 4AAWA 3D5NA 2JCLA 2QKXA 3OH1A 3U2XA 1H7TA 1Z90A 5CMJA 2W0WA 1ZI5A 3I0GA 3DK5A 3SXBA 5FTVA 2X60A 4Y9XA 4HO6A 4FRMA 1VGWA 2VD4A 4B4MA 5CMIA 2ZU7A 3OH3A 1HM9A 2VS3A 3JTJA 1PZTA 1W77A 1XHBA 2D0JA 3SX5A 2OI5A 5AJPA 4HO4A 4LW6A 3SX3A 3I0FA 3PKQA 4FRHA 4D11C 1TVYA 4FRPA 4BQHA 5C49A 4Y7TA 1MP4A 1G93A 2AH9A 2J0BA 3T7OA 1TW5A 2RIXA 3F1YA 4LW3A 3CKVA 1G97A 2FY7A 1EZIA 4D0ZA 1H5RB 2VS5A 3I0JA 1FWYA 2VXLA 1VGTA 2VFZA 1WVCA 4O6MA 4KPZA 3DUVA 2WVMA 1QG8A 3RSBA 1H5SC 4HG6A 5C36A 4B3UA 2XWLA 1WT3A 4EEOA 4G87A 3USRA 1H5TB 4B42A 3V0LA 3OH4A 1R80A 3HL3A 1R7YA 1VH1A 1O7OA 5FUHA 5C4CA 3JUKA 3USQA 1LVWA 2WAWA 1GX0A 2E8BA 2RJ4A 3BRKX 4KNRA 3OH2A 1LZ7A 3U2UA 4KPXA 1JVDA 2RIYA 2WEEA 1OQMB 2DPWA 2RJ0A 2Y6PA 1R7TA 1H7HA 1VGZA 4FCUA 5C4DA 1EYRA 4ASYA 1GA8A 1R7VA 4HO9A 1H5RA 4HO8A 1FRWA 3D8VA 3SPTA 4EEGA 3R3IA 5D91A 4C2SA 1G9RA 3I0DA 1ZJ2A 2P73A 1ON6A 2XWMA 4D11A 4KNXA 3T7MA 1G0RA 1ZDFA 3POLA 4YS8A 4FCEA 4JD0A 3V0OA 5C4FA 4NAIA 1GWWA 2WGZA 1H5TA 3V91A 4G3SA 1FGXA 2OI7A 3SXGA 1MP3A 3GUEA 4EE3A 4FROA 1FR9A 1ZJ1A 3LW6A 2WVKA 1S4OA 5EIYA 4R7PA 2ZU9A 3V0MA 1JYKA 2A8UA 1FXJA 4KC1A 2D7IA 2PA4A 2AESA 4KC4A 2YQCA 4FRDA 2RITA 3CKJA 4Y7VA 2C0NA 2VSHA 3RMVA 4Y6NA 1WT1A 2MZBA 4HO5A 4HO0A 1G8OA 2RJ9A 1ZCYA 4IRQA 2AM3A 4M2AA 4EEAA 3Q80A 2APCA 1H7EA 3OAMA 3RMWA 2Y4JA 3F1CA 1GX4A 5C48A 1FZWA 1WT2A 4EVWA 4FRBA 1H4EA 1ZJ0A 4HO2A 1WSZA 3U0YA 4M4KA 4GBPA 1JV1A 1OMXA 2VXMA 1SS9A 3CKQA 3OGZA 3V0PA 1ZJOA 5CQMX 3I0IX 1ZCVA 2QH5A 1INJA 1O23B 4G3PA 2Y4KA 4DECA 1YP2A 2V0JA 3CKNA 1G95A 1G2VA 1KWSA 2ICYA 1VPAA 2YCMA 2GGQA 1JVGA 2P6WA 2A8WA 2VS4A 2ICXA 5IDTA 4Y63A 1NMMB 1W55A 3SX7A 5C8RA 1LZIA 4K6RA 2X5SA 3ZF8A 3FOQA 3V8ZA 1WT0A 2AGDA 4ARWA 2ZU8A 2PGYA 3U2TA 3TZTA 5FV9A 2FYBA 5CQOA 4HO3A 4KRVA 2UX8A 3I0CA 4FRLA 4KQLA 1ZJPA 2GGOA 1YROB 5CQPA 3V0QA 5AJNA 3TQDA 3QVBA 2O1GA 2YC5A 4B2XA 4Y64A 4BMAA 4CVHA 1ZI3A 4AYLA 1NKHB 3IOJA 3Q4SA 2X65A 2AE7A 4MIXA 2W0VA 3DJ4A 4CJ8A 1GQCA 4P02A 1YP4A 4KT7A 3SXCA 5IFYA 2Y4LA 1H5SB 4Q7CA 1E5KA 2Z87A 3JUJA 5CQLX 1H3MA 1H7GA 1LL2A 3O3PA 3ZLLA 3I0LA 4FIXA 2YQJA 3IOIA 3SXEA 1I52A 1LZ0A 3D98A 2P72A 4NALA 4MNDA 1R7XA 1S4NA 5FU0A 1VZUA 4DE7A 2WE9A 5J49A 4L41C 4NAKA 4Y62A 1R82A 5C38A 4FRQA 2YESA 1ZIZA 1V83A 3N9WA 5BXCA 2XWNA 1V82A 3K8EA 3R2WA 2VK9A 1H7FA 2Y4MA 1R7UA 3T7NA 2PX7A 2JCKA 3SXAA 2V0HA 2D7RA 3CU0A 1GWVA 5FU8A 2RJ7A 1R81A 4Y7FA 5CMGX 3FWWA 4HOCA 2XMHA 1H5SA 1YP3A 4FRAA 2JCJA 4O6NA 3ZLKA 1VICA 1VGUA 3U2WA 1FR8A 1W57A 5C3DA 2RJ1A 4XWIA 5C3BA 1FO9A 1V84A 1ZHJA 2V0LA 4D48A 1FO8A 1PZYB 5FTSA 4EE4A 4CJBA 1JYLA 2PGVA 3OH0A 2YQSA 2Q4JA 2YQHA 1QGSA 1ZDGA 3IOHA 2V0IA 1HM8A 5CQNX 1O0RA 1S4PA 3I0EA 1ZI4A 2BO6A 5L6VA 1INIA 1ZI1A 2I7BA 4AYJA 3OKRA 4M2BA 2FYDB 2BO8A 4MYBA 2OEFA 2Z86A 4E1KA 1HJLA 5D92A 5EJZA 1IIMA 1VZTA 3V8YA 1ON8A 5C1GA 2WVLA 3BCVA 1NWGB 3U0XA 1QWJA 1HJJA 4M28A 2AM4A 1JV3A 1K4VA 1QGQA 2FFVA 3I0KA 2YC3A 2O1FA 3K8DA 3KIAA 4EE5A 3CGXA 2J0AA 2RJ8A 5C3AA 4KXOA 5IDSA 3E25A 5CMFX 2AM5A 1ZCTA 4HCQA 4ZDQA 1VM8A 4ASJA 1H4DA 2E3DA 1H7LA 1LZJA 1NF5B 5CMHA 3PKPA 2I5EA 1G3LA 3E26A 2FYAA 5HS2A 1FG5N 3SXDA 4B4BA 4IRPA 1FGGA 4Y7UA 5C47A 4ECMA 5C1HA 1LL0A 3ZGFA 1HM0A 1IINA 1VH3A 3SX8A 4D0TA 4UEGA 4Y7GA 2CU2A 2RIZA 4P00A 1TW1A 4Y6UA 4DDZA 4FQWA 1NHEB 4FIYA 4FREA 2NXVA 2Y7AA 4CJCA 3NGWA 2OEGA 1OMZA 5I1FA 2O1HA 4KC2A 3U2VA 3I0HA 1O7QA 2RJ5A 1H4CA 1ZJ3A 1HV9A 3CKOA 4G3QA 4EEMA 2BO4A
