5C3BA

Crystal structure of abba + udp-c-gal (long soak) + di
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
285
structure length
277
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histo-blood group ABO system transferase
publication title High Resolution Structures of the Human ABO(H) Blood Group Enzymes in Complex with Donor Analogs Reveal That the Enzymes Utilize Multiple Donor Conformations to Bind Substrates in a Stepwise Manner.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 277
sequence length 285
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2015-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5c3bA00
1FXJA 5CMJA 1H7GA 4CJCA 1GWWA 2FYDB 1MP4A 1YP4A 1R7YA 4M2AA 4KPXA 3FOQA 3ZF8A 1H5SC 4GBPA 4B2WA 3JUJA 2D0JA 3JTJA 4JD0A 1QGQA 2RJ7A 5C4EA 3RMWA 1FO9A 1ON6A 2O1FA 2JCJA 2JCOA 4DE7A 2RJ6A 1EYRA 2Y4LA 2X65A 2X5SA 3R3IA 4AC3A 3OH2A 2VSHA 2V0HA 3CKJA 1VPAA 2VSIA 2AGDA 2JCKA 1ZI3A 3PKPA 1V83A 1VGUA 1WT0A 4LW3A 4HO6A 2O1HA 4NAKA 2JCLA 1WSZA 2VXLA 1G3LA 4IRPA 3ST8A 1GQ9A 2AE7A 2AESA 1O7QA 2AM3A 3R2WA 3SXDA 4FREA 4D11A 5C1GA 1ZJ0A 2BO8A 1EZIA 3GUEA 1ZI1A 3V90A 2QH5A 5DDTA 1QG8A 2MZBA 1XZ6A 2ZU8A 5C48A 2DPWA 4KQLA 3K8DA 4ASJA 5JQQA 3Q4SA 2XMHA 1WT2A 2WVLA 3V0QA 2OI6A 2V0KA 1ZDFA 3SX3A 3OH0A 3U2TA 3TZTA 5CQNX 2RJ0A 1ZCTA 4FRAA 3T7OA 3V8ZA 1LZIA 5FU8A 4DDZA 5C1LA 1H5SA 4EVWA 2RJ4A 2V0IA 4G3QA 1YP3A 2ICYA 2V0JA 5CMGX 3V0PA 1WT1A 3OGZA 4B2XA 2A8UA 2RIYA 2Y4KA 1NWGB 4HOCA 1HM9A 2XWNA 1GQCA 2BO4A 2WGZA 4FRQA 1G9RA 3PKQA 4EEGA 4HO3A 4FCUA 4KNXA 4NALA 1V84A 3OH3A 2ICXA 1LZ7A 3F1YA 2D7IA 2BO6A 3I0KA 1VZTA 4EEMA 3POLA 1JV1A 2FFVA 2RIXA 1NHEB 4MYBA 1S4PA 1GWVA 1JYLA 1VICA 5IFYA 1NMMB 1JYKA 2QKXA 5DDVA 5C4DA 3N9WA 4KC1A 1MP5A 2P6WA 4FCEA 5C49A 5FTVA 1ZDGA 1ZJOA 1IINA 2YQCA 2E8BA 1G0RA 1NKHB 1JV3A 5CMFX 3SXEA 1ZHJA 1OQMB 4P02A 2YQSA 2O1GA 4FRLA 4KC2A 4YS8A 3BRKX 2FY7A 1GX0A 4E1KA 4B5BA 5J49A 1O7OA 1LL2A 1H5SB 1HJJA 4HG6A 3OH4A 2VD4A 1O0RA 4FRBA 1HM0A 1H7EA 3SXAA 4J18A 2AM4A 3I0CA 1FG5N 1HJLA 1HV9A 4B4MA 4KRVA 3E26A 3CGXA 3I0EA 2Z86A 4EE5A 3DK5A 2Y6PA 3ZLLA 1PZYB 5C8RA 1TZFA 1VH3A 5L6VA 1GX4A 1QWJA 4D0TA 1R7VA 5EIYA 1H5SD 1W57A 1FXOA 2CU2A 1ZJPA 2VS4A 5CQMX 4Y6NA 2I5EA 2YQJA 3IOHA 4BQHA 5C3BA 4MNDA 1ZCUA 1NQIB 3T7MA 4Y7UA 4KC4A 4LW6A 5I1FA 3ZGFA 3OC9A 1R7XA 1H7FA 4G87A 4B3UA 3QVBA 3D5NA 4B42A 2Y4JA 4Y64A 2PX7A 5EJ1A 2AH9A 3EE5A 1R81A 3RMVA 3SPTA 5C38A 2RJ1A 1ZCVA 3T7NA 1ZJ1A 2WVKA 4K6RA 4Y63A 4AYJA 2P73A 4FRDA 3I0FA 2AECA 2VS5A 1PZTA 2I5KA 1H3MA 1R7TA 1R80A 1LVWA 2VFZA 4B4GA 2PGYA 2RIZA 2W0VA 3V0OA 1R7UA 3V0MA 3DJ4A 2OEFA 4Y9XA 5CQOA 4ECMA 2YC5A 2APCA 3I0IX 2X60A 1VGZA 5FTSA 1MC3A 3TQDA 3K8EA 2QGIA 1G8OA 1YROB 1IIMA 3E25A 5CQLX 5C36A 2YCMA 4NAIA 4ARWA 1FRWA 4M4KA 4FROA 4EE3A 1H4EA 4ASYA 5C3DA 3CU0A 3CKOA 2OEGA 1H7HA 2BO7A 3PNNA 2XWLA 3I0JA 2XWMA 3CKQA 5AJPA 5AJOA 1LZ0A 1VGWA 2FYBA 3U2UA 1H4DA 1INJA 3ZLKA 5C1HA 2YESA 5CMHA 1TVYA 5IDSA 1K4VA 4HO4A 4IRQA 2PA4A 1VH1A 2OI7A 4P00A 4JISA 4KT7A 4EE4A 4Y7GA 2Q4JA 4HO8A 3SX8A 1H5TA 1O23B 3D98A 1ZCYA 1H7TA 4M2BA 2V0LA 2FFUA 3CKVA 4Y7FA 3I0LA 4G3PA 4CJBA 3JUKA 1E5KA 3Q7UA 3F1CA 2YC3A 4CJ8A 2YQHA 3O3PA 1H7QA 1VZXA 4Y7TA 1FWYA 1G97A 1FOAA 4G3SA 4HO2A 3U2WA 1ON8A 3SX7A 1S4NA 3SXGA 4FRHA 5FYEA 2ZU7A 5HS2A 5FUHA 3RSBA 4Y7VA 4BMAA 1G23A 3CKNA 1FZWA 2VXMA 1ZI4A 2D7RA 1WT3A 3BCVA 5AJNA 2GGQA 4EEAA 2Y4MA 3DUVA 3IOIA 3I0GA 5CMIA 3V91A 5C4CA 1XHBA 2Y7AA 5EJZA 2XMEA 2WAWA 1FO8A 4FQWA 2X5ZA 1KWSA 4R7PA 3NGWA 3HL3A 4HO5A 5FV9A 1FGXA 4HCQA 3LW6A 5C4FA 3OH1A 4D0ZA 4L41C 3IOJA 1WVCA 2FYCB 4D48A 