4MYBA

Crystal structure of francisella tularensis 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase (ispd)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
227
structure length
217
Chain Sequence
SNKYVIIPAAGIGDIPKQYYKLNNGKTILDNTLVKFIDNPLFDKIFVAIFWNNSLYYNHDKIVVCNGGETRFNSVYNALNVIDERKNDDWVFVHDAARPCVSIDSIIDLYEQTKSSHSQAGILAVRAYETVKQVTKNIVVKTLARDNIWLAQTPQLSRLGQLEKAFDFCYSNNLVAKVTDEASALEMFGINPIVVECSKKNIKITTKDDLEYANWQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
publication title Crystal Structure of Francisella tularensis 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (IspD)
rcsb
source organism Francisella tularensis
total genus 63
structure length 217
sequence length 227
ec nomenclature ec 2.7.7.60: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase.
pdb deposition date 2013-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4mybA00
3BCVA 2YC5A 4IRPA 4XWIA 1ON6A 4D48A 1R7VA 2CU2A 4NAKA 1FG5N 1VH3A 1H5TA 2AE7A 4BQHA 2QKXA 4Y6UA 5I1FA 1QGSA 2YESA 2VSHA 5FTVA 5DDVA 2Q4JA 3ST8A 2XMEA 1NMMB 4D0ZA 1IIMA 4ZDQA 2X60A 2QGIA 4J18A 2WVLA 1LZIA 3I0LA 1H7LA 5C3DA 2Y7AA 3V0MA 4HO2A 1FGXA 1ZI1A 2Y4MA 4B4GA 3IOHA 3IOJA 1R80A 2VD4A 3U0XA 4AYJA 5AJPA 3I0IX 1H7HA 3I0KA 2V0LA 1FXOA 1H4EA 5CQNX 1FRWA 4FCEA 2XWLA 4Y7FA 1JYKA 1PZYB 3K8DA 2AGDA 3DUVA 1YP3A 1HJLA 4NANA 5CQMX 1R82A 4JISA 1WVCA 1GWVA 2ICYA 3IOIA 4MNDA 1O7QA 4P00A 3E25A 1LL0A 4B42A 2GGOA 1W55A 1H4CA 4Y7UA 4HO8A 5FV9A 5FTSA 3I0JA 2RJ9A 5EJZA 4M28A 3CKJA 4Y9XA 4EEOA 1WT1A 1HV9A 4FREA 1E5KA 3EE5A 1FO8A 1ZJ0A 3SXGA 4YS8A 1XHBA 2V0JA 3OGZA 4Y62A 3U2TA 1R81A 1FXJA 2BO4A 1WT0A 2JCKA 5CMGX 1G23A 4ARWA 4B2WA 5C48A 2E8BA 4MYBA 2AM4A 4CJCA 3U2UA 1ZI3A 1VPAA 2AECA 2OI6A 1MP3A 4G87A 2AESA 2VXMA 5IFYA 3PKQA 4M2AA 2VXLA 5C49A 2FYCB 2Z87A 4DECA 1JVGA 2JCOA 3D5NA 4M4KA 1K4VA 4KXOA 5FU0A 2WAWA 5FYEA 2D7RA 1H3MA 3D8VA 1YP2A 2RIYA 5C3BA 1VZUA 3OH4A 3SX3A 3TZTA 4CJ8A 3KIAA 3SX5A 2FYBA 1ZJPA 1QG8A 4CJBA 2RJ7A 4AAWA 1JYLA 1LZ0A 1SS9A 2WVMA 1G95A 1HM8A 3V0OA 2O1GA 1QGQA 1H7QA 1TVYA 1W77A 2WE9A 4FRBA 3V90A 1H5SC 1ZCVA 4FRQA 3OC9A 5C4BA 4KT7A 3R3IA 3R2WA 1ZJ2A 3U0YA 4ASYA 4ASJA 4M2BA 5CMIA 4BMAA 3CGXA 2OI7A 1G2VA 2I7BA 2FFVA 5C4EA 2RJ4A 2V0KA 3O3PA 1FR8A 4EE5A 4Y64A 4EE3A 1KWSA 2X5SA 1FWYA 3HL3A 2FY7A 3I0HA 3U2WA 2AM3A 5C36A 1S4PA 2RJ5A 2Y6PA 1FGGA 1EZIA 4FRDA 2VSIA 1VGTA 2QH5A 1I52A 1INIA 4IRQA 1FO9A 4L41C 1OMXA 3V8ZA 1H5RB 2RIXA 1MP4A 4LW6A 3Q7UA 3SX8A 4AYLA 3CKQA 3I0CA 1ZI4A 1S4NA 4B4MA 3SXDA 1JV1A 1HM0A 2ZU7A 1GX4A 4HO3A 1GWWA 1TW5A 2YQHA 3I0DA 1VZTA 5L6SA 2W0VA 4P02A 5CQPA 5C4DA 1R7TA 1R7UA 2PGYA 4KNRA 4EEGA 1OMZA 4FROA 3BRKX 4B4BA 4KNXA 3V91A 2I5KA 4FQWA 3I0FA 1TZFA 1ON8A 5CMFX 4E1KA 1GQCA 5C1LA 1NWGB 4HOCA 2DPWA 5BXCA 1MC3A 3FWWA 4HO4A 3ZLKA 3ZGFA 1TW1A 1H5SB 1H7FA 2P73A 1H5SD 5AJOA 4EEMA 1VGZA 2X65A 2XWNA 3V0NA 3CKNA 4FRHA 5CMHA 1YROB 3JUJA 1V84A 2VS4A 2PA4A 1WT3A 1NQIB 2YCMA 2W0WA 4B5BA 5C4CA 1H5TB 3OH3A 3NGWA 2PX7A 3OH0A 2AM5A 3JUKA 2ICXA 4HO5A 5JQQA 1R7XA 4KRVA 2RJ1A 2P72A 3SXEA 2Y4LA 3USRA 2PGVA 4JD0A 5AJNA 1G1LA 3V8YA 5C3AA 3E26A 3V0PA 4GBPA 1H7EA 3CKOA 4CVHA 2Y4JA 1ZDFA 2O1HA 3CU0A 2RJ0A 1OQMB 1IINA 4G3PA 4KC1A 4Y7VA 1FZWA 1ZIZA 5IDSA 4FRPA 3RMVA 1JV3A 1LZJA 2A8UA 1FR9A 2VS3A 4HO0A 4DDZA 1LL3A 1VGWA 5C4FA 2MZBA 3V0LA 1PZTA 4D11A 3ZF8A 5CMJA 4NAIA 4Y6NA 2X5ZA 