chains in the Genus database with same CATH topology
4J18A 5FYEA 1FOAA 1H5SD 1GQ9A 5C4EA 3V90A 2AECA 2I5KA 2QGIA 3V0NA 5L6SA 2X5ZA 2JCOA 5EJ1A 1ZCUA 1XZ6A 1G23A 5DDTA 5C4BA 3ZGGA 4B4GA 1G1LA 5C1LA 1VZXA 2RJ6A 5DDVA 4JISA 1H7QA 4AC3A 4NANA 3ST8A 1FXOA 1MC3A 4B2WA 4B5BA 5AJOA 2FFUA 2XMEA 1LL3A 1MP5A 1TZFA 3PNNA 5JQQA 1NQIB 2BO7A 3EE5A 2FYCB 2OI6A 3OC9A 2VSIA 2V0KA 3Q7UA 4AAWA 3D5NA 2JCLA 2QKXA 3OH1A 3U2XA 1H7TA 1Z90A 5CMJA 2W0WA 1ZI5A 3I0GA 3DK5A 3SXBA 5FTVA 2X60A 4Y9XA 4HO6A 4FRMA 1VGWA 2VD4A 4B4MA 5CMIA 2ZU7A 3OH3A 1HM9A 2VS3A 3JTJA 1PZTA 1W77A 1XHBA 2D0JA 3SX5A 2OI5A 5AJPA 4HO4A 4LW6A 3SX3A 3I0FA 3PKQA 4FRHA 4D11C 1TVYA 4FRPA 4BQHA 5C49A 4Y7TA 1MP4A 1G93A 2AH9A 2J0BA 3T7OA 1TW5A 2RIXA 3F1YA 4LW3A 3CKVA 1G97A 2FY7A 1EZIA 4D0ZA 1H5RB 2VS5A 3I0JA 1FWYA 2VXLA 1VGTA 2VFZA 1WVCA 4O6MA 4KPZA 3DUVA 2WVMA 1QG8A 3RSBA 1H5SC 4HG6A 5C36A 4B3UA 2XWLA 1WT3A 4EEOA 4G87A 3USRA 1H5TB 4B42A 3V0LA 3OH4A 1R80A 3HL3A 1R7YA 1VH1A 1O7OA 5FUHA 5C4CA 3JUKA 3USQA 1LVWA 2WAWA 1GX0A 2E8BA 2RJ4A 3BRKX 4KNRA 3OH2A 1LZ7A 3U2UA 4KPXA 1JVDA 2RIYA 2WEEA 1OQMB 2DPWA 2RJ0A 2Y6PA 1R7TA 1H7HA 1VGZA 4FCUA 5C4DA 1EYRA 4ASYA 1GA8A 1R7VA 4HO9A 1H5RA 4HO8A 1FRWA 3D8VA 3SPTA 4EEGA 3R3IA 5D91A 4C2SA 1G9RA 3I0DA 1ZJ2A 2P73A 1ON6A 2XWMA 4D11A 4KNXA 3T7MA 1G0RA 1ZDFA 3POLA 4YS8A 4FCEA 4JD0A 3V0OA 5C4FA 4NAIA 1GWWA 2WGZA 1H5TA 3V91A 4G3SA 1FGXA 2OI7A 3SXGA 1MP3A 3GUEA 4EE3A 4FROA 1FR9A 1ZJ1A 3LW6A 2WVKA 1S4OA 5EIYA 4R7PA 2ZU9A 3V0MA 1JYKA 2A8UA 1FXJA 4KC1A 2D7IA 2PA4A 2AESA 4KC4A 2YQCA 4FRDA 2RITA 3CKJA 4Y7VA 2C0NA 2VSHA 3RMVA 4Y6NA 1WT1A 2MZBA 4HO5A 4HO0A 1G8OA 2RJ9A 1ZCYA 4IRQA 2AM3A 4M2AA 4EEAA 3Q80A 2APCA 1H7EA 3OAMA 3RMWA 2Y4JA 3F1CA 1GX4A 5C48A 1FZWA 1WT2A 4EVWA 4FRBA 1H4EA 1ZJ0A 4HO2A 1WSZA 3U0YA 4M4KA 4GBPA 1JV1A 1OMXA 2VXMA 1SS9A 3CKQA 3OGZA 3V0PA 1ZJOA 5CQMX 3I0IX 1ZCVA 2QH5A 1INJA 1O23B 4G3PA 2Y4KA 4DECA 1YP2A 2V0JA 3CKNA 1G95A 1G2VA 1KWSA 2ICYA 1VPAA 2YCMA 2GGQA 1JVGA 2P6WA 2A8WA 2VS4A 2ICXA 5IDTA 4Y63A 1NMMB 1W55A 3SX7A 5C8RA 1LZIA 4K6RA 2X5SA 3ZF8A 3FOQA 3V8ZA 1WT0A 2AGDA 4ARWA 2ZU8A 2PGYA 3U2TA 3TZTA 5FV9A 2FYBA 5CQOA 4HO3A 4KRVA 2UX8A 3I0CA 4FRLA 4KQLA 1ZJPA 2GGOA 1YROB 5CQPA 3V0QA 5AJNA 3TQDA 3QVBA 2O1GA 2YC5A 4B2XA 4Y64A 4BMAA 4CVHA 1ZI3A 4AYLA 1NKHB 3IOJA 3Q4SA 2X65A 2AE7A 4MIXA 2W0VA 3DJ4A 4CJ8A 1GQCA 4P02A 1YP4A 4KT7A 3SXCA 5IFYA 2Y4LA 1H5SB 4Q7CA 1E5KA 2Z87A 3JUJA 5CQLX 1H3MA 1H7GA 1LL2A 3O3PA 3ZLLA 3I0LA 4FIXA 2YQJA 3IOIA 3SXEA 1I52A 1LZ0A 3D98A 2P72A 4NALA 4MNDA 1R7XA 1S4NA 5FU0A 1VZUA 4DE7A 2WE9A 5J49A 4L41C 4NAKA 4Y62A 1R82A 5C38A 4FRQA 2YESA 1ZIZA 