4KNRA 4B4BA 1VM8A 2A8WA 1MP3A 3I0HA 1VGTA 1QGSA 2W0WA 3FWWA 4HO9A 3OAMA 4ZDQA 3OKRA 1H5TB 2VS3A 2P72A 2RJ9A 3V0NA 1V82A 1I52A 5C4BA 1H4CA 1W77A 4UEGA 5IDTA 2NXVA 2OI5A 1H5RA 1ZJ3A 1LL3A 3I0DA 2I7BA 2RITA 4C2SA 1TW5A 2E3DA 1VZUA 5L6SA 1INIA 3U0YA 2AM5A 3U2VA 4XWIA 3SXCA 1G2VA 3U2XA 2RJ5A 4AAWA 3USRA 2FYAA 2WVMA 1FGGA 5C3AA 3SXBA 2ZU9A 5BXCA 1ZJ2A 1FR8A 1ZIZA 3D8VA 5C47A 4CVHA 1OMXA 1NF5B 4NANA 4Y62A 5CQPA 1W55A 3V8YA 3U0XA 1Z90A 1JVDA 1R82A 1G95A 1LL0A 1S4OA 2UX8A 1HM8A 4HO0A 4EEOA 2PGVA 3V0LA 2WE9A 1ZI5A 1SS9A 4Y6UA 4FRPA 5FU0A 1JVGA 4FRMA 4D11C 2WEEA 1H7LA 2GGOA 1G1LA 4M28A 1GA8A 2RJ8A 3Q80A 4KPZA 3ZGGA 4DECA 4AYLA 1OMZA 2Z87A 3KIAA 1YP2A 1G93A 1LZJA 4KXOA 1FR9A 1H5RB 3USQA 3SX5A 1TW1A
chains in the Genus database with same CATH superfamily
1FXJA 5CMJA 1H7GA 4CJCA 1GWWA 2FYDB 1MP4A 1YP4A 1R7YA 4M2AA 4FIXA 4KPXA 3FOQA 5D92A 3ZF8A 1H5SC 4GBPA 4B2WA 3JUJA 2D0JA 5D91A 3JTJA 4JD0A 1QGQA 2RJ7A 5C4EA 3RMWA 1FO9A 1ON6A 2O1FA 2JCJA 2JCOA 4DE7A 2RJ6A 1EYRA 2Y4LA 2X65A 2X5SA 3R3IA 4AC3A 3OH2A 2VSHA 2V0HA 3CKJA 1VPAA 2VSIA 2AGDA 2JCKA 1ZI3A 3PKPA 1V83A 1VGUA 1WT0A 4LW3A 4HO6A 2O1HA 4NAKA 2JCLA 1WSZA 2VXLA 1G3LA 4IRPA 3ST8A 1GQ9A 2AE7A 2AESA 1O7QA 2AM3A 3R2WA 3SXDA 4FREA 4D11A 5C1GA 1ZJ0A 2BO8A 1EZIA 2VK9A 3GUEA 1ZI1A 3V90A 2QH5A 5DDTA 1QG8A 2MZBA 1XZ6A 2ZU8A 5C48A 2DPWA 4KQLA 3K8DA 4ASJA 5JQQA 3Q4SA 2XMHA 1WT2A 2WVLA 3V0QA 2OI6A 2V0KA 1ZDFA 3SX3A 3OH0A 3U2TA 3TZTA 5CQNX 2RJ0A 1ZCTA 4FRAA 3T7OA 3V8ZA 1LZIA 5FU8A 4DDZA 5C1LA 1H5SA 4EVWA 2RJ4A 2V0IA 4G3QA 1YP3A 2ICYA 2V0JA 5CMGX 3V0PA 1WT1A 3OGZA 4B2XA 4MIXA 2A8UA 2RIYA 2Y4KA 1NWGB 4HOCA 1HM9A 2XWNA 1GQCA 2BO4A 2WGZA 4FRQA 1G9RA 3PKQA 4EEGA 4HO3A 4FCUA 4KNXA 4NALA 1V84A 3OH3A 2ICXA 1LZ7A 3F1YA 2D7IA 2BO6A 3I0KA 1VZTA 4EEMA 3POLA 1JV1A 2FFVA 2J0BA 2RIXA 1NHEB 4MYBA 1S4PA 1GWVA 1JYLA 1VICA 5IFYA 1NMMB 1JYKA 2QKXA 5DDVA 5C4DA 3N9WA 4KC1A 1MP5A 2P6WA 4FCEA 5C49A 5FTVA 1ZDGA 1ZJOA 1IINA 2YQCA 2E8BA 1G0RA 1NKHB 1JV3A 5CMFX 3SXEA 1ZHJA 1OQMB 4P02A 2YQSA 2O1GA 4FRLA 4KC2A 4YS8A 3BRKX 2FY7A 1GX0A 4E1KA 4B5BA 5J49A 1O7OA 1LL2A 1H5SB 1HJJA 4HG6A 3OH4A 4Q7CA 2VD4A 1O0RA 4FRBA 1HM0A 1H7EA 3SXAA 4J18A 2AM4A 3I0CA 1FG5N 1HJLA 1HV9A 4B4MA 4KRVA 3E26A 3CGXA 3I0EA 2Z86A 4EE5A 3DK5A 2Y6PA 3ZLLA 1PZYB 5C8RA 1TZFA 1VH3A 5L6VA 1GX4A 1QWJA 4D0TA 1R7VA 5EIYA 1H5SD 1W57A 1FXOA 2CU2A 1ZJPA 2VS4A 5CQMX 4Y6NA 2I5EA 2YQJA 3IOHA 4BQHA 5C3BA 4MNDA 1ZCUA 1NQIB 3T7MA 4Y7UA 4KC4A 4LW6A 5I1FA 3ZGFA 3OC9A 1R7XA 1H7FA 4G87A 4B3UA 3QVBA 3D5NA 4B42A 2Y4JA 4Y64A 2PX7A 5EJ1A 2AH9A 3EE5A 1R81A 3RMVA 3SPTA 5C38A 2RJ1A 1ZCVA 3T7NA 1ZJ1A 2WVKA 4K6RA 4Y63A 4AYJA 2P73A 4FRDA 3I0FA 2AECA 2VS5A 1PZTA 2I5KA 1H3MA 1R7TA 1R80A 1LVWA 2VFZA 4B4GA 2PGYA 2RIZA 2W0VA 3V0OA 1R7UA 3V0MA 3DJ4A 2OEFA 4Y9XA 5CQOA 4ECMA 2YC5A 2APCA 3I0IX 2X60A 1VGZA 5FTSA 1MC3A 3TQDA 3K8EA 4FIYA 2QGIA 1G8OA 1YROB 1IIMA 3E25A 5CQLX 5C36A 2YCMA 4NAIA 4ARWA 1FRWA 4M4KA 4FROA 4EE3A 1H4EA 4ASYA 5C3DA 3CU0A 3CKOA 2OEGA 1H7HA 2BO7A 3PNNA 2XWLA 3I0JA 2XWMA 3CKQA 5AJPA 5AJOA 1LZ0A 1VGWA 2FYBA 3U2UA 1H4DA 1INJA 3ZLKA 5C1HA 2YESA 5CMHA 1TVYA 5IDSA 1K4VA 4HO4A 4IRQA 2PA4A 1VH1A 2OI7A 4P00A 4JISA 4KT7A 4EE4A 4Y7GA 2Q4JA 4HO8A 3SX8A 1H5TA 1O23B 3D98A 1ZCYA 1H7TA 4M2BA 2V0LA 2FFUA 3CKVA 4Y7FA 3I0LA 4G3PA 4CJBA 3JUKA 1E5KA 3Q7UA 3F1CA 2YC3A 4CJ8A 2YQHA 3O3PA 1H7QA 1VZXA 4Y7TA 1FWYA 1G97A 1FOAA 4G3SA 4HO2A 3U2WA 1ON8A 3SX7A 1S4NA 3SXGA 4FRHA 5FYEA 2ZU7A 5HS2A 5FUHA 3RSBA 4Y7VA 4BMAA 1G23A 3CKNA 1FZWA 2VXMA 1ZI4A 2D7RA 1WT3A 3BCVA 5AJNA 2GGQA 4EEAA 2Y4MA 3DUVA 3IOIA 3I0GA 5CMIA 3V91A 