4K6RA 5J49A 2V0IA 1HJJA 1H7TA 4KQLA 4HO9A 3V0QA 1GA8A 1ZHJA 5C8RA 1G0RA 5EIYA 2RJ6A 2UX8A 3POLA 2AH9A 3JTJA 1G3LA 3F1CA 2JCJA 2O1FA 1VICA 1VH1A 2GGQA 3PKPA 3K8EA 4R7PA 1WT2A 3OH2A 3F1YA 2OEGA 3D98A 2VS5A 3Q4SA 3USQA 1LVWA 2Z86A 4LW3A 5L6VA 3PNNA 4KPZA 2RITA 1VGUA 2Y4KA 5IDTA 1MP5A 5FU8A 1ZJ1A 5C38A 3T7OA 4HCQA 1NKHB 3GUEA 1O7OA 2JCLA 4G3SA 4DE7A 1NHEB 3SXBA 4B2XA 1LZ7A 1S4OA 2ZU8A 5CQLX 3SXCA 4NALA 2FYDB 4FRMA 2V0HA 2I5EA 3SPTA 1WSZA 4AC3A 3FOQA 4ECMA 1GQ9A 3U2VA 2FFUA 3I0GA 2XWMA 1HM9A 1VZXA 4EEAA 2ZU9A 5DDTA 3U2XA 3I0EA 1V82A 2E3DA 3N9WA 2OI5A 1ZCYA 3SXAA 3ZGGA 1INJA 3SX7A 3QVBA 1R7YA 2APCA 3T7MA 3OKRA 5C47A 4D0TA 1NF5B 3DJ4A 2D7IA 4KC2A 3TQDA 1H4DA 1QWJA 1EYRA 2BO6A 2YC3A 4G3QA 1G9RA 3CKVA 5EJ1A 2BO8A 4Y7GA 1H5RA 3RMWA 4FRLA 2XMHA 2RIZA 4EE4A 5HS2A 5C1HA 1VM8A 4C2SA 1G8OA 1Z90A 3RSBA 4EVWA 4Y63A 2WVKA 2VFZA 4B3UA 2YQSA 1ZCUA 1ZJ3A 1ZCTA 1W57A 1H7GA 1LL2A 2A8WA 1ZJOA 2BO7A 3DK5A 2NXVA 4HO6A 4UEGA 1O23B 3T7NA 1JVDA 2YQJA 1G93A 2FYAA 1O0RA 4FRAA 2YQCA 4HG6A 2OEFA 1ZI5A 1YP4A 2WEEA 4KC4A 1FOAA 5CQOA 3OH1A 2WGZA 5C1GA 2D0JA 1G97A 2RJ8A 4KPXA 5FUHA 3Q80A 1ZDGA 4D11C 4Y7TA 3LW6A 3ZLLA 2P6WA 3OAMA 1GX0A 4FCUA 1H5SA 1V83A 1XZ6A
chains in the Genus database with same CATH superfamily
3BCVA 2YC5A 4IRPA 4XWIA 1ON6A 4D48A 1R7VA 2CU2A 4NAKA 1FG5N 1VH3A 1H5TA 2AE7A 4BQHA 2QKXA 4Y6UA 5I1FA 1QGSA 2YESA 2VSHA 5FTVA 5DDVA 2Q4JA 3ST8A 2XMEA 1NMMB 4D0ZA 1IIMA 4ZDQA 2X60A 2QGIA 4J18A 2WVLA 1LZIA 3I0LA 1H7LA 5C3DA 2Y7AA 3V0MA 4HO2A 1FGXA 1ZI1A 2Y4MA 4B4GA 3IOHA 3IOJA 1R80A 2VD4A 3U0XA 4AYJA 4FIXA 5AJPA 3I0IX 1H7HA 3I0KA 2V0LA 1FXOA 1H4EA 5CQNX 1FRWA 4FCEA 2XWLA 4Y7FA 1JYKA 1PZYB 3K8DA 2AGDA 3DUVA 1YP3A 1HJLA 4NANA 5CQMX 1R82A 4JISA 1WVCA 1GWVA 2ICYA 3IOIA 4MNDA 1O7QA 4P00A 3E25A 1LL0A 4B42A 2GGOA 1W55A 1H4CA 4Y7UA 4HO8A 5FV9A 5FTSA 3I0JA 2RJ9A 5EJZA 4M28A 3CKJA 4Y9XA 4EEOA 1WT1A 1HV9A 4FREA 1E5KA 3EE5A 1FO8A 1ZJ0A 3SXGA 4O6MA 4YS8A 1XHBA 2V0JA 3OGZA 4Y62A 3U2TA 1R81A 2C0NA 1FXJA 2BO4A 1WT0A 2JCKA 5CMGX 1G23A 4ARWA 4B2WA 5C48A 2E8BA 4MYBA 2AM4A 4CJCA 3U2UA 1ZI3A 1VPAA 2AECA 2OI6A 1MP3A 4G87A 2AESA 2VXMA 5IFYA 3PKQA 4M2AA 2VXLA 5C49A 2FYCB 2Z87A 4DECA 1JVGA 2JCOA 3D5NA 4M4KA 4FIYA 1K4VA 4KXOA 5FU0A 2WAWA 5FYEA 2D7RA 1H3MA 3D8VA 1YP2A 2RIYA 5C3BA 1VZUA 3OH4A 3SX3A 3TZTA 4CJ8A 3KIAA 3SX5A 2FYBA 1ZJPA 1QG8A 4CJBA 2RJ7A 4AAWA 1JYLA 1LZ0A 1SS9A 2WVMA 1G95A 1HM8A 3V0OA 2O1GA 1QGQA 1H7QA 1TVYA 1W77A 2WE9A 4FRBA 3V90A 1H5SC 1ZCVA 4FRQA 3OC9A 5C4BA 4KT7A 3R3IA 3R2WA 1ZJ2A 3U0YA 4ASYA 4ASJA 4M2BA 5CMIA 4BMAA 3CGXA 2OI7A 1G2VA 2I7BA 2FFVA 5C4EA 2RJ4A 2V0KA 3O3PA 1FR8A 4EE5A 4Y64A 4EE3A 1KWSA 2X5SA 1FWYA 3HL3A 2FY7A 3I0HA 3U2WA 2AM3A 5C36A 1S4PA 2RJ5A 2Y6PA 1FGGA 1EZIA 4FRDA 2VSIA 1VGTA 2QH5A 1I52A 1INIA 4IRQA 1FO9A 4L41C 1OMXA 3V8ZA 1H5RB 2RIXA 1MP4A 4LW6A 3Q7UA 3SX8A 4AYLA 3CKQA 2J0AA 3I0CA 2J0BA 1ZI4A 1S4NA 4B4MA 3SXDA 1JV1A 1HM0A 2ZU7A 1GX4A 4HO3A 1GWWA 1TW5A 2YQHA 3I0DA 1VZTA 5L6SA 2W0VA 4P02A 5CQPA 5C4DA 1R7TA 1R7UA 2PGYA 4KNRA 4EEGA 1OMZA 4FROA 3BRKX 4B4BA 4KNXA 3V91A 2I5KA 4FQWA 3I0FA 1TZFA 1ON8A 5CMFX 4E1KA 1GQCA 5C1LA 1NWGB 4HOCA 2DPWA 5BXCA 1MC3A 5D92A 3FWWA 4HO4A 3ZLKA 3ZGFA 4MIXA 1TW1A 4Q7CA 1H5SB 1H7FA 2P73A 1H5SD 5AJOA 4EEMA 1VGZA 2X65A 2XWNA 3V0NA 3CKNA 4FRHA 5CMHA 1YROB 3JUJA 1V84A 2VS4A 2PA4A 1WT3A 1NQIB 2YCMA 2W0WA 4B5BA 5C4CA 