1V83A 3N9WA 5BXCA 2XWNA 1V82A 3K8EA 3R2WA 2VK9A 1H7FA 2Y4MA 1R7UA 3T7NA 2PX7A 2JCKA 3SXAA 2V0HA 2D7RA 3CU0A 1GWVA 5FU8A 2RJ7A 1R81A 4Y7FA 5CMGX 3FWWA 4HOCA 2XMHA 1H5SA 1YP3A 4FRAA 2JCJA 4O6NA 3ZLKA 1VICA 1VGUA 3U2WA 1FR8A 1W57A 5C3DA 2RJ1A 4XWIA 5C3BA 1FO9A 1V84A 1ZHJA 2V0LA 4D48A 1FO8A 1PZYB 5FTSA 4EE4A 4CJBA 1JYLA 2PGVA 3OH0A 2YQSA 2Q4JA 2YQHA 1QGSA 1ZDGA 3IOHA 2V0IA 1HM8A 5CQNX 1O0RA 1S4PA 3I0EA 1ZI4A 2BO6A 5L6VA 1INIA 1ZI1A 2I7BA 4AYJA 3OKRA 4M2BA 2FYDB 2BO8A 4MYBA 2OEFA 2Z86A 4E1KA 1HJLA 5D92A 5EJZA 1IIMA 1VZTA 3V8YA 1ON8A 5C1GA 2WVLA 3BCVA 1NWGB 3U0XA 1QWJA 1HJJA 4M28A 2AM4A 1JV3A 1K4VA 1QGQA 2FFVA 3I0KA 2YC3A 2O1FA 3K8DA 3KIAA 4EE5A 3CGXA 2J0AA 2RJ8A 5C3AA 4KXOA 5IDSA 3E25A 5CMFX 2AM5A 1ZCTA 4HCQA 4ZDQA 1VM8A 4ASJA 1H4DA 2E3DA 1H7LA 1LZJA 1NF5B 5CMHA 3PKPA 2I5EA 1G3LA 3E26A 2FYAA 5HS2A 1FG5N 3SXDA 4B4BA 4IRPA 1FGGA 4Y7UA 5C47A 4ECMA 5C1HA 1LL0A 3ZGFA 1HM0A 1IINA 1VH3A 3SX8A 4D0TA 4UEGA 4Y7GA 2CU2A 2RIZA 4P00A 1TW1A 4Y6UA 4DDZA 4FQWA 1NHEB 4FIYA 4FREA 2NXVA 2Y7AA 4CJCA 3NGWA 2OEGA 1OMZA 5I1FA 2O1HA 4KC2A 3U2VA 3I0HA 1O7QA 2RJ5A 1H4CA 1ZJ3A 1HV9A 3CKOA 4G3QA 4EEMA 2BO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J18 A;  5FYE A;  1FOA A;  1H5S D;  1GQ9 A;  5C4E A;  3V90 A;  2AEC A;  2I5K A;  2QGI A;  3V0N A;  5L6S A;  2X5Z A;  2JCO A;  5EJ1 A;  1ZCU A;  1XZ6 A;  1G23 A;  5DDT A;  5C4B A;  3ZGG A;  4B4G A;  1G1L A;  5C1L A;  1VZX A;  2RJ6 A;  5DDV A;  4JIS A;  1H7Q A;  4AC3 A;  4NAN A;  3ST8 A;  1FXO A;  1MC3 A;  4B2W A;  4B5B A;  5AJO A;  2FFU A;  2XME A;  1LL3 A;  1MP5 A;  1TZF A;  3PNN A;  5JQQ A;  1NQI B;  2BO7 A;  3EE5 A;  2FYC B;  2OI6 A;  3OC9 A;  2VSI A;  2V0K A;  3Q7U A;  4AAW A;  3D5N A;  2JCL A;  2QKX A;  3OH1 A;  3U2X A;  1H7T A;  1Z90 A;  5CMJ A;  2W0W A;  1ZI5 A;  3I0G A;  3DK5 A;  3SXB A;  5FTV A;  2X60 A;  4Y9X A;  4HO6 A;  4FRM A;  1VGW A;  2VD4 A;  4B4M A;  5CMI A;  2ZU7 A;  3OH3 A;  1HM9 A;  2VS3 A;  3JTJ A;  1PZT A;  1W77 A;  1XHB A;  2D0J A;  3SX5 A;  2OI5 A;  5AJP A;  4HO4 A;  4LW6 A;  3SX3 A;  3I0F A;  3PKQ A;  4FRH A;  4D11 C;  1TVY A;  4FRP A;  4BQH A;  5C49 A;  4Y7T A;  1MP4 A;  1G93 A;  2AH9 A;  3T7O A;  1TW5 A;  2RIX A;  3F1Y A;  4LW3 A;  3CKV A;  1G97 A;  2FY7 A;  1EZI A;  4D0Z A;  1H5R B;  2VS5 A;  3I0J A;  1FWY A;  2VXL A;  1VGT A;  2VFZ A;  1WVC A;  4KPZ A;  3DUV A;  2WVM A;  1QG8 A;  3RSB A;  1H5S C;  4HG6 A;  5C36 A;  4B3U A;  2XWL A;  1WT3 A;  4EEO A;  4G87 A;  3USR A;  1H5T B;  4B42 A;  3V0L A;  3OH4 A;  1R80 A;  3HL3 A;  1R7Y A;  1VH1 A;  1O7O A;  5FUH A;  5C4C A;  3JUK A;  3USQ A;  1LVW A;  2WAW A;  1GX0 A;  2E8B A;  2RJ4 A;  3BRK X;  4KNR A;  3OH2 A;  1LZ7 A;  3U2U A;  4KPX A;  1JVD A;  2RIY A;  2WEE A;  1OQM B;  2DPW A;  2RJ0 A;  2Y6P A;  1R7T A;  1H7H A;  1VGZ A;  4FCU A;  5C4D A;  1EYR A;  4ASY A;  1GA8 A;  1R7V A;  4HO9 A;  1H5R A;  4HO8 A;  1FRW A;  3D8V A;  3SPT A;  4EEG A;  3R3I A;  4C2S A;  1G9R A;  3I0D A;  1ZJ2 A;  2P73 