5C4CA 1XHBA 2Y7AA 5EJZA 2XMEA 2WAWA 1FO8A 4FQWA 2X5ZA 1KWSA 4R7PA 3NGWA 3HL3A 4HO5A 5FV9A 1FGXA 4HCQA 3LW6A 5C4FA 3OH1A 4D0ZA 4L41C 3IOJA 1WVCA 2FYCB 4D48A 4KNRA 4B4BA 1VM8A 2A8WA 1MP3A 3I0HA 1VGTA 2C0NA 1QGSA 2W0WA 3FWWA 4HO9A 3OAMA 4ZDQA 3OKRA 1H5TB 2VS3A 2P72A 2RJ9A 3V0NA 1V82A 1I52A 5C4BA 1H4CA 1W77A 4UEGA 5IDTA 2NXVA 2OI5A 1H5RA 1ZJ3A 1LL3A 3I0DA 2I7BA 2RITA 4C2SA 1TW5A 2E3DA 1VZUA 5L6SA 1INIA 3U0YA 2AM5A 3U2VA 4XWIA 3SXCA 1G2VA 3U2XA 2RJ5A 4AAWA 3USRA 2FYAA 2WVMA 1FGGA 5C3AA 3SXBA 2ZU9A 5BXCA 1ZJ2A 1FR8A 1ZIZA 3D8VA 5C47A 4CVHA 1OMXA 2J0AA 1NF5B 4NANA 4Y62A 5CQPA 1W55A 4O6NA 3V8YA 3U0XA 1Z90A 1JVDA 1R82A 1G95A 1LL0A 1S4OA 2UX8A 1HM8A 4HO0A 4EEOA 2PGVA 3V0LA 2WE9A 4O6MA 1ZI5A 1SS9A 4Y6UA 4FRPA 5FU0A 1JVGA 4FRMA 4D11C 2WEEA 1H7LA 2GGOA 1G1LA 4M28A 1GA8A 2RJ8A 3Q80A 4KPZA 3ZGGA 4DECA 4AYLA 1OMZA 2Z87A 3KIAA 1YP2A 1G93A 1LZJA 4KXOA 1FR9A 1H5RB 3USQA 3SX5A 1TW1A
chains in the Genus database with same CATH topology
1FXJA 5CMJA 1H7GA 4CJCA 1GWWA 2FYDB 1MP4A 1YP4A 1R7YA 4M2AA 4FIXA 4KPXA 3FOQA 5D92A 3ZF8A 1H5SC 4GBPA 4B2WA 3JUJA 2D0JA 5D91A 3JTJA 4JD0A 1QGQA 2RJ7A 5C4EA 3RMWA 1FO9A 1ON6A 2O1FA 2JCJA 2JCOA 4DE7A 2RJ6A 1EYRA 2Y4LA 2X65A 2X5SA 3R3IA 4AC3A 3OH2A 2VSHA 2V0HA 3CKJA 1VPAA 2VSIA 2AGDA 2JCKA 1ZI3A 3PKPA 1V83A 1VGUA 1WT0A 4LW3A 4HO6A 2O1HA 4NAKA 2JCLA 1WSZA 2VXLA 1G3LA 4IRPA 3ST8A 1GQ9A 2AE7A 2AESA 1O7QA 2AM3A 3R2WA 3SXDA 4FREA 4D11A 5C1GA 1ZJ0A 2BO8A 1EZIA 2VK9A 3GUEA 1ZI1A 3V90A 2QH5A 5DDTA 1QG8A 2MZBA 1XZ6A 2ZU8A 5C48A 2DPWA 4KQLA 3K8DA 4ASJA 5JQQA 3Q4SA 2XMHA 1WT2A 2WVLA 3V0QA 2OI6A 2V0KA 1ZDFA 3SX3A 3OH0A 3U2TA 3TZTA 5CQNX 2RJ0A 1ZCTA 4FRAA 3T7OA 3V8ZA 1LZIA 5FU8A 4DDZA 5C1LA 1H5SA 4EVWA 2RJ4A 2V0IA 4G3QA 1YP3A 2ICYA 2V0JA 5CMGX 3V0PA 1WT1A 3OGZA 4B2XA 4MIXA 2A8UA 2RIYA 2Y4KA 1NWGB 4HOCA 1HM9A 2XWNA 1GQCA 2BO4A 2WGZA 4FRQA 1G9RA 3PKQA 4EEGA 4HO3A 4FCUA 4KNXA 4NALA 1V84A 3OH3A 2ICXA 1LZ7A 3F1YA 2D7IA 2BO6A 3I0KA 1VZTA 4EEMA 3POLA 1JV1A 2FFVA 2J0BA 2RIXA 1NHEB 4MYBA 1S4PA 1GWVA 1JYLA 1VICA 5IFYA 1NMMB 1JYKA 2QKXA 5DDVA 5C4DA 3N9WA 4KC1A 1MP5A 2P6WA 4FCEA 5C49A 5FTVA 1ZDGA 1ZJOA 1IINA 2YQCA 2E8BA 1G0RA 1NKHB 1JV3A 5CMFX 3SXEA 1ZHJA 1OQMB 4P02A 2YQSA 2O1GA 4FRLA 4KC2A 4YS8A 3BRKX 2FY7A 1GX0A 4E1KA 4B5BA 5J49A 1O7OA 1LL2A 1H5SB 1HJJA 4HG6A 3OH4A 4Q7CA 2VD4A 1O0RA 4FRBA 1HM0A 1H7EA 3SXAA 4J18A 2AM4A 3I0CA 1FG5N 1HJLA 1HV9A 4B4MA 4KRVA 3E26A 3CGXA 3I0EA 2Z86A 4EE5A 3DK5A 2Y6PA 3ZLLA 1PZYB 5C8RA 1TZFA 1VH3A 5L6VA 1GX4A 1QWJA 4D0TA 1R7VA 5EIYA 1H5SD 1W57A 1FXOA 2CU2A 1ZJPA 2VS4A 5CQMX 4Y6NA 2I5EA 2YQJA 3IOHA 4BQHA 5C3BA 4MNDA 1ZCUA 1NQIB 3T7MA 4Y7UA 4KC4A 4LW6A 5I1FA 3ZGFA 3OC9A 1R7XA 1H7FA 4G87A 4B3UA 3QVBA 3D5NA 4B42A 2Y4JA 4Y64A 2PX7A 5EJ1A 2AH9A 3EE5A 1R81A 3RMVA 3SPTA 5C38A 2RJ1A 1ZCVA 3T7NA 1ZJ1A 2WVKA 4K6RA 4Y63A 4AYJA 2P73A 4FRDA 3I0FA 2AECA 2VS5A 1PZTA 2I5KA 1H3MA 1R7TA 1R80A 1LVWA 2VFZA 4B4GA 2PGYA 2RIZA 2W0VA 3V0OA 1R7UA 3V0MA 3DJ4A 2OEFA 4Y9XA 5CQOA 4ECMA 2YC5A 2APCA 3I0IX 2X60A 1VGZA 5FTSA 1MC3A 3TQDA 3K8EA 4FIYA 2QGIA 1G8OA 1YROB 1IIMA 3E25A 5CQLX 5C36A 2YCMA 4NAIA 4ARWA 1FRWA 4M4KA 4FROA 4EE3A 1H4EA 4ASYA 5C3DA 3CU0A 3CKOA 2OEGA 1H7HA 2BO7A 3PNNA 2XWLA 3I0JA 2XWMA 3CKQA 5AJPA 5AJOA 1LZ0A 1VGWA 2FYBA 3U2UA 1H4DA 1INJA 3ZLKA 5C1HA 2YESA 5CMHA 1TVYA 5IDSA 1K4VA 4HO4A 4IRQA 2PA4A 1VH1A 2OI7A 4P00A 4JISA 4KT7A 4EE4A 4Y7GA 2Q4JA 4HO8A 3SX8A 1H5TA 1O23B 3D98A 1ZCYA 1H7TA 4M2BA 2V0LA 2FFUA 3CKVA 4Y7FA 3I0LA 4G3PA 4CJBA 3JUKA 1E5KA 3Q7UA 3F1CA 2YC3A 4CJ8A 2YQHA 3O3PA 1H7QA 1VZXA 4Y7TA 1FWYA 1G97A 1FOAA 4G3SA 4HO2A 3U2WA 