1H5TB 3OH3A 3NGWA 2PX7A 3OH0A 2AM5A 3JUKA 2ICXA 4HO5A 5JQQA 1R7XA 4KRVA 2RJ1A 2P72A 3SXEA 2Y4LA 3USRA 2PGVA 4JD0A 5AJNA 1G1LA 3V8YA 5C3AA 3E26A 3V0PA 4GBPA 1H7EA 3CKOA 4CVHA 2Y4JA 1ZDFA 2O1HA 3CU0A 2RJ0A 1OQMB 1IINA 4G3PA 4KC1A 4Y7VA 1FZWA 1ZIZA 5IDSA 4FRPA 3RMVA 1JV3A 1LZJA 2A8UA 1FR9A 2VS3A 4HO0A 4DDZA 1LL3A 1VGWA 5C4FA 2MZBA 3V0LA 1PZTA 4D11A 3ZF8A 5CMJA 4NAIA 4Y6NA 2X5ZA 4O6NA 4K6RA 5J49A 2V0IA 1HJJA 1H7TA 4KQLA 4HO9A 3V0QA 1GA8A 1ZHJA 5C8RA 1G0RA 5EIYA 2RJ6A 2UX8A 3POLA 2AH9A 3JTJA 1G3LA 3F1CA 2JCJA 2O1FA 1VICA 1VH1A 2GGQA 3PKPA 3K8EA 4R7PA 1WT2A 3OH2A 3F1YA 2OEGA 3D98A 2VS5A 3Q4SA 3USQA 1LVWA 2Z86A 4LW3A 5D91A 3PNNA 5L6VA 4KPZA 2RITA 1VGUA 2Y4KA 5IDTA 1MP5A 5FU8A 1ZJ1A 5C38A 3T7OA 4HCQA 1NKHB 3GUEA 1O7OA 2JCLA 4G3SA 4DE7A 1NHEB 3SXBA 4B2XA 1LZ7A 1S4OA 2ZU8A 5CQLX 3SXCA 4NALA 2FYDB 4FRMA 2V0HA 2I5EA 3SPTA 1WSZA 4AC3A 3FOQA 4ECMA 1GQ9A 3U2VA 2FFUA 3I0GA 2XWMA 1HM9A 1VZXA 4EEAA 2ZU9A 5DDTA 3U2XA 3I0EA 1V82A 2E3DA 3N9WA 2OI5A 1ZCYA 3SXAA 3ZGGA 1INJA 3SX7A 3QVBA 1R7YA 2APCA 3T7MA 3OKRA 5C47A 4D0TA 1NF5B 3DJ4A 2D7IA 4KC2A 3TQDA 1H4DA 1QWJA 1EYRA 2VK9A 2BO6A 2YC3A 4G3QA 1G9RA 3CKVA 5EJ1A 2BO8A 4Y7GA 1H5RA 3RMWA 4FRLA 2XMHA 2RIZA 4EE4A 5HS2A 5C1HA 1VM8A 4C2SA 1G8OA 1Z90A 3RSBA 4EVWA 4Y63A 2WVKA 2VFZA 4B3UA 2YQSA 1ZCUA 1ZJ3A 1ZCTA 1W57A 1H7GA 1LL2A 2A8WA 1ZJOA 2BO7A 3DK5A 2NXVA 4HO6A 4UEGA 1O23B 3T7NA 1JVDA 2YQJA 1G93A 2FYAA 1O0RA 4FRAA 2YQCA 4HG6A 2OEFA 1ZI5A 1YP4A 2WEEA 4KC4A 1FOAA 5CQOA 3OH1A 2WGZA 5C1GA 2D0JA 1G97A 2RJ8A 4KPXA 5FUHA 3Q80A 1ZDGA 4D11C 4Y7TA 3LW6A 3ZLLA 2P6WA 3OAMA 1GX0A 4FCUA 1H5SA 1V83A 1XZ6A
chains in the Genus database with same CATH topology
3BCVA 2YC5A 4IRPA 4XWIA 1ON6A 4D48A 1R7VA 2CU2A 4NAKA 1FG5N 1VH3A 1H5TA 2AE7A 4BQHA 2QKXA 4Y6UA 5I1FA 1QGSA 2YESA 2VSHA 5FTVA 5DDVA 2Q4JA 3ST8A 2XMEA 1NMMB 4D0ZA 1IIMA 4ZDQA 2X60A 2QGIA 4J18A 2WVLA 1LZIA 3I0LA 1H7LA 5C3DA 2Y7AA 3V0MA 4HO2A 1FGXA 1ZI1A 2Y4MA 4B4GA 3IOHA 3IOJA 1R80A 2VD4A 3U0XA 4AYJA 4FIXA 5AJPA 3I0IX 1H7HA 3I0KA 2V0LA 1FXOA 1H4EA 5CQNX 1FRWA 4FCEA 2XWLA 4Y7FA 1JYKA 1PZYB 3K8DA 2AGDA 3DUVA 1YP3A 1HJLA 4NANA 5CQMX 1R82A 4JISA 1WVCA 1GWVA 2ICYA 3IOIA 4MNDA 1O7QA 4P00A 3E25A 1LL0A 4B42A 2GGOA 1W55A 1H4CA 4Y7UA 4HO8A 5FV9A 5FTSA 3I0JA 2RJ9A 5EJZA 4M28A 3CKJA 4Y9XA 4EEOA 1WT1A 1HV9A 4FREA 1E5KA 3EE5A 1FO8A 1ZJ0A 3SXGA 4O6MA 4YS8A 1XHBA 2V0JA 3OGZA 4Y62A 3U2TA 1R81A 2C0NA 1FXJA 2BO4A 1WT0A 2JCKA 5CMGX 1G23A 4ARWA 4B2WA 5C48A 2E8BA 4MYBA 2AM4A 4CJCA 3U2UA 1ZI3A 1VPAA 2AECA 2OI6A 1MP3A 4G87A 2AESA 2VXMA 5IFYA 3PKQA 4M2AA 2VXLA 5C49A 2FYCB 2Z87A 4DECA 1JVGA 2JCOA 3D5NA 4M4KA 4FIYA 1K4VA 4KXOA 5FU0A 2WAWA 5FYEA 2D7RA 1H3MA 3D8VA 1YP2A 2RIYA 5C3BA 1VZUA 3OH4A 3SX3A 3TZTA 4CJ8A 3KIAA 3SX5A 2FYBA 1ZJPA 1QG8A 4CJBA 2RJ7A 4AAWA 1JYLA 1LZ0A 1SS9A 2WVMA 1G95A 1HM8A 3V0OA 2O1GA 1QGQA 1H7QA 1TVYA 1W77A 2WE9A 4FRBA 3V90A 1H5SC 1ZCVA 4FRQA 3OC9A 5C4BA 4KT7A 3R3IA 3R2WA 1ZJ2A 3U0YA 4ASYA 4ASJA 4M2BA 5CMIA 4BMAA 3CGXA 2OI7A 1G2VA 2I7BA 2FFVA 5C4EA 2RJ4A 2V0KA 3O3PA 1FR8A 4EE5A 4Y64A 4EE3A 1KWSA 2X5SA 1FWYA 3HL3A 2FY7A 3I0HA 3U2WA 2AM3A 5C36A 1S4PA 2RJ5A 2Y6PA 1FGGA 1EZIA 4FRDA 2VSIA 1VGTA 2QH5A 1I52A 1INIA 4IRQA 1FO9A 4L41C 1OMXA 3V8ZA 1H5RB 2RIXA 1MP4A 4LW6A 3Q7UA 3SX8A 4AYLA 3CKQA 2J0AA 3I0CA 2J0BA 1ZI4A 1S4NA 4B4MA 3SXDA 1JV1A 1HM0A 2ZU7A 1GX4A 4HO3A 1GWWA 