A;  1ON6 A;  2XWM A;  4D11 A;  4KNX A;  3T7M A;  1G0R A;  1ZDF A;  3POL A;  4YS8 A;  4FCE A;  4JD0 A;  3V0O A;  5C4F A;  4NAI A;  1GWW A;  2WGZ A;  1H5T A;  3V91 A;  4G3S A;  1FGX A;  2OI7 A;  3SXG A;  1MP3 A;  3GUE A;  4EE3 A;  4FRO A;  1FR9 A;  1ZJ1 A;  3LW6 A;  2WVK A;  1S4O A;  5EIY A;  4R7P A;  2ZU9 A;  3V0M A;  1JYK A;  2A8U A;  1FXJ A;  4KC1 A;  2D7I A;  2PA4 A;  2AES A;  4KC4 A;  2YQC A;  4FRD A;  2RIT A;  3CKJ A;  4Y7V A;  2VSH A;  3RMV A;  4Y6N A;  1WT1 A;  2MZB A;  4HO5 A;  4HO0 A;  1G8O A;  2RJ9 A;  1ZCY A;  4IRQ A;  2AM3 A;  4M2A A;  4EEA A;  3Q80 A;  2APC A;  1H7E A;  3OAM A;  3RMW A;  2Y4J A;  3F1C A;  1GX4 A;  5C48 A;  1FZW A;  1WT2 A;  4EVW A;  4FRB A;  1H4E A;  1ZJ0 A;  4HO2 A;  1WSZ A;  3U0Y A;  4M4K A;  4GBP A;  1JV1 A;  1OMX A;  2VXM A;  1SS9 A;  3CKQ A;  3OGZ A;  3V0P A;  1ZJO A;  5CQM X;  3I0I X;  1ZCV A;  2QH5 A;  1INJ A;  1O23 B;  4G3P A;  2Y4K A;  4DEC A;  1YP2 A;  2V0J A;  3CKN A;  1G95 A;  1G2V A;  1KWS A;  2ICY A;  1VPA A;  2YCM A;  2GGQ A;  1JVG A;  2P6W A;  2A8W A;  2VS4 A;  2ICX A;  5IDT A;  4Y63 A;  1NMM B;  1W55 A;  3SX7 A;  5C8R A;  1LZI A;  4K6R A;  2X5S A;  3ZF8 A;  3FOQ A;  3V8Z A;  1WT0 A;  2AGD A;  4ARW A;  2ZU8 A;  2PGY A;  3U2T A;  3TZT A;  5FV9 A;  2FYB A;  5CQO A;  4HO3 A;  4KRV A;  2UX8 A;  3I0C A;  4FRL A;  4KQL A;  1ZJP A;  2GGO A;  1YRO B;  5CQP A;  3V0Q A;  5AJN A;  3TQD A;  3QVB A;  2O1G A;  2YC5 A;  4B2X A;  4Y64 A;  4BMA A;  4CVH A;  1ZI3 A;  4AYL A;  1NKH B;  3IOJ A;  3Q4S A;  2X65 A;  2AE7 A;  2W0V A;  3DJ4 A;  4CJ8 A;  1GQC A;  4P02 A;  1YP4 A;  4KT7 A;  3SXC A;  5IFY A;  2Y4L A;  1H5S B;  1E5K A;  2Z87 A;  3JUJ A;  5CQL X;  1H3M A;  1H7G A;  1LL2 A;  3O3P A;  3ZLL A;  3I0L A;  2YQJ A;  3IOI A;  3SXE A;  1I52 A;  1LZ0 A;  3D98 A;  2P72 A;  4NAL A;  4MND A;  1R7X A;  1S4N A;  5FU0 A;  1VZU A;  4DE7 A;  2WE9 A;  5J49 A;  4L41 C;  4NAK A;  4Y62 A;  1R82 A;  5C38 A;  4FRQ A;  2YES A;  1ZIZ A;  1V83 A;  3N9W A;  5BXC A;  2XWN A;  1V82 A;  3K8E A;  3R2W A;  1H7F A;  2Y4M A;  1R7U A;  3T7N A;  2PX7 A;  2JCK A;  3SXA A;  2V0H A;  2D7R A;  3CU0 A;  1GWV A;  5FU8 A;  2RJ7 A;  1R81 A;  4Y7F A;  5CMG X;  3FWW A;  4HOC A;  2XMH A;  1H5S A;  1YP3 A;  4FRA A;  2JCJ A;  3ZLK A;  1VIC A;  1VGU A;  3U2W A;  1FR8 A;  1W57 A;  5C3D A;  2RJ1 A;  4XWI A;  5C3B A;  1FO9 A;  1V84 A;  1ZHJ A;  2V0L A;  4D48 A;  1FO8 A;  1PZY B;  5FTS A;  4EE4 A;  4CJB A;  1JYL A;  2PGV A;  3OH0 A;  2YQS A;  2Q4J A;  2YQH A;  1QGS A;  1ZDG A;  3IOH A;  2V0I A;  1HM8 A;  5CQN X;  1O0R A;  1S4P A;  3I0E A;  1ZI4 A;  2BO6 A;  5L6V A;  1INI A;  1ZI1 A;  2I7B A;  4AYJ A;  3OKR A;  4M2B A;  2FYD B;  2BO8 A;  4MYB A;  2OEF A;  2Z86 A;  4E1K A;  1HJL A;  5EJZ A;  1IIM A;  1VZT A;  3V8Y A;  1ON8 A;  5C1G A;  2WVL A;  3BCV A;  1NWG B;  3U0X A;  1QWJ A;  1HJJ A;  4M28 A;  2AM4 A;  1JV3 A;  1K4V A;  1QGQ A;  2FFV A;  3I0K A;  2YC3 A;  2O1F A;  3K8D A;  3KIA A;  4EE5 A;  3CGX A;  2RJ8 