1ON8A 3SX7A 1S4NA 3SXGA 4FRHA 5FYEA 2ZU7A 5HS2A 5FUHA 3RSBA 4Y7VA 4BMAA 1G23A 3CKNA 1FZWA 2VXMA 1ZI4A 2D7RA 1WT3A 3BCVA 5AJNA 2GGQA 4EEAA 2Y4MA 3DUVA 3IOIA 3I0GA 5CMIA 3V91A 5C4CA 1XHBA 2Y7AA 5EJZA 2XMEA 2WAWA 1FO8A 4FQWA 2X5ZA 1KWSA 4R7PA 3NGWA 3HL3A 4HO5A 5FV9A 1FGXA 4HCQA 3LW6A 5C4FA 3OH1A 4D0ZA 4L41C 3IOJA 1WVCA 2FYCB 4D48A 4KNRA 4B4BA 1VM8A 2A8WA 1MP3A 3I0HA 1VGTA 2C0NA 1QGSA 2W0WA 3FWWA 4HO9A 3OAMA 4ZDQA 3OKRA 1H5TB 2VS3A 2P72A 2RJ9A 3V0NA 1V82A 1I52A 5C4BA 1H4CA 1W77A 4UEGA 5IDTA 2NXVA 2OI5A 1H5RA 1ZJ3A 1LL3A 3I0DA 2I7BA 2RITA 4C2SA 1TW5A 2E3DA 1VZUA 5L6SA 1INIA 3U0YA 2AM5A 3U2VA 4XWIA 3SXCA 1G2VA 3U2XA 2RJ5A 4AAWA 3USRA 2FYAA 2WVMA 1FGGA 5C3AA 3SXBA 2ZU9A 5BXCA 1ZJ2A 1FR8A 1ZIZA 3D8VA 5C47A 4CVHA 1OMXA 2J0AA 1NF5B 4NANA 4Y62A 5CQPA 1W55A 4O6NA 3V8YA 3U0XA 1Z90A 1JVDA 1R82A 1G95A 1LL0A 1S4OA 2UX8A 1HM8A 4HO0A 4EEOA 2PGVA 3V0LA 2WE9A 4O6MA 1ZI5A 1SS9A 4Y6UA 4FRPA 5FU0A 1JVGA 4FRMA 4D11C 2WEEA 1H7LA 2GGOA 1G1LA 4M28A 1GA8A 2RJ8A 3Q80A 4KPZA 3ZGGA 4DECA 4AYLA 1OMZA 2Z87A 3KIAA 1YP2A 1G93A 1LZJA 4KXOA 1FR9A 1H5RB 3USQA 3SX5A 1TW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FXJ A;  5CMJ A;  1H7G A;  4CJC A;  1GWW A;  2FYD B;  1MP4 A;  1YP4 A;  1R7Y A;  4M2A A;  4KPX A;  3FOQ A;  3ZF8 A;  1H5S C;  4GBP A;  4B2W A;  3JUJ A;  2D0J A;  3JTJ A;  4JD0 A;  1QGQ A;  2RJ7 A;  5C4E A;  3RMW A;  1FO9 A;  1ON6 A;  2O1F A;  2JCJ A;  2JCO A;  4DE7 A;  2RJ6 A;  1EYR A;  2Y4L A;  2X65 A;  2X5S A;  3R3I A;  4AC3 A;  3OH2 A;  2VSH A;  2V0H A;  3CKJ A;  1VPA A;  2VSI A;  2AGD A;  2JCK A;  1ZI3 A;  3PKP A;  1V83 A;  1VGU A;  1WT0 A;  4LW3 A;  4HO6 A;  2O1H A;  4NAK A;  2JCL A;  1WSZ A;  2VXL A;  1G3L A;  4IRP A;  3ST8 A;  1GQ9 A;  2AE7 A;  2AES A;  1O7Q A;  2AM3 A;  3R2W A;  3SXD A;  4FRE A;  4D11 A;  5C1G A;  1ZJ0 A;  2BO8 A;  1EZI A;  3GUE A;  1ZI1 A;  3V90 A;  2QH5 A;  5DDT A;  1QG8 A;  2MZB A;  1XZ6 A;  2ZU8 A;  5C48 A;  2DPW A;  4KQL A;  3K8D A;  4ASJ A;  5JQQ A;  3Q4S A;  2XMH A;  1WT2 A;  2WVL A;  3V0Q A;  2OI6 A;  2V0K A;  1ZDF A;  3SX3 A;  3OH0 A;  3U2T A;  3TZT A;  5CQN X;  2RJ0 A;  1ZCT A;  4FRA A;  3T7O A;  3V8Z A;  1LZI A;  5FU8 A;  4DDZ A;  5C1L A;  1H5S A;  4EVW A;  2RJ4 A;  2V0I A;  4G3Q A;  1YP3 A;  2ICY A;  2V0J A;  5CMG X;  3V0P A;  1WT1 A;  3OGZ A;  4B2X A;  2A8U A;  2RIY A;  2Y4K A;  1NWG B;  4HOC A;  1HM9 A;  2XWN A;  1GQC A;  2BO4 A;  2WGZ A;  4FRQ A;  1G9R A;  3PKQ A;  4EEG A;  4HO3 A;  4FCU A;  4KNX A;  4NAL A;  1V84 A;  3OH3 A;  2ICX A;  1LZ7 A;  3F1Y A;  2D7I A;  2BO6 A;  3I0K A;  1VZT A;  4EEM A;  3POL A;  1JV1 A;  2FFV A;  2RIX A;  1NHE B;  4MYB A;  1S4P A;  1GWV A;  1JYL A;  1VIC A;  5IFY A;  1NMM B;  1JYK A;  2QKX A;  5DDV A;  5C4D A;  3N9W A;  4KC1 A;  1MP5 A;  2P6W A;  4FCE A;  5C49 A;  5FTV A;  1ZDG A;  1ZJO A;  1IIN A;  2YQC A;  2E8B A;  1G0R A;  1NKH B;  1JV3 A;  5CMF X;  3SXE A;  1ZHJ A;  1OQM B;  4P02 A;  2YQS A;  2O1G A;  4FRL A;  4KC2 A;  4YS8 A;  3BRK X;  2FY7 A;  1GX0 A;  4E1K A;  4B5B A;  5J49 A;  1O7O A;  1LL2 A;  1H5S B;  1HJJ A;  4HG6 A;  3OH4 A;  2VD4 A;  1O0R A;  4FRB A;  1HM0 A;  1H7E A;  3SXA A;  4J18 A;  2AM4 A;  3I0C A;  1FG5 N;  1HJL A;  1HV9 A;  4B4M A;  4KRV A;  3E26 A;  3CGX A;  3I0E A;  2Z86 A;  4EE5 A;  3DK5 A;  2Y6P A;  3ZLL A;  1PZY B;  5C8R A;  1TZF A;  1VH3 A;  5L6V A;  1GX4 A;  1QWJ A;  4D0T A;  1R7V A;  5EIY A;  1H5S D;  1W57 A;  1FXO A;  2CU2 A;  1ZJP A;  2VS4 A;  5CQM X;  4Y6N A;  2I5E A;  2YQJ A;  3IOH A;  4BQH A;  5C3B A;  4MND A;  1ZCU A;  1NQI B;  3T7M A;  4Y7U A;  4KC4 