1TW5A 2YQHA 3I0DA 1VZTA 5L6SA 2W0VA 4P02A 5CQPA 5C4DA 1R7TA 1R7UA 2PGYA 4KNRA 4EEGA 1OMZA 4FROA 3BRKX 4B4BA 4KNXA 3V91A 2I5KA 4FQWA 3I0FA 1TZFA 1ON8A 5CMFX 4E1KA 1GQCA 5C1LA 1NWGB 4HOCA 2DPWA 5BXCA 1MC3A 5D92A 3FWWA 4HO4A 3ZLKA 3ZGFA 4MIXA 1TW1A 4Q7CA 1H5SB 1H7FA 2P73A 1H5SD 5AJOA 4EEMA 1VGZA 2X65A 2XWNA 3V0NA 3CKNA 4FRHA 5CMHA 1YROB 3JUJA 1V84A 2VS4A 2PA4A 1WT3A 1NQIB 2YCMA 2W0WA 4B5BA 5C4CA 1H5TB 3OH3A 3NGWA 2PX7A 3OH0A 2AM5A 3JUKA 2ICXA 4HO5A 5JQQA 1R7XA 4KRVA 2RJ1A 2P72A 3SXEA 2Y4LA 3USRA 2PGVA 4JD0A 5AJNA 1G1LA 3V8YA 5C3AA 3E26A 3V0PA 4GBPA 1H7EA 3CKOA 4CVHA 2Y4JA 1ZDFA 2O1HA 3CU0A 2RJ0A 1OQMB 1IINA 4G3PA 4KC1A 4Y7VA 1FZWA 1ZIZA 5IDSA 4FRPA 3RMVA 1JV3A 1LZJA 2A8UA 1FR9A 2VS3A 4HO0A 4DDZA 1LL3A 1VGWA 5C4FA 2MZBA 3V0LA 1PZTA 4D11A 3ZF8A 5CMJA 4NAIA 4Y6NA 2X5ZA 4O6NA 4K6RA 5J49A 2V0IA 1HJJA 1H7TA 4KQLA 4HO9A 3V0QA 1GA8A 1ZHJA 5C8RA 1G0RA 5EIYA 2RJ6A 2UX8A 3POLA 2AH9A 3JTJA 1G3LA 3F1CA 2JCJA 2O1FA 1VICA 1VH1A 2GGQA 3PKPA 3K8EA 4R7PA 1WT2A 3OH2A 3F1YA 2OEGA 3D98A 2VS5A 3Q4SA 3USQA 1LVWA 2Z86A 4LW3A 5D91A 3PNNA 5L6VA 4KPZA 2RITA 1VGUA 2Y4KA 5IDTA 1MP5A 5FU8A 1ZJ1A 5C38A 3T7OA 4HCQA 1NKHB 3GUEA 1O7OA 2JCLA 4G3SA 4DE7A 1NHEB 3SXBA 4B2XA 1LZ7A 1S4OA 2ZU8A 5CQLX 3SXCA 4NALA 2FYDB 4FRMA 2V0HA 2I5EA 3SPTA 1WSZA 4AC3A 3FOQA 4ECMA 1GQ9A 3U2VA 2FFUA 3I0GA 2XWMA 1HM9A 1VZXA 4EEAA 2ZU9A 5DDTA 3U2XA 3I0EA 1V82A 2E3DA 3N9WA 2OI5A 1ZCYA 3SXAA 3ZGGA 1INJA 3SX7A 3QVBA 1R7YA 2APCA 3T7MA 3OKRA 5C47A 4D0TA 1NF5B 3DJ4A 2D7IA 4KC2A 3TQDA 1H4DA 1QWJA 1EYRA 2VK9A 2BO6A 2YC3A 4G3QA 1G9RA 3CKVA 5EJ1A 2BO8A 4Y7GA 1H5RA 3RMWA 4FRLA 2XMHA 2RIZA 4EE4A 5HS2A 5C1HA 1VM8A 4C2SA 1G8OA 1Z90A 3RSBA 4EVWA 4Y63A 2WVKA 2VFZA 4B3UA 2YQSA 1ZCUA 1ZJ3A 1ZCTA 1W57A 1H7GA 1LL2A 2A8WA 1ZJOA 2BO7A 3DK5A 2NXVA 4HO6A 4UEGA 1O23B 3T7NA 1JVDA 2YQJA 1G93A 2FYAA 1O0RA 4FRAA 2YQCA 4HG6A 2OEFA 1ZI5A 1YP4A 2WEEA 4KC4A 1FOAA 5CQOA 3OH1A 2WGZA 5C1GA 2D0JA 1G97A 2RJ8A 4KPXA 5FUHA 3Q80A 1ZDGA 4D11C 4Y7TA 3LW6A 3ZLLA 2P6WA 3OAMA 1GX0A 4FCUA 1H5SA 1V83A 1XZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BCV A;  2YC5 A;  4IRP A;  4XWI A;  1ON6 A;  4D48 A;  1R7V A;  2CU2 A;  4NAK A;  1FG5 N;  1VH3 A;  1H5T A;  2AE7 A;  4BQH A;  2QKX A;  4Y6U A;  5I1F A;  1QGS A;  2YES A;  2VSH A;  5FTV A;  5DDV A;  2Q4J A;  3ST8 A;  2XME A;  1NMM B;  4D0Z A;  1IIM A;  4ZDQ A;  2X60 A;  2QGI A;  4J18 A;  2WVL A;  1LZI A;  3I0L A;  1H7L A;  5C3D A;  2Y7A A;  3V0M A;  4HO2 A;  1FGX A;  1ZI1 A;  2Y4M A;  4B4G A;  3IOH A;  3IOJ A;  1R80 A;  2VD4 A;  3U0X A;  4AYJ A;  5AJP A;  3I0I X;  1H7H A;  3I0K A;  2V0L A;  1FXO A;  1H4E A;  5CQN X;  1FRW A;  4FCE A;  2XWL A;  4Y7F A;  1JYK A;  1PZY B;  3K8D A;  2AGD A;  3DUV A;  1YP3 A;  1HJL A;  4NAN A;  5CQM X;  1R82 A;  4JIS A;  1WVC A;  1GWV A;  2ICY A;  3IOI A;  4MND A;  1O7Q A;  4P00 A;  3E25 A;  1LL0 A;  4B42 A;  2GGO A;  1W55 A;  1H4C A;  4Y7U A;  4HO8 A;  5FV9 A;  5FTS A;  3I0J A;  2RJ9 A;  5EJZ A;  4M28 A;  3CKJ A;  4Y9X A;  4EEO A;  1WT1 A;  1HV9 A;  4FRE A;  1E5K A;  3EE5 A;  1FO8 A;  1ZJ0 A;  3SXG A;  4YS8 A;  1XHB A;  2V0J A;  3OGZ A;  4Y62 A;  3U2T A;  1R81 A;  1FXJ A;  2BO4 A;  1WT0 A;  2JCK A;  5CMG X;  1G23 A;  4ARW A;  4B2W A;  5C48 A;  2E8B A;  4MYB A;  2AM4 A;  4CJC A;  3U2U A;  1ZI3 A;  1VPA A;  2AEC A;  2OI6 A;  1MP3 A;  4G87 A;  