A;  5C3A A;  4KXO A;  5IDS A;  3E25 A;  5CMF X;  2AM5 A;  1ZCT A;  4HCQ A;  4ZDQ A;  1VM8 A;  4ASJ A;  1H4D A;  2E3D A;  1H7L A;  1LZJ A;  1NF5 B;  5CMH A;  3PKP A;  2I5E A;  1G3L A;  3E26 A;  2FYA A;  5HS2 A;  1FG5 N;  3SXD A;  4B4B A;  4IRP A;  1FGG A;  4Y7U A;  5C47 A;  4ECM A;  5C1H A;  1LL0 A;  3ZGF A;  1HM0 A;  1IIN A;  1VH3 A;  3SX8 A;  4D0T A;  4UEG A;  4Y7G A;  2CU2 A;  2RIZ A;  4P00 A;  1TW1 A;  4Y6U A;  4DDZ A;  4FQW A;  1NHE B;  4FRE A;  2NXV A;  2Y7A A;  4CJC A;  3NGW A;  2OEG A;  1OMZ A;  5I1F A;  2O1H A;  4KC2 A;  3U2V A;  3I0H A;  1O7Q A;  2RJ5 A;  1H4C A;  1ZJ3 A;  1HV9 A;  3CKO A;  4G3Q A;  4EEM A;  2BO4 A; 
#chains in the Genus database with same CATH topology
 4J18 A;  5FYE A;  1FOA A;  1H5S D;  1GQ9 A;  5C4E A;  3V90 A;  2AEC A;  2I5K A;  2QGI A;  3V0N A;  5L6S A;  2X5Z A;  2JCO A;  5EJ1 A;  1ZCU A;  1XZ6 A;  1G23 A;  5DDT A;  5C4B A;  3ZGG A;  4B4G A;  1G1L A;  5C1L A;  1VZX A;  2RJ6 A;  5DDV A;  4JIS A;  1H7Q A;  4AC3 A;  4NAN A;  3ST8 A;  1FXO A;  1MC3 A;  4B2W A;  4B5B A;  5AJO A;  2FFU A;  2XME A;  1LL3 A;  1MP5 A;  1TZF A;  3PNN A;  5JQQ A;  1NQI B;  2BO7 A;  3EE5 A;  2FYC B;  2OI6 A;  3OC9 A;  2VSI A;  2V0K A;  3Q7U A;  4AAW A;  3D5N A;  2JCL A;  2QKX A;  3OH1 A;  3U2X A;  1H7T A;  1Z90 A;  5CMJ A;  2W0W A;  1ZI5 A;  3I0G A;  3DK5 A;  3SXB A;  5FTV A;  2X60 A;  4Y9X A;  4HO6 A;  4FRM A;  1VGW A;  2VD4 A;  4B4M A;  5CMI A;  2ZU7 A;  3OH3 A;  1HM9 A;  2VS3 A;  3JTJ A;  1PZT A;  1W77 A;  1XHB A;  2D0J A;  3SX5 A;  2OI5 A;  5AJP A;  4HO4 A;  4LW6 A;  3SX3 A;  3I0F A;  3PKQ A;  4FRH A;  4D11 C;  1TVY A;  4FRP A;  4BQH A;  5C49 A;  4Y7T A;  1MP4 A;  1G93 A;  2AH9 A;  2J0B A;  3T7O A;  1TW5 A;  2RIX A;  3F1Y A;  4LW3 A;  3CKV A;  1G97 A;  2FY7 A;  1EZI A;  4D0Z A;  1H5R B;  2VS5 A;  3I0J A;  1FWY A;  2VXL A;  1VGT A;  2VFZ A;  1WVC A;  4O6M A;  4KPZ A;  3DUV A;  2WVM A;  1QG8 A;  3RSB A;  1H5S C;  4HG6 A;  5C36 A;  4B3U A;  2XWL A;  1WT3 A;  4EEO A;  4G87 A;  3USR A;  1H5T B;  4B42 A;  3V0L A;  3OH4 A;  1R80 A;  3HL3 A;  1R7Y A;  1VH1 A;  1O7O A;  5FUH A;  5C4C A;  3JUK A;  3USQ A;  1LVW A;  2WAW A;  1GX0 A;  2E8B A;  2RJ4 A;  3BRK X;  4KNR A;  3OH2 A;  1LZ7 A;  3U2U A;  4KPX A;  1JVD A;  2RIY A;  2WEE A;  1OQM B;  2DPW A;  2RJ0 A;  2Y6P A;  1R7T A;  1H7H A;  1VGZ A;  4FCU A;  5C4D A;  1EYR A;  4ASY A;  1GA8 A;  1R7V A;  4HO9 A;  1H5R A;  4HO8 A;  1FRW A;  3D8V A;  3SPT A;  4EEG A;  3R3I A;  5D91 A;  4C2S A;  1G9R A;  3I0D A;  1ZJ2 A;  2P73 A;  1ON6 A;  2XWM A;  4D11 A;  4KNX A;  3T7M A;  1G0R A;  1ZDF A;  3POL A;  4YS8 A;  4FCE A;  4JD0 A;  3V0O A;  5C4F A;  4NAI A;  1GWW A;  2WGZ A;  1H5T A;  3V91 A;  4G3S A;  1FGX A;  2OI7 A;  3SXG A;  1MP3 A;  3GUE A;  4EE3 A;  4FRO A;  1FR9 A;  1ZJ1 A;  3LW6 A;  2WVK A;  1S4O A;  5EIY A;  4R7P A;  2ZU9 A;  3V0M A;  1JYK A;  2A8U A;  1FXJ A;  4KC1 A;  2D7I A;  2PA4 A;  2AES A;  4KC4 A;  2YQC A;  4FRD A;  2RIT A;  3CKJ A;  