A;  4LW6 A;  5I1F A;  3ZGF A;  3OC9 A;  1R7X A;  1H7F A;  4G87 A;  4B3U A;  3QVB A;  3D5N A;  4B42 A;  2Y4J A;  4Y64 A;  2PX7 A;  5EJ1 A;  2AH9 A;  3EE5 A;  1R81 A;  3RMV A;  3SPT A;  5C38 A;  2RJ1 A;  1ZCV A;  3T7N A;  1ZJ1 A;  2WVK A;  4K6R A;  4Y63 A;  4AYJ A;  2P73 A;  4FRD A;  3I0F A;  2AEC A;  2VS5 A;  1PZT A;  2I5K A;  1H3M A;  1R7T A;  1R80 A;  1LVW A;  2VFZ A;  4B4G A;  2PGY A;  2RIZ A;  2W0V A;  3V0O A;  1R7U A;  3V0M A;  3DJ4 A;  2OEF A;  4Y9X A;  5CQO A;  4ECM A;  2YC5 A;  2APC A;  3I0I X;  2X60 A;  1VGZ A;  5FTS A;  1MC3 A;  3TQD A;  3K8E A;  2QGI A;  1G8O A;  1YRO B;  1IIM A;  3E25 A;  5CQL X;  5C36 A;  2YCM A;  4NAI A;  4ARW A;  1FRW A;  4M4K A;  4FRO A;  4EE3 A;  1H4E A;  4ASY A;  5C3D A;  3CU0 A;  3CKO A;  2OEG A;  1H7H A;  2BO7 A;  3PNN A;  2XWL A;  3I0J A;  2XWM A;  3CKQ A;  5AJP A;  5AJO A;  1LZ0 A;  1VGW A;  2FYB A;  3U2U A;  1H4D A;  1INJ A;  3ZLK A;  5C1H A;  2YES A;  5CMH A;  1TVY A;  5IDS A;  1K4V A;  4HO4 A;  4IRQ A;  2PA4 A;  1VH1 A;  2OI7 A;  4P00 A;  4JIS A;  4KT7 A;  4EE4 A;  4Y7G A;  2Q4J A;  4HO8 A;  3SX8 A;  1H5T A;  1O23 B;  3D98 A;  1ZCY A;  1H7T A;  4M2B A;  2V0L A;  2FFU A;  3CKV A;  4Y7F A;  3I0L A;  4G3P A;  4CJB A;  3JUK A;  1E5K A;  3Q7U A;  3F1C A;  2YC3 A;  4CJ8 A;  2YQH A;  3O3P A;  1H7Q A;  1VZX A;  4Y7T A;  1FWY A;  1G97 A;  1FOA A;  4G3S A;  4HO2 A;  3U2W A;  1ON8 A;  3SX7 A;  1S4N A;  3SXG A;  4FRH A;  5FYE A;  2ZU7 A;  5HS2 A;  5FUH A;  3RSB A;  4Y7V A;  4BMA A;  1G23 A;  3CKN A;  1FZW A;  2VXM A;  1ZI4 A;  2D7R A;  1WT3 A;  3BCV A;  5AJN A;  2GGQ A;  4EEA A;  2Y4M A;  3DUV A;  3IOI A;  3I0G A;  5CMI A;  3V91 A;  5C4C A;  1XHB A;  2Y7A A;  5EJZ A;  2XME A;  2WAW A;  1FO8 A;  4FQW A;  2X5Z A;  1KWS A;  4R7P A;  3NGW A;  3HL3 A;  4HO5 A;  5FV9 A;  1FGX A;  4HCQ A;  3LW6 A;  5C4F A;  3OH1 A;  4D0Z A;  4L41 C;  3IOJ A;  1WVC A;  2FYC B;  4D48 A;  4KNR A;  4B4B A;  1VM8 A;  2A8W A;  1MP3 A;  3I0H A;  1VGT A;  1QGS A;  2W0W A;  3FWW A;  4HO9 A;  3OAM A;  4ZDQ A;  3OKR A;  1H5T B;  2VS3 A;  2P72 A;  2RJ9 A;  3V0N A;  1V82 A;  1I52 A;  5C4B A;  1H4C A;  1W77 A;  4UEG A;  5IDT A;  2NXV A;  2OI5 A;  1H5R A;  1ZJ3 A;  1LL3 A;  3I0D A;  2I7B A;  2RIT A;  4C2S A;  1TW5 A;  2E3D A;  1VZU A;  5L6S A;  1INI A;  3U0Y A;  2AM5 A;  3U2V A;  4XWI A;  3SXC A;  1G2V A;  3U2X A;  2RJ5 A;  4AAW A;  3USR A;  2FYA A;  2WVM A;  1FGG A;  5C3A A;  3SXB A;  2ZU9 A;  5BXC A;  1ZJ2 A;  1FR8 A;  1ZIZ A;  3D8V A;  5C47 A;  4CVH A;  1OMX A;  1NF5 B;  4NAN A;  4Y62 A;  5CQP A;  1W55 A;  3V8Y A;  3U0X A;  1Z90 A;  1JVD A;  1R82 A;  1G95 A;  1LL0 A;  1S4O A;  2UX8 A;  1HM8 A;  4HO0 A;  4EEO A;  2PGV A;  3V0L A;  2WE9 A;  1ZI5 A;  1SS9 A;  4Y6U A;  4FRP A;  5FU0 A;  1JVG A;  4FRM A;  4D11 C;  2WEE A;  1H7L A;  2GGO A;  1G1L A;  4M28 A;  1GA8 A;  2RJ8 A;  3Q80 A;  4KPZ A;  3ZGG A;  4DEC A;  4AYL A;  1OMZ A;  2Z87 A;  3KIA A;  1YP2 A;  1G93 A;  1LZJ A;  4KXO A;  1FR9 A;  1H5R B;  3USQ A;  3SX5 A;  1TW1 A; 
#chains in the Genus database with same CATH topology