2AES A;  2VXM A;  5IFY A;  3PKQ A;  4M2A A;  2VXL A;  5C49 A;  2FYC B;  2Z87 A;  4DEC A;  1JVG A;  2JCO A;  3D5N A;  4M4K A;  1K4V A;  4KXO A;  5FU0 A;  2WAW A;  5FYE A;  2D7R A;  1H3M A;  3D8V A;  1YP2 A;  2RIY A;  5C3B A;  1VZU A;  3OH4 A;  3SX3 A;  3TZT A;  4CJ8 A;  3KIA A;  3SX5 A;  2FYB A;  1ZJP A;  1QG8 A;  4CJB A;  2RJ7 A;  4AAW A;  1JYL A;  1LZ0 A;  1SS9 A;  2WVM A;  1G95 A;  1HM8 A;  3V0O A;  2O1G A;  1QGQ A;  1H7Q A;  1TVY A;  1W77 A;  2WE9 A;  4FRB A;  3V90 A;  1H5S C;  1ZCV A;  4FRQ A;  3OC9 A;  5C4B A;  4KT7 A;  3R3I A;  3R2W A;  1ZJ2 A;  3U0Y A;  4ASY A;  4ASJ A;  4M2B A;  5CMI A;  4BMA A;  3CGX A;  2OI7 A;  1G2V A;  2I7B A;  2FFV A;  5C4E A;  2RJ4 A;  2V0K A;  3O3P A;  1FR8 A;  4EE5 A;  4Y64 A;  4EE3 A;  1KWS A;  2X5S A;  1FWY A;  3HL3 A;  2FY7 A;  3I0H A;  3U2W A;  2AM3 A;  5C36 A;  1S4P A;  2RJ5 A;  2Y6P A;  1FGG A;  1EZI A;  4FRD A;  2VSI A;  1VGT A;  2QH5 A;  1I52 A;  1INI A;  4IRQ A;  1FO9 A;  4L41 C;  1OMX A;  3V8Z A;  1H5R B;  2RIX A;  1MP4 A;  4LW6 A;  3Q7U A;  3SX8 A;  4AYL A;  3CKQ A;  3I0C A;  1ZI4 A;  1S4N A;  4B4M A;  3SXD A;  1JV1 A;  1HM0 A;  2ZU7 A;  1GX4 A;  4HO3 A;  1GWW A;  1TW5 A;  2YQH A;  3I0D A;  1VZT A;  5L6S A;  2W0V A;  4P02 A;  5CQP A;  5C4D A;  1R7T A;  1R7U A;  2PGY A;  4KNR A;  4EEG A;  1OMZ A;  4FRO A;  3BRK X;  4B4B A;  4KNX A;  3V91 A;  2I5K A;  4FQW A;  3I0F A;  1TZF A;  1ON8 A;  5CMF X;  4E1K A;  1GQC A;  5C1L A;  1NWG B;  4HOC A;  2DPW A;  5BXC A;  1MC3 A;  3FWW A;  4HO4 A;  3ZLK A;  3ZGF A;  1TW1 A;  1H5S B;  1H7F A;  2P73 A;  1H5S D;  5AJO A;  4EEM A;  1VGZ A;  2X65 A;  2XWN A;  3V0N A;  3CKN A;  4FRH A;  5CMH A;  1YRO B;  3JUJ A;  1V84 A;  2VS4 A;  2PA4 A;  1WT3 A;  1NQI B;  2YCM A;  2W0W A;  4B5B A;  5C4C A;  1H5T B;  3OH3 A;  3NGW A;  2PX7 A;  3OH0 A;  2AM5 A;  3JUK A;  2ICX A;  4HO5 A;  5JQQ A;  1R7X A;  4KRV A;  2RJ1 A;  2P72 A;  3SXE A;  2Y4L A;  3USR A;  2PGV A;  4JD0 A;  5AJN A;  1G1L A;  3V8Y A;  5C3A A;  3E26 A;  3V0P A;  4GBP A;  1H7E A;  3CKO A;  4CVH A;  2Y4J A;  1ZDF A;  2O1H A;  3CU0 A;  2RJ0 A;  1OQM B;  1IIN A;  4G3P A;  4KC1 A;  4Y7V A;  1FZW A;  1ZIZ A;  5IDS A;  4FRP A;  3RMV A;  1JV3 A;  1LZJ A;  2A8U A;  1FR9 A;  2VS3 A;  4HO0 A;  4DDZ A;  1LL3 A;  1VGW A;  5C4F A;  2MZB A;  3V0L A;  1PZT A;  4D11 A;  3ZF8 A;  5CMJ A;  4NAI A;  4Y6N A;  2X5Z A;  4K6R A;  5J49 A;  2V0I A;  1HJJ A;  1H7T A;  4KQL A;  4HO9 A;  3V0Q A;  1GA8 A;  1ZHJ A;  5C8R A;  1G0R A;  5EIY A;  2RJ6 A;  2UX8 A;  3POL A;  2AH9 A;  3JTJ A;  1G3L A;  3F1C A;  2JCJ A;  2O1F A;  1VIC A;  1VH1 A;  2GGQ A;  3PKP A;  3K8E A;  4R7P A;  1WT2 A;  3OH2 A;  3F1Y A;  2OEG A;  3D98 A;  2VS5 A;  3Q4S A;  3USQ A;  1LVW A;  2Z86 A;  4LW3 A;  5L6V A;  3PNN A;  4KPZ A;  2RIT A;  1VGU A;  2Y4K A;  5IDT A;  1MP5 A;  5FU8 A;  1ZJ1 A;  5C38 A;  3T7O A;  4HCQ A;  1NKH B;  3GUE A;  1O7O A;  2JCL A;  4G3S A;  4DE7 A;  1NHE B;  3SXB A;  4B2X A;  1LZ7 A;  1S4O A;  2ZU8 A;  5CQL X;  3SXC A;  4NAL A;  2FYD B;  4FRM A;  2V0H A;  2I5E A;  3SPT A;  1WSZ A;  4AC3 A;  3FOQ A;  4ECM A;  1GQ9 A;  3U2V A;  2FFU A;  3I0G A;  2XWM A;  1HM9 A;  1VZX A;  4EEA A;  2ZU9 A;  5DDT A;  3U2X A;  3I0E A;  1V82 A;  2E3D A;  3N9W A;  2OI5 A;  1ZCY A;  3SXA A;  3ZGG A;  1INJ A;  3SX7 A;  3QVB A;  1R7Y A;  2APC A;  3T7M A;  