4Y7V A;  2C0N A;  2VSH A;  3RMV A;  4Y6N A;  1WT1 A;  2MZB A;  4HO5 A;  4HO0 A;  1G8O A;  2RJ9 A;  1ZCY A;  4IRQ A;  2AM3 A;  4M2A A;  4EEA A;  3Q80 A;  2APC A;  1H7E A;  3OAM A;  3RMW A;  2Y4J A;  3F1C A;  1GX4 A;  5C48 A;  1FZW A;  1WT2 A;  4EVW A;  4FRB A;  1H4E A;  1ZJ0 A;  4HO2 A;  1WSZ A;  3U0Y A;  4M4K A;  4GBP A;  1JV1 A;  1OMX A;  2VXM A;  1SS9 A;  3CKQ A;  3OGZ A;  3V0P A;  1ZJO A;  5CQM X;  3I0I X;  1ZCV A;  2QH5 A;  1INJ A;  1O23 B;  4G3P A;  2Y4K A;  4DEC A;  1YP2 A;  2V0J A;  3CKN A;  1G95 A;  1G2V A;  1KWS A;  2ICY A;  1VPA A;  2YCM A;  2GGQ A;  1JVG A;  2P6W A;  2A8W A;  2VS4 A;  2ICX A;  5IDT A;  4Y63 A;  1NMM B;  1W55 A;  3SX7 A;  5C8R A;  1LZI A;  4K6R A;  2X5S A;  3ZF8 A;  3FOQ A;  3V8Z A;  1WT0 A;  2AGD A;  4ARW A;  2ZU8 A;  2PGY A;  3U2T A;  3TZT A;  5FV9 A;  2FYB A;  5CQO A;  4HO3 A;  4KRV A;  2UX8 A;  3I0C A;  4FRL A;  4KQL A;  1ZJP A;  2GGO A;  1YRO B;  5CQP A;  3V0Q A;  5AJN A;  3TQD A;  3QVB A;  2O1G A;  2YC5 A;  4B2X A;  4Y64 A;  4BMA A;  4CVH A;  1ZI3 A;  4AYL A;  1NKH B;  3IOJ A;  3Q4S A;  2X65 A;  2AE7 A;  4MIX A;  2W0V A;  3DJ4 A;  4CJ8 A;  1GQC A;  4P02 A;  1YP4 A;  4KT7 A;  3SXC A;  5IFY A;  2Y4L A;  1H5S B;  4Q7C A;  1E5K A;  2Z87 A;  3JUJ A;  5CQL X;  1H3M A;  1H7G A;  1LL2 A;  3O3P A;  3ZLL A;  3I0L A;  4FIX A;  2YQJ A;  3IOI A;  3SXE A;  1I52 A;  1LZ0 A;  3D98 A;  2P72 A;  4NAL A;  4MND A;  1R7X A;  1S4N A;  5FU0 A;  1VZU A;  4DE7 A;  2WE9 A;  5J49 A;  4L41 C;  4NAK A;  4Y62 A;  1R82 A;  5C38 A;  4FRQ A;  2YES A;  1ZIZ A;  1V83 A;  3N9W A;  5BXC A;  2XWN A;  1V82 A;  3K8E A;  3R2W A;  2VK9 A;  1H7F A;  2Y4M A;  1R7U A;  3T7N A;  2PX7 A;  2JCK A;  3SXA A;  2V0H A;  2D7R A;  3CU0 A;  1GWV A;  5FU8 A;  2RJ7 A;  1R81 A;  4Y7F A;  5CMG X;  3FWW A;  4HOC A;  2XMH A;  1H5S A;  1YP3 A;  4FRA A;  2JCJ A;  4O6N A;  3ZLK A;  1VIC A;  1VGU A;  3U2W A;  1FR8 A;  1W57 A;  5C3D A;  2RJ1 A;  4XWI A;  5C3B A;  1FO9 A;  1V84 A;  1ZHJ A;  2V0L A;  4D48 A;  1FO8 A;  1PZY B;  5FTS A;  4EE4 A;  4CJB A;  1JYL A;  2PGV A;  3OH0 A;  2YQS A;  2Q4J A;  2YQH A;  1QGS A;  1ZDG A;  3IOH A;  2V0I A;  1HM8 A;  5CQN X;  1O0R A;  1S4P A;  3I0E A;  1ZI4 A;  2BO6 A;  5L6V A;  1INI A;  1ZI1 A;  2I7B A;  4AYJ A;  3OKR A;  4M2B A;  2FYD B;  2BO8 A;  4MYB A;  2OEF A;  2Z86 A;  4E1K A;  1HJL A;  5D92 A;  5EJZ A;  1IIM A;  1VZT A;  3V8Y A;  1ON8 A;  5C1G A;  2WVL A;  3BCV A;  1NWG B;  3U0X A;  1QWJ A;  1HJJ A;  4M28 A;  2AM4 A;  1JV3 A;  1K4V A;  1QGQ A;  2FFV A;  3I0K A;  2YC3 A;  2O1F A;  3K8D A;  3KIA A;  4EE5 A;  3CGX A;  2J0A A;  2RJ8 A;  5C3A A;  4KXO A;  5IDS A;  3E25 A;  5CMF X;  2AM5 A;  1ZCT A;  4HCQ A;  4ZDQ A;  1VM8 A;  4ASJ A;  1H4D A;  2E3D A;  1H7L A;  1LZJ A;  1NF5 B;  5CMH A;  3PKP A;  2I5E A;  1G3L A;  3E26 A;  2FYA A;  5HS2 A;  1FG5 N;  3SXD A;  4B4B A;  4IRP A;  1FGG A;  4Y7U A;  5C47 A;  4ECM A;  5C1H A;  1LL0 A;  3ZGF A;  1HM0 A;  1IIN A;  1VH3 A;  3SX8 A;  4D0T A;  4UEG A;  4Y7G A;  2CU2 A;  2RIZ A;  4P00 A;  1TW1 A;  4Y6U A;  4DDZ A;  4FQW A;  1NHE B;  4FIY A;  4FRE A;  2NXV A;  2Y7A A;  4CJC A;  3NGW A;  2OEG A;  1OMZ A;  5I1F A;  2O1H A;  4KC2 A;  3U2V A;  3I0H A;  1O7Q A;  2RJ5 A;  1H4C A;  1ZJ3 A;  1HV9 A;  3CKO A;  4G3Q A;  4EEM A;  2BO4 A; 