 1FXJ A;  5CMJ A;  1H7G A;  4CJC A;  1GWW A;  2FYD B;  1MP4 A;  1YP4 A;  1R7Y A;  4M2A A;  4FIX A;  4KPX A;  3FOQ A;  5D92 A;  3ZF8 A;  1H5S C;  4GBP A;  4B2W A;  3JUJ A;  2D0J A;  5D91 A;  3JTJ A;  4JD0 A;  1QGQ A;  2RJ7 A;  5C4E A;  3RMW A;  1FO9 A;  1ON6 A;  2O1F A;  2JCJ A;  2JCO A;  4DE7 A;  2RJ6 A;  1EYR A;  2Y4L A;  2X65 A;  2X5S A;  3R3I A;  4AC3 A;  3OH2 A;  2VSH A;  2V0H A;  3CKJ A;  1VPA A;  2VSI A;  2AGD A;  2JCK A;  1ZI3 A;  3PKP A;  1V83 A;  1VGU A;  1WT0 A;  4LW3 A;  4HO6 A;  2O1H A;  4NAK A;  2JCL A;  1WSZ A;  2VXL A;  1G3L A;  4IRP A;  3ST8 A;  1GQ9 A;  2AE7 A;  2AES A;  1O7Q A;  2AM3 A;  3R2W A;  3SXD A;  4FRE A;  4D11 A;  5C1G A;  1ZJ0 A;  2BO8 A;  1EZI A;  2VK9 A;  3GUE A;  1ZI1 A;  3V90 A;  2QH5 A;  5DDT A;  1QG8 A;  2MZB A;  1XZ6 A;  2ZU8 A;  5C48 A;  2DPW A;  4KQL A;  3K8D A;  4ASJ A;  5JQQ A;  3Q4S A;  2XMH A;  1WT2 A;  2WVL A;  3V0Q A;  2OI6 A;  2V0K A;  1ZDF A;  3SX3 A;  3OH0 A;  3U2T A;  3TZT A;  5CQN X;  2RJ0 A;  1ZCT A;  4FRA A;  3T7O A;  3V8Z A;  1LZI A;  5FU8 A;  4DDZ A;  5C1L A;  1H5S A;  4EVW A;  2RJ4 A;  2V0I A;  4G3Q A;  1YP3 A;  2ICY A;  2V0J A;  5CMG X;  3V0P A;  1WT1 A;  3OGZ A;  4B2X A;  4MIX A;  2A8U A;  2RIY A;  2Y4K A;  1NWG B;  4HOC A;  1HM9 A;  2XWN A;  1GQC A;  2BO4 A;  2WGZ A;  4FRQ A;  1G9R A;  3PKQ A;  4EEG A;  4HO3 A;  4FCU A;  4KNX A;  4NAL A;  1V84 A;  3OH3 A;  2ICX A;  1LZ7 A;  3F1Y A;  2D7I A;  2BO6 A;  3I0K A;  1VZT A;  4EEM A;  3POL A;  1JV1 A;  2FFV A;  2J0B A;  2RIX A;  1NHE B;  4MYB A;  1S4P A;  1GWV A;  1JYL A;  1VIC A;  5IFY A;  1NMM B;  1JYK A;  2QKX A;  5DDV A;  5C4D A;  3N9W A;  4KC1 A;  1MP5 A;  2P6W A;  4FCE A;  5C49 A;  5FTV A;  1ZDG A;  1ZJO A;  1IIN A;  2YQC A;  2E8B A;  1G0R A;  1NKH B;  1JV3 A;  5CMF X;  3SXE A;  1ZHJ A;  1OQM B;  4P02 A;  2YQS A;  2O1G A;  4FRL A;  4KC2 A;  4YS8 A;  3BRK X;  2FY7 A;  1GX0 A;  4E1K A;  4B5B A;  5J49 A;  1O7O A;  1LL2 A;  1H5S B;  1HJJ A;  4HG6 A;  3OH4 A;  4Q7C A;  2VD4 A;  1O0R A;  4FRB A;  1HM0 A;  1H7E A;  3SXA A;  4J18 A;  2AM4 A;  3I0C A;  1FG5 N;  1HJL A;  1HV9 A;  4B4M A;  4KRV A;  3E26 A;  3CGX A;  3I0E A;  2Z86 A;  4EE5 A;  3DK5 A;  2Y6P A;  3ZLL A;  1PZY B;  5C8R A;  1TZF A;  1VH3 A;  5L6V A;  1GX4 A;  1QWJ A;  4D0T A;  1R7V A;  5EIY A;  1H5S D;  1W57 A;  1FXO A;  2CU2 A;  1ZJP A;  2VS4 A;  5CQM X;  4Y6N A;  2I5E A;  2YQJ A;  3IOH A;  4BQH A;  5C3B A;  4MND A;  1ZCU A;  1NQI B;  3T7M A;  4Y7U A;  4KC4 A;  4LW6 A;  5I1F A;  3ZGF A;  3OC9 A;  1R7X A;  1H7F A;  4G87 A;  4B3U A;  3QVB A;  3D5N A;  4B42 A;  2Y4J A;  4Y64 A;  2PX7 A;  5EJ1 A;  2AH9 A;  3EE5 A;  1R81 A;  3RMV A;  3SPT A;  5C38 A;  2RJ1 A;  1ZCV A;  3T7N A;  1ZJ1 A;  2WVK A;  4K6R A;  4Y63 A;  4AYJ A;  2P73 A;  4FRD A;  3I0F A;  2AEC A;  2VS5 A;  1PZT A;  2I5K A;  1H3M A;  1R7T A;  1R80 A;  1LVW A;  2VFZ A;  4B4G A;  2PGY A;  2RIZ A;  2W0V A;  3V0O A;  1R7U A;  3V0M A;  3DJ4 A;  2OEF A;  4Y9X A;  5CQO A;  4ECM A;  2YC5 A;  2APC A;  3I0I X;  2X60 A;  1VGZ A;  5FTS A;  1MC3 A;  3TQD A;  3K8E A;  4FIY A;  2QGI A;  1G8O A;  1YRO B;  1IIM A;  3E25 A;  5CQL X;  5C36 A;  2YCM A;  4NAI A;  4ARW A;  1FRW A;  4M4K A;  4FRO A;  4EE3 A;  1H4E A;  4ASY A;  5C3D A;  3CU0 A;  3CKO A;  2OEG A;  1H7H A;  2BO7 A;  3PNN A;  2XWL A;  3I0J A;  2XWM A;  3CKQ A;  5AJP A;  5AJO A;  1LZ0 A;  1VGW A;  2FYB A;  3U2U A;  1H4D A;  1INJ A;  3ZLK A;  5C1H A;  2YES A;  5CMH A;  1TVY A;  5IDS A;  1K4V A;  4HO4 A;  4IRQ A;  2PA4 A;  1VH1 A;  2OI7 A;  4P00 A;  4JIS A;  4KT7 A;  4EE4 A;  4Y7G A;  2Q4J A;  4HO8 A;  3SX8 A;  1H5T A;  1O23 B;  3D98 A;  1ZCY A;  1H7T A;  4M2B A;  2V0L A;  2FFU A;  3CKV A;  4Y7F A;  3I0L A;  4G3P A;  4CJB A;  3JUK A;  1E5K A;  3Q7U A;  3F1C A;  2YC3 A;  4CJ8 A;  2YQH A;  3O3P A;  1H7Q A;  1VZX A;  4Y7T A;  1FWY A;  1G97 A;  1FOA A;  4G3S A;  4HO2 A;  3U2W A;  1ON8 A;  3SX7 A;  1S4N A;  3SXG A;  4FRH A;  5FYE A;  2ZU7 A;  5HS2 A;  5FUH A;  3RSB A;  4Y7V A;  4BMA A;  1G23 A;  3CKN A;  1FZW A;  2VXM A;  1ZI4 A;  2D7R A;  1WT3 