3OKR A;  5C47 A;  4D0T A;  1NF5 B;  3DJ4 A;  2D7I A;  4KC2 A;  3TQD A;  1H4D A;  1QWJ A;  1EYR A;  2BO6 A;  2YC3 A;  4G3Q A;  1G9R A;  3CKV A;  5EJ1 A;  2BO8 A;  4Y7G A;  1H5R A;  3RMW A;  4FRL A;  2XMH A;  2RIZ A;  4EE4 A;  5HS2 A;  5C1H A;  1VM8 A;  4C2S A;  1G8O A;  1Z90 A;  3RSB A;  4EVW A;  4Y63 A;  2WVK A;  2VFZ A;  4B3U A;  2YQS A;  1ZCU A;  1ZJ3 A;  1ZCT A;  1W57 A;  1H7G A;  1LL2 A;  2A8W A;  1ZJO A;  2BO7 A;  3DK5 A;  2NXV A;  4HO6 A;  4UEG A;  1O23 B;  3T7N A;  1JVD A;  2YQJ A;  1G93 A;  2FYA A;  1O0R A;  4FRA A;  2YQC A;  4HG6 A;  2OEF A;  1ZI5 A;  1YP4 A;  2WEE A;  4KC4 A;  1FOA A;  5CQO A;  3OH1 A;  2WGZ A;  5C1G A;  2D0J A;  1G97 A;  2RJ8 A;  4KPX A;  5FUH A;  3Q80 A;  1ZDG A;  4D11 C;  4Y7T A;  3LW6 A;  3ZLL A;  2P6W A;  3OAM A;  1GX0 A;  4FCU A;  1H5S A;  1V83 A;  1XZ6 A; 
#chains in the Genus database with same CATH topology
 3BCV A;  2YC5 A;  4IRP A;  4XWI A;  1ON6 A;  4D48 A;  1R7V A;  2CU2 A;  4NAK A;  1FG5 N;  1VH3 A;  1H5T A;  2AE7 A;  4BQH A;  2QKX A;  4Y6U A;  5I1F A;  1QGS A;  2YES A;  2VSH A;  5FTV A;  5DDV A;  2Q4J A;  3ST8 A;  2XME A;  1NMM B;  4D0Z A;  1IIM A;  4ZDQ A;  2X60 A;  2QGI A;  4J18 A;  2WVL A;  1LZI A;  3I0L A;  1H7L A;  5C3D A;  2Y7A A;  3V0M A;  4HO2 A;  1FGX A;  1ZI1 A;  2Y4M A;  4B4G A;  3IOH A;  3IOJ A;  1R80 A;  2VD4 A;  3U0X A;  4AYJ A;  4FIX A;  5AJP A;  3I0I X;  1H7H A;  3I0K A;  2V0L A;  1FXO A;  1H4E A;  5CQN X;  1FRW A;  4FCE A;  2XWL A;  4Y7F A;  1JYK A;  1PZY B;  3K8D A;  2AGD A;  3DUV A;  1YP3 A;  1HJL A;  4NAN A;  5CQM X;  1R82 A;  4JIS A;  1WVC A;  1GWV A;  2ICY A;  3IOI A;  4MND A;  1O7Q A;  4P00 A;  3E25 A;  1LL0 A;  4B42 A;  2GGO A;  1W55 A;  1H4C A;  4Y7U A;  4HO8 A;  5FV9 A;  5FTS A;  3I0J A;  2RJ9 A;  5EJZ A;  4M28 A;  3CKJ A;  4Y9X A;  4EEO A;  1WT1 A;  1HV9 A;  4FRE A;  1E5K A;  3EE5 A;  1FO8 A;  1ZJ0 A;  3SXG A;  4O6M A;  4YS8 A;  1XHB A;  2V0J A;  3OGZ A;  4Y62 A;  3U2T A;  1R81 A;  2C0N A;  1FXJ A;  2BO4 A;  1WT0 A;  2JCK A;  5CMG X;  1G23 A;  4ARW A;  4B2W A;  5C48 A;  2E8B A;  4MYB A;  2AM4 A;  4CJC A;  3U2U A;  1ZI3 A;  1VPA A;  2AEC A;  2OI6 A;  1MP3 A;  4G87 A;  2AES A;  2VXM A;  5IFY A;  3PKQ A;  4M2A A;  2VXL A;  5C49 A;  2FYC B;  2Z87 A;  4DEC A;  1JVG A;  2JCO A;  3D5N A;  4M4K A;  4FIY A;  1K4V A;  4KXO A;  5FU0 A;  2WAW A;  5FYE A;  2D7R A;  1H3M A;  3D8V A;  1YP2 A;  2RIY A;  5C3B A;  1VZU A;  3OH4 A;  3SX3 A;  3TZT A;  4CJ8 A;  3KIA A;  3SX5 A;  2FYB A;  1ZJP A;  1QG8 A;  4CJB A;  2RJ7 A;  4AAW A;  1JYL A;  1LZ0 A;  1SS9 A;  2WVM A;  1G95 A;  1HM8 A;  3V0O A;  2O1G A;  1QGQ A;  1H7Q A;  1TVY A;  1W77 A;  2WE9 A;  4FRB A;  3V90 A;  1H5S C;  1ZCV A;  4FRQ A;  3OC9 A;  5C4B A;  4KT7 A;  3R3I A;  3R2W A;  1ZJ2 A;  3U0Y A;  4ASY A;  4ASJ A;  4M2B A;  5CMI A;  4BMA A;  3CGX A;  2OI7 A;  1G2V A;  2I7B A;  2FFV A;  5C4E A;  2RJ4 A;  2V0K A;  3O3P A;  1FR8 A;  4EE5 A;  4Y64 A;  4EE3 A;  1KWS A;  2X5S A;  1FWY A;  3HL3 A;  2FY7 A;  3I0H A;  3U2W A;  2AM3 A;  5C36 A;  1S4P A;  2RJ5 A;  2Y6P A;  1FGG A;  1EZI A;  4FRD A;  2VSI A;  1VGT A;  2QH5 A;  1I52 A;  1INI A;  4IRQ A;  1FO9 A;  4L41 C;  1OMX A;  3V8Z A;  1H5R B;  2RIX A;  1MP4 A;  4LW6 A;  3Q7U A;  3SX8 A;  4AYL A;  3CKQ A;  2J0A A;  3I0C A;  2J0B A;  1ZI4 A;  1S4N A;  4B4M A;  3SXD A;  