#chains in the Genus database with same CATH homology
 4J18 A;  5FYE A;  1FOA A;  1H5S D;  1GQ9 A;  5C4E A;  3V90 A;  2AEC A;  2I5K A;  2QGI A;  3V0N A;  5L6S A;  2X5Z A;  2JCO A;  5EJ1 A;  1ZCU A;  1XZ6 A;  1G23 A;  5DDT A;  5C4B A;  3ZGG A;  4B4G A;  1G1L A;  5C1L A;  1VZX A;  2RJ6 A;  5DDV A;  4JIS A;  1H7Q A;  4AC3 A;  4NAN A;  3ST8 A;  1FXO A;  1MC3 A;  4B2W A;  4B5B A;  5AJO A;  2FFU A;  2XME A;  1LL3 A;  1MP5 A;  1TZF A;  3PNN A;  5JQQ A;  1NQI B;  2BO7 A;  3EE5 A;  2FYC B;  2OI6 A;  3OC9 A;  2VSI A;  2V0K A;  3Q7U A;  4AAW A;  3D5N A;  2JCL A;  2QKX A;  3OH1 A;  3U2X A;  1H7T A;  1Z90 A;  5CMJ A;  2W0W A;  1ZI5 A;  3I0G A;  3DK5 A;  3SXB A;  5FTV A;  2X60 A;  4Y9X A;  4HO6 A;  4FRM A;  1VGW A;  2VD4 A;  4B4M A;  5CMI A;  2ZU7 A;  3OH3 A;  1HM9 A;  2VS3 A;  3JTJ A;  1PZT A;  1W77 A;  1XHB A;  2D0J A;  3SX5 A;  2OI5 A;  5AJP A;  4HO4 A;  4LW6 A;  3SX3 A;  3I0F A;  3PKQ A;  4FRH A;  4D11 C;  1TVY A;  4FRP A;  4BQH A;  5C49 A;  4Y7T A;  1MP4 A;  1G93 A;  2AH9 A;  2J0B A;  3T7O A;  1TW5 A;  2RIX A;  3F1Y A;  4LW3 A;  3CKV A;  1G97 A;  2FY7 A;  1EZI A;  4D0Z A;  1H5R B;  2VS5 A;  3I0J A;  1FWY A;  2VXL A;  1VGT A;  2VFZ A;  1WVC A;  4O6M A;  4KPZ A;  3DUV A;  2WVM A;  1QG8 A;  3RSB A;  1H5S C;  4HG6 A;  5C36 A;  4B3U A;  2XWL A;  1WT3 A;  4EEO A;  4G87 A;  3USR A;  1H5T B;  4B42 A;  3V0L A;  3OH4 A;  1R80 A;  3HL3 A;  1R7Y A;  1VH1 A;  1O7O A;  5FUH A;  5C4C A;  3JUK A;  3USQ A;  1LVW A;  2WAW A;  1GX0 A;  2E8B A;  2RJ4 A;  3BRK X;  4KNR A;  3OH2 A;  1LZ7 A;  3U2U A;  4KPX A;  1JVD A;  2RIY A;  2WEE A;  1OQM B;  2DPW A;  2RJ0 A;  2Y6P A;  1R7T A;  1H7H A;  1VGZ A;  4FCU A;  5C4D A;  1EYR A;  4ASY A;  1GA8 A;  1R7V A;  4HO9 A;  1H5R A;  4HO8 A;  1FRW A;  3D8V A;  3SPT A;  4EEG A;  3R3I A;  5D91 A;  4C2S A;  1G9R A;  3I0D A;  1ZJ2 A;  2P73 A;  1ON6 A;  2XWM A;  4D11 A;  4KNX A;  3T7M A;  1G0R A;  1ZDF A;  3POL A;  4YS8 A;  4FCE A;  4JD0 A;  3V0O A;  5C4F A;  4NAI A;  1GWW A;  2WGZ A;  1H5T A;  3V91 A;  4G3S A;  1FGX A;  2OI7 A;  3SXG A;  1MP3 A;  3GUE A;  4EE3 A;  4FRO A;  1FR9 A;  1ZJ1 A;  3LW6 A;  2WVK A;  1S4O A;  5EIY A;  4R7P A;  2ZU9 A;  3V0M A;  1JYK A;  2A8U A;  1FXJ A;  4KC1 A;  2D7I A;  2PA4 A;  2AES A;  4KC4 A;  2YQC A;  4FRD A;  2RIT A;  3CKJ A;  4Y7V A;  2C0N A;  2VSH A;  3RMV A;  4Y6N A;  1WT1 A;  2MZB A;  4HO5 A;  4HO0 A;  1G8O A;  2RJ9 A;  1ZCY A;  4IRQ A;  2AM3 A;  4M2A A;  4EEA A;  3Q80 A;  2APC A;  1H7E A;  3OAM A;  3RMW A;  2Y4J A;  3F1C A;  1GX4 A;  5C48 A;  1FZW A;  1WT2 A;  4EVW A;  4FRB A;  1H4E A;  1ZJ0 A;  4HO2 A;  1WSZ A;  3U0Y A;  4M4K A;  4GBP A;  1JV1 A;  1OMX A;  