A;  3BCV A;  5AJN A;  2GGQ A;  4EEA A;  2Y4M A;  3DUV A;  3IOI A;  3I0G A;  5CMI A;  3V91 A;  5C4C A;  1XHB A;  2Y7A A;  5EJZ A;  2XME A;  2WAW A;  1FO8 A;  4FQW A;  2X5Z A;  1KWS A;  4R7P A;  3NGW A;  3HL3 A;  4HO5 A;  5FV9 A;  1FGX A;  4HCQ A;  3LW6 A;  5C4F A;  3OH1 A;  4D0Z A;  4L41 C;  3IOJ A;  1WVC A;  2FYC B;  4D48 A;  4KNR A;  4B4B A;  1VM8 A;  2A8W A;  1MP3 A;  3I0H A;  1VGT A;  2C0N A;  1QGS A;  2W0W A;  3FWW A;  4HO9 A;  3OAM A;  4ZDQ A;  3OKR A;  1H5T B;  2VS3 A;  2P72 A;  2RJ9 A;  3V0N A;  1V82 A;  1I52 A;  5C4B A;  1H4C A;  1W77 A;  4UEG A;  5IDT A;  2NXV A;  2OI5 A;  1H5R A;  1ZJ3 A;  1LL3 A;  3I0D A;  2I7B A;  2RIT A;  4C2S A;  1TW5 A;  2E3D A;  1VZU A;  5L6S A;  1INI A;  3U0Y A;  2AM5 A;  3U2V A;  4XWI A;  3SXC A;  1G2V A;  3U2X A;  2RJ5 A;  4AAW A;  3USR A;  2FYA A;  2WVM A;  1FGG A;  5C3A A;  3SXB A;  2ZU9 A;  5BXC A;  1ZJ2 A;  1FR8 A;  1ZIZ A;  3D8V A;  5C47 A;  4CVH A;  1OMX A;  2J0A A;  1NF5 B;  4NAN A;  4Y62 A;  5CQP A;  1W55 A;  4O6N A;  3V8Y A;  3U0X A;  1Z90 A;  1JVD A;  1R82 A;  1G95 A;  1LL0 A;  1S4O A;  2UX8 A;  1HM8 A;  4HO0 A;  4EEO A;  2PGV A;  3V0L A;  2WE9 A;  4O6M A;  1ZI5 A;  1SS9 A;  4Y6U A;  4FRP A;  5FU0 A;  1JVG A;  4FRM A;  4D11 C;  2WEE A;  1H7L A;  2GGO A;  1G1L A;  4M28 A;  1GA8 A;  2RJ8 A;  3Q80 A;  4KPZ A;  3ZGG A;  4DEC A;  4AYL A;  1OMZ A;  2Z87 A;  3KIA A;  1YP2 A;  1G93 A;  1LZJ A;  4KXO A;  1FR9 A;  1H5R B;  3USQ A;  3SX5 A;  1TW1 A; 
#chains in the Genus database with same CATH homology
 1FXJ A;  5CMJ A;  1H7G A;  4CJC A;  1GWW A;  2FYD B;  1MP4 A;  1YP4 A;  1R7Y A;  4M2A A;  4FIX A;  4KPX A;  3FOQ A;  5D92 A;  3ZF8 A;  1H5S C;  4GBP A;  4B2W A;  3JUJ A;  2D0J A;  5D91 A;  3JTJ A;  4JD0 A;  1QGQ A;  2RJ7 A;  5C4E A;  3RMW A;  1FO9 A;  1ON6 A;  2O1F A;  2JCJ A;  2JCO A;  4DE7 A;  2RJ6 A;  1EYR A;  2Y4L A;  2X65 A;  2X5S A;  3R3I A;  4AC3 A;  3OH2 A;  2VSH A;  2V0H A;  3CKJ A;  1VPA A;  2VSI A;  2AGD A;  2JCK A;  1ZI3 A;  3PKP A;  1V83 A;  1VGU A;  1WT0 A;  4LW3 A;  4HO6 A;  2O1H A;  4NAK A;  2JCL A;  1WSZ A;  2VXL A;  1G3L A;  4IRP A;  3ST8 A;  1GQ9 A;  2AE7 A;  2AES A;  1O7Q A;  2AM3 A;  3R2W A;  3SXD A;  4FRE A;  4D11 A;  5C1G A;  1ZJ0 A;  2BO8 A;  1EZI A;  2VK9 A;  3GUE A;  1ZI1 A;  3V90 A;  2QH5 A;  5DDT A;  1QG8 A;  2MZB A;  1XZ6 A;  2ZU8 A;  5C48 A;  2DPW A;  4KQL A;  3K8D A;  4ASJ A;  5JQQ A;  3Q4S A;  2XMH A;  1WT2 A;  2WVL A;  3V0Q A;  2OI6 A;  2V0K A;  1ZDF A;  3SX3 A;  3OH0 A;  3U2T A;  3TZT A;  5CQN X;  2RJ0 A;  1ZCT A;  4FRA A;  3T7O A;  3V8Z A;  1LZI A;  5FU8 A;  4DDZ A;  5C1L A;  1H5S A;  4EVW A;  2RJ4 A;  2V0I A;  4G3Q A;  1YP3 A;  2ICY A;  2V0J A;  5CMG X;  3V0P A;  1WT1 A;  3OGZ A;  4B2X A;  4MIX A;  2A8U A;  2RIY A;  2Y4K A;  1NWG B;  4HOC A;  1HM9 A;  2XWN A;  1GQC A;  2BO4 A;  2WGZ A;  4FRQ A;  1G9R A;  3PKQ A;  4EEG A;  4HO3 A;  4FCU A;  4KNX A;  4NAL A;  1V84 A;  3OH3 A;  2ICX A;  1LZ7 A;  3F1Y A;  2D7I A;  2BO6 A;  3I0K A;  1VZT A;  4EEM A;  3POL A;  1JV1 A;  2FFV A;  2J0B A;  2RIX A;  1NHE B;  4MYB A;  1S4P A;  1GWV A;  1JYL A;  1VIC A;  5IFY A;  1NMM B;  1JYK A;  2QKX A;  5DDV A;  5C4D A;  3N9W A;  4KC1 A;  1MP5 A;  2P6W A;  4FCE A;  5C49 A;  5FTV A;  1ZDG A;  1ZJO A;  1IIN A;  2YQC A;  2E8B A;  1G0R A;  1NKH B;  1JV3 A;  5CMF X;  3SXE A;  1ZHJ A;  1OQM B;  4P02 A;  2YQS A;  2O1G A;  4FRL A;  4KC2 A;  4YS8 A;  3BRK X;  2FY7 A;  1GX0 A;  4E1K A;  4B5B A;  5J49 A;  1O7O A;  1LL2 A;  1H5S B;  1HJJ A;  4HG6 A;  3OH4 A;  4Q7C A;  2VD4 A;  1O0R A;  4FRB A;  