1JV1 A;  1HM0 A;  2ZU7 A;  1GX4 A;  4HO3 A;  1GWW A;  1TW5 A;  2YQH A;  3I0D A;  1VZT A;  5L6S A;  2W0V A;  4P02 A;  5CQP A;  5C4D A;  1R7T A;  1R7U A;  2PGY A;  4KNR A;  4EEG A;  1OMZ A;  4FRO A;  3BRK X;  4B4B A;  4KNX A;  3V91 A;  2I5K A;  4FQW A;  3I0F A;  1TZF A;  1ON8 A;  5CMF X;  4E1K A;  1GQC A;  5C1L A;  1NWG B;  4HOC A;  2DPW A;  5BXC A;  1MC3 A;  5D92 A;  3FWW A;  4HO4 A;  3ZLK A;  3ZGF A;  4MIX A;  1TW1 A;  4Q7C A;  1H5S B;  1H7F A;  2P73 A;  1H5S D;  5AJO A;  4EEM A;  1VGZ A;  2X65 A;  2XWN A;  3V0N A;  3CKN A;  4FRH A;  5CMH A;  1YRO B;  3JUJ A;  1V84 A;  2VS4 A;  2PA4 A;  1WT3 A;  1NQI B;  2YCM A;  2W0W A;  4B5B A;  5C4C A;  1H5T B;  3OH3 A;  3NGW A;  2PX7 A;  3OH0 A;  2AM5 A;  3JUK A;  2ICX A;  4HO5 A;  5JQQ A;  1R7X A;  4KRV A;  2RJ1 A;  2P72 A;  3SXE A;  2Y4L A;  3USR A;  2PGV A;  4JD0 A;  5AJN A;  1G1L A;  3V8Y A;  5C3A A;  3E26 A;  3V0P A;  4GBP A;  1H7E A;  3CKO A;  4CVH A;  2Y4J A;  1ZDF A;  2O1H A;  3CU0 A;  2RJ0 A;  1OQM B;  1IIN A;  4G3P A;  4KC1 A;  4Y7V A;  1FZW A;  1ZIZ A;  5IDS A;  4FRP A;  3RMV A;  1JV3 A;  1LZJ A;  2A8U A;  1FR9 A;  2VS3 A;  4HO0 A;  4DDZ A;  1LL3 A;  1VGW A;  5C4F A;  2MZB A;  3V0L A;  1PZT A;  4D11 A;  3ZF8 A;  5CMJ A;  4NAI A;  4Y6N A;  2X5Z A;  4O6N A;  4K6R A;  5J49 A;  2V0I A;  1HJJ A;  1H7T A;  4KQL A;  4HO9 A;  3V0Q A;  1GA8 A;  1ZHJ A;  5C8R A;  1G0R A;  5EIY A;  2RJ6 A;  2UX8 A;  3POL A;  2AH9 A;  3JTJ A;  1G3L A;  3F1C A;  2JCJ A;  2O1F A;  1VIC A;  1VH1 A;  2GGQ A;  3PKP A;  3K8E A;  4R7P A;  1WT2 A;  3OH2 A;  3F1Y A;  2OEG A;  3D98 A;  2VS5 A;  3Q4S A;  3USQ A;  1LVW A;  2Z86 A;  4LW3 A;  5D91 A;  3PNN A;  5L6V A;  4KPZ A;  2RIT A;  1VGU A;  2Y4K A;  5IDT A;  1MP5 A;  5FU8 A;  1ZJ1 A;  5C38 A;  3T7O A;  4HCQ A;  1NKH B;  3GUE A;  1O7O A;  2JCL A;  4G3S A;  4DE7 A;  1NHE B;  3SXB A;  4B2X A;  1LZ7 A;  1S4O A;  2ZU8 A;  5CQL X;  3SXC A;  4NAL A;  2FYD B;  4FRM A;  2V0H A;  2I5E A;  3SPT A;  1WSZ A;  4AC3 A;  3FOQ A;  4ECM A;  1GQ9 A;  3U2V A;  2FFU A;  3I0G A;  2XWM A;  1HM9 A;  1VZX A;  4EEA A;  2ZU9 A;  5DDT A;  3U2X A;  3I0E A;  1V82 A;  2E3D A;  3N9W A;  2OI5 A;  1ZCY A;  3SXA A;  3ZGG A;  1INJ A;  3SX7 A;  3QVB A;  1R7Y A;  2APC A;  3T7M A;  3OKR A;  5C47 A;  4D0T A;  1NF5 B;  3DJ4 A;  2D7I A;  4KC2 A;  3TQD A;  1H4D A;  1QWJ A;  1EYR A;  2VK9 A;  2BO6 A;  2YC3 A;  4G3Q A;  1G9R A;  3CKV A;  5EJ1 A;  2BO8 A;  4Y7G A;  1H5R A;  3RMW A;  4FRL A;  2XMH A;  2RIZ A;  4EE4 A;  5HS2 A;  5C1H A;  1VM8 A;  4C2S A;  1G8O A;  1Z90 A;  3RSB A;  4EVW A;  4Y63 A;  2WVK A;  2VFZ A;  4B3U A;  2YQS A;  1ZCU A;  1ZJ3 A;  1ZCT A;  1W57 A;  1H7G A;  1LL2 A;  2A8W A;  1ZJO A;  2BO7 A;  3DK5 A;  2NXV A;  4HO6 A;  4UEG A;  1O23 B;  3T7N A;  1JVD A;  2YQJ A;  1G93 A;  2FYA A;  1O0R A;  4FRA A;  2YQC A;  4HG6 A;  2OEF A;  1ZI5 A;  1YP4 A;  2WEE A;  4KC4 A;  1FOA A;  5CQO A;  3OH1 A;  2WGZ A;  5C1G A;  2D0J A;  1G97 A;  2RJ8 A;  4KPX A;  5FUH A;  3Q80 A;  1ZDG A;  4D11 C;  4Y7T A;  3LW6 A;  3ZLL A;  2P6W A;  3OAM A;  1GX0 A;  4FCU A;  1H5S A;  1V83 A;  1XZ6 A; 
#chains in the Genus database with same CATH homology