2VXM A;  1SS9 A;  3CKQ A;  3OGZ A;  3V0P A;  1ZJO A;  5CQM X;  3I0I X;  1ZCV A;  2QH5 A;  1INJ A;  1O23 B;  4G3P A;  2Y4K A;  4DEC A;  1YP2 A;  2V0J A;  3CKN A;  1G95 A;  1G2V A;  1KWS A;  2ICY A;  1VPA A;  2YCM A;  2GGQ A;  1JVG A;  2P6W A;  2A8W A;  2VS4 A;  2ICX A;  5IDT A;  4Y63 A;  1NMM B;  1W55 A;  3SX7 A;  5C8R A;  1LZI A;  4K6R A;  2X5S A;  3ZF8 A;  3FOQ A;  3V8Z A;  1WT0 A;  2AGD A;  4ARW A;  2ZU8 A;  2PGY A;  3U2T A;  3TZT A;  5FV9 A;  2FYB A;  5CQO A;  4HO3 A;  4KRV A;  2UX8 A;  3I0C A;  4FRL A;  4KQL A;  1ZJP A;  2GGO A;  1YRO B;  5CQP A;  3V0Q A;  5AJN A;  3TQD A;  3QVB A;  2O1G A;  2YC5 A;  4B2X A;  4Y64 A;  4BMA A;  4CVH A;  1ZI3 A;  4AYL A;  1NKH B;  3IOJ A;  3Q4S A;  2X65 A;  2AE7 A;  4MIX A;  2W0V A;  3DJ4 A;  4CJ8 A;  1GQC A;  4P02 A;  1YP4 A;  4KT7 A;  3SXC A;  5IFY A;  2Y4L A;  1H5S B;  4Q7C A;  1E5K A;  2Z87 A;  3JUJ A;  5CQL X;  1H3M A;  1H7G A;  1LL2 A;  3O3P A;  3ZLL A;  3I0L A;  4FIX A;  2YQJ A;  3IOI A;  3SXE A;  1I52 A;  1LZ0 A;  3D98 A;  2P72 A;  4NAL A;  4MND A;  1R7X A;  1S4N A;  5FU0 A;  1VZU A;  4DE7 A;  2WE9 A;  5J49 A;  4L41 C;  4NAK A;  4Y62 A;  1R82 A;  5C38 A;  4FRQ A;  2YES A;  1ZIZ A;  1V83 A;  3N9W A;  5BXC A;  2XWN A;  1V82 A;  3K8E A;  3R2W A;  2VK9 A;  1H7F A;  2Y4M A;  1R7U A;  3T7N A;  2PX7 A;  2JCK A;  3SXA A;  2V0H A;  2D7R A;  3CU0 A;  1GWV A;  5FU8 A;  2RJ7 A;  1R81 A;  4Y7F A;  5CMG X;  3FWW A;  4HOC A;  2XMH A;  1H5S A;  1YP3 A;  4FRA A;  2JCJ A;  4O6N A;  3ZLK A;  1VIC A;  1VGU A;  3U2W A;  1FR8 A;  1W57 A;  5C3D A;  2RJ1 A;  4XWI A;  5C3B A;  1FO9 A;  1V84 A;  1ZHJ A;  2V0L A;  4D48 A;  1FO8 A;  1PZY B;  5FTS A;  4EE4 A;  4CJB A;  1JYL A;  2PGV A;  3OH0 A;  2YQS A;  2Q4J A;  2YQH A;  1QGS A;  1ZDG A;  3IOH A;  2V0I A;  1HM8 A;  5CQN X;  1O0R A;  1S4P A;  3I0E A;  1ZI4 A;  2BO6 A;  5L6V A;  1INI A;  1ZI1 A;  2I7B A;  4AYJ A;  3OKR A;  4M2B A;  2FYD B;  2BO8 A;  4MYB A;  2OEF A;  2Z86 A;  4E1K A;  1HJL A;  5D92 A;  5EJZ A;  1IIM A;  1VZT A;  3V8Y A;  1ON8 A;  5C1G A;  2WVL A;  3BCV A;  1NWG B;  3U0X A;  1QWJ A;  1HJJ A;  4M28 A;  2AM4 A;  1JV3 A;  1K4V A;  1QGQ A;  2FFV A;  3I0K A;  2YC3 A;  2O1F A;  3K8D A;  3KIA A;  4EE5 A;  3CGX A;  2J0A A;  2RJ8 A;  5C3A A;  4KXO A;  5IDS A;  3E25 A;  5CMF X;  2AM5 A;  1ZCT A;  4HCQ A;  4ZDQ A;  1VM8 A;  4ASJ A;  1H4D A;  2E3D A;  1H7L A;  1LZJ A;  1NF5 B;  5CMH A;  3PKP A;  2I5E A;  1G3L A;  3E26 A;  2FYA A;  5HS2 A;  1FG5 N;  3SXD A;  4B4B A;  4IRP A;  1FGG A;  4Y7U A;  5C47 A;  4ECM A;  5C1H A;  1LL0 A;  3ZGF A;  1HM0 A;  1IIN A;  1VH3 A;  3SX8 A;  4D0T A;  4UEG A;  4Y7G A;  2CU2 A;  2RIZ A;  4P00 A;  1TW1 A;  4Y6U A;  4DDZ A;  4FQW A;  1NHE B;  4FIY A;  4FRE A;  2NXV A;  2Y7A A;  4CJC A;  3NGW A;  2OEG A;  1OMZ A;  5I1F A;  2O1H A;  4KC2 A;  3U2V A;  3I0H A;  1O7Q A;  2RJ5 A;  1H4C A;  1ZJ3 A;  1HV9 A;  3CKO A;  4G3Q A;  4EEM A;  2BO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...