1HM0 A;  1H7E A;  3SXA A;  4J18 A;  2AM4 A;  3I0C A;  1FG5 N;  1HJL A;  1HV9 A;  4B4M A;  4KRV A;  3E26 A;  3CGX A;  3I0E A;  2Z86 A;  4EE5 A;  3DK5 A;  2Y6P A;  3ZLL A;  1PZY B;  5C8R A;  1TZF A;  1VH3 A;  5L6V A;  1GX4 A;  1QWJ A;  4D0T A;  1R7V A;  5EIY A;  1H5S D;  1W57 A;  1FXO A;  2CU2 A;  1ZJP A;  2VS4 A;  5CQM X;  4Y6N A;  2I5E A;  2YQJ A;  3IOH A;  4BQH A;  5C3B A;  4MND A;  1ZCU A;  1NQI B;  3T7M A;  4Y7U A;  4KC4 A;  4LW6 A;  5I1F A;  3ZGF A;  3OC9 A;  1R7X A;  1H7F A;  4G87 A;  4B3U A;  3QVB A;  3D5N A;  4B42 A;  2Y4J A;  4Y64 A;  2PX7 A;  5EJ1 A;  2AH9 A;  3EE5 A;  1R81 A;  3RMV A;  3SPT A;  5C38 A;  2RJ1 A;  1ZCV A;  3T7N A;  1ZJ1 A;  2WVK A;  4K6R A;  4Y63 A;  4AYJ A;  2P73 A;  4FRD A;  3I0F A;  2AEC A;  2VS5 A;  1PZT A;  2I5K A;  1H3M A;  1R7T A;  1R80 A;  1LVW A;  2VFZ A;  4B4G A;  2PGY A;  2RIZ A;  2W0V A;  3V0O A;  1R7U A;  3V0M A;  3DJ4 A;  2OEF A;  4Y9X A;  5CQO A;  4ECM A;  2YC5 A;  2APC A;  3I0I X;  2X60 A;  1VGZ A;  5FTS A;  1MC3 A;  3TQD A;  3K8E A;  4FIY A;  2QGI A;  1G8O A;  1YRO B;  1IIM A;  3E25 A;  5CQL X;  5C36 A;  2YCM A;  4NAI A;  4ARW A;  1FRW A;  4M4K A;  4FRO A;  4EE3 A;  1H4E A;  4ASY A;  5C3D A;  3CU0 A;  3CKO A;  2OEG A;  1H7H A;  2BO7 A;  3PNN A;  2XWL A;  3I0J A;  2XWM A;  3CKQ A;  5AJP A;  5AJO A;  1LZ0 A;  1VGW A;  2FYB A;  3U2U A;  1H4D A;  1INJ A;  3ZLK A;  5C1H A;  2YES A;  5CMH A;  1TVY A;  5IDS A;  1K4V A;  4HO4 A;  4IRQ A;  2PA4 A;  1VH1 A;  2OI7 A;  4P00 A;  4JIS A;  4KT7 A;  4EE4 A;  4Y7G A;  2Q4J A;  4HO8 A;  3SX8 A;  1H5T A;  1O23 B;  3D98 A;  1ZCY A;  1H7T A;  4M2B A;  2V0L A;  2FFU A;  3CKV A;  4Y7F A;  3I0L A;  4G3P A;  4CJB A;  3JUK A;  1E5K A;  3Q7U A;  3F1C A;  2YC3 A;  4CJ8 A;  2YQH A;  3O3P A;  1H7Q A;  1VZX A;  4Y7T A;  1FWY A;  1G97 A;  1FOA A;  4G3S A;  4HO2 A;  3U2W A;  1ON8 A;  3SX7 A;  1S4N A;  3SXG A;  4FRH A;  5FYE A;  2ZU7 A;  5HS2 A;  5FUH A;  3RSB A;  4Y7V A;  4BMA A;  1G23 A;  3CKN A;  1FZW A;  2VXM A;  1ZI4 A;  2D7R A;  1WT3 A;  3BCV A;  5AJN A;  2GGQ A;  4EEA A;  2Y4M A;  3DUV A;  3IOI A;  3I0G A;  5CMI A;  3V91 A;  5C4C A;  1XHB A;  2Y7A A;  5EJZ A;  2XME A;  2WAW A;  1FO8 A;  4FQW A;  2X5Z A;  1KWS A;  4R7P A;  3NGW A;  3HL3 A;  4HO5 A;  5FV9 A;  1FGX A;  4HCQ A;  3LW6 A;  5C4F A;  3OH1 A;  4D0Z A;  4L41 C;  3IOJ A;  1WVC A;  2FYC B;  4D48 A;  4KNR A;  4B4B A;  1VM8 A;  2A8W A;  1MP3 A;  3I0H A;  1VGT A;  2C0N A;  1QGS A;  2W0W A;  3FWW A;  4HO9 A;  3OAM A;  4ZDQ A;  3OKR A;  1H5T B;  2VS3 A;  2P72 A;  2RJ9 A;  3V0N A;  1V82 A;  1I52 A;  5C4B A;  1H4C A;  1W77 A;  4UEG A;  5IDT A;  2NXV A;  2OI5 A;  1H5R A;  1ZJ3 A;  1LL3 A;  3I0D A;  2I7B A;  2RIT A;  4C2S A;  1TW5 A;  2E3D A;  1VZU A;  5L6S A;  1INI A;  3U0Y A;  2AM5 A;  3U2V A;  4XWI A;  3SXC A;  1G2V A;  3U2X A;  2RJ5 A;  4AAW A;  3USR A;  2FYA A;  2WVM A;  1FGG A;  5C3A A;  3SXB A;  2ZU9 A;  5BXC A;  1ZJ2 A;  1FR8 A;  1ZIZ A;  3D8V A;  5C47 A;  4CVH A;  1OMX A;  2J0A A;  1NF5 B;  4NAN A;  4Y62 A;  5CQP A;  1W55 A;  4O6N A;  3V8Y A;  3U0X A;  1Z90 A;  1JVD A;  1R82 A;  1G95 A;  1LL0 A;  1S4O A;  2UX8 A;  1HM8 A;  4HO0 A;  4EEO A;  2PGV A;  3V0L A;  2WE9 A;  4O6M A;  1ZI5 A;  1SS9 A;  4Y6U A;  4FRP A;  5FU0 A;  1JVG A;  4FRM A;  4D11 C;  2WEE A;  1H7L A;  2GGO A;  1G1L A;  4M28 A;  1GA8 A;  2RJ8 A;  3Q80 A;  4KPZ A;  3ZGG A;  4DEC A;  4AYL A;  1OMZ A;  2Z87 A;  3KIA A;  1YP2 A;  1G93 A;  1LZJ A;  4KXO A;  1FR9 A;  1H5R B;  3USQ A;  3SX5 A;  1TW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...