 3BCV A;  2YC5 A;  4IRP A;  4XWI A;  1ON6 A;  4D48 A;  1R7V A;  2CU2 A;  4NAK A;  1FG5 N;  1VH3 A;  1H5T A;  2AE7 A;  4BQH A;  2QKX A;  4Y6U A;  5I1F A;  1QGS A;  2YES A;  2VSH A;  5FTV A;  5DDV A;  2Q4J A;  3ST8 A;  2XME A;  1NMM B;  4D0Z A;  1IIM A;  4ZDQ A;  2X60 A;  2QGI A;  4J18 A;  2WVL A;  1LZI A;  3I0L A;  1H7L A;  5C3D A;  2Y7A A;  3V0M A;  4HO2 A;  1FGX A;  1ZI1 A;  2Y4M A;  4B4G A;  3IOH A;  3IOJ A;  1R80 A;  2VD4 A;  3U0X A;  4AYJ A;  4FIX A;  5AJP A;  3I0I X;  1H7H A;  3I0K A;  2V0L A;  1FXO A;  1H4E A;  5CQN X;  1FRW A;  4FCE A;  2XWL A;  4Y7F A;  1JYK A;  1PZY B;  3K8D A;  2AGD A;  3DUV A;  1YP3 A;  1HJL A;  4NAN A;  5CQM X;  1R82 A;  4JIS A;  1WVC A;  1GWV A;  2ICY A;  3IOI A;  4MND A;  1O7Q A;  4P00 A;  3E25 A;  1LL0 A;  4B42 A;  2GGO A;  1W55 A;  1H4C A;  4Y7U A;  4HO8 A;  5FV9 A;  5FTS A;  3I0J A;  2RJ9 A;  5EJZ A;  4M28 A;  3CKJ A;  4Y9X A;  4EEO A;  1WT1 A;  1HV9 A;  4FRE A;  1E5K A;  3EE5 A;  1FO8 A;  1ZJ0 A;  3SXG A;  4O6M A;  4YS8 A;  1XHB A;  2V0J A;  3OGZ A;  4Y62 A;  3U2T A;  1R81 A;  2C0N A;  1FXJ A;  2BO4 A;  1WT0 A;  2JCK A;  5CMG X;  1G23 A;  4ARW A;  4B2W A;  5C48 A;  2E8B A;  4MYB A;  2AM4 A;  4CJC A;  3U2U A;  1ZI3 A;  1VPA A;  2AEC A;  2OI6 A;  1MP3 A;  4G87 A;  2AES A;  2VXM A;  5IFY A;  3PKQ A;  4M2A A;  2VXL A;  5C49 A;  2FYC B;  2Z87 A;  4DEC A;  1JVG A;  2JCO A;  3D5N A;  4M4K A;  4FIY A;  1K4V A;  4KXO A;  5FU0 A;  2WAW A;  5FYE A;  2D7R A;  1H3M A;  3D8V A;  1YP2 A;  2RIY A;  5C3B A;  1VZU A;  3OH4 A;  3SX3 A;  3TZT A;  4CJ8 A;  3KIA A;  3SX5 A;  2FYB A;  1ZJP A;  1QG8 A;  4CJB A;  2RJ7 A;  4AAW A;  1JYL A;  1LZ0 A;  1SS9 A;  2WVM A;  1G95 A;  1HM8 A;  3V0O A;  2O1G A;  1QGQ A;  1H7Q A;  1TVY A;  1W77 A;  2WE9 A;  4FRB A;  3V90 A;  1H5S C;  1ZCV A;  4FRQ A;  3OC9 A;  5C4B A;  4KT7 A;  3R3I A;  3R2W A;  1ZJ2 A;  3U0Y A;  4ASY A;  4ASJ A;  4M2B A;  5CMI A;  4BMA A;  3CGX A;  2OI7 A;  1G2V A;  2I7B A;  2FFV A;  5C4E A;  2RJ4 A;  2V0K A;  3O3P A;  1FR8 A;  4EE5 A;  4Y64 A;  4EE3 A;  1KWS A;  2X5S A;  1FWY A;  3HL3 A;  2FY7 A;  3I0H A;  3U2W A;  2AM3 A;  5C36 A;  1S4P A;  2RJ5 A;  2Y6P A;  1FGG A;  1EZI A;  4FRD A;  2VSI A;  1VGT A;  2QH5 A;  1I52 A;  1INI A;  4IRQ A;  1FO9 A;  4L41 C;  1OMX A;  3V8Z A;  1H5R B;  2RIX A;  1MP4 A;  4LW6 A;  3Q7U A;  3SX8 A;  4AYL A;  3CKQ A;  2J0A A;  3I0C A;  2J0B A;  1ZI4 A;  1S4N A;  4B4M A;  3SXD A;  1JV1 A;  1HM0 A;  2ZU7 A;  1GX4 A;  4HO3 A;  1GWW A;  1TW5 A;  2YQH A;  3I0D A;  1VZT A;  5L6S A;  2W0V A;  4P02 A;  5CQP A;  5C4D A;  1R7T A;  1R7U A;  2PGY A;  4KNR A;  4EEG A;  1OMZ A;  4FRO A;  3BRK X;  4B4B A;  4KNX A;  3V91 A;  2I5K A;  4FQW A;  3I0F A;  1TZF A;  1ON8 A;  5CMF X;  4E1K A;  1GQC A;  5C1L A;  1NWG B;  4HOC A;  2DPW A;  5BXC A;  1MC3 A;  5D92 A;  3FWW A;  4HO4 A;  3ZLK A;  3ZGF A;  4MIX A;  1TW1 A;  4Q7C A;  1H5S B;  1H7F A;  2P73 A;  1H5S D;  5AJO A;  4EEM A;  1VGZ A;  2X65 A;  2XWN A;  3V0N A;  3CKN A;  4FRH A;  5CMH A;  1YRO B;  3JUJ A;  1V84 A;  2VS4 A;  2PA4 A;  1WT3 A;  1NQI B;  2YCM A;  2W0W A;  4B5B A;  5C4C A;  1H5T B;  3OH3 A;  3NGW A;  2PX7 A;  3OH0 A;  2AM5 A;  3JUK A;  2ICX A;  4HO5 A;  5JQQ A;  1R7X A;  4KRV A;  2RJ1 A;  2P72 A;  3SXE A;  2Y4L A;  3USR A;  2PGV A;  4JD0 A;  5AJN A;  1G1L A;  3V8Y A;  5C3A A;  3E26 A;  3V0P A;  4GBP A;  1H7E A;  3CKO A;  4CVH A;  2Y4J A;  1ZDF A;  2O1H A;  3CU0 A;  2RJ0 A;  1OQM B;  1IIN A;  4G3P A;  4KC1 A;  4Y7V A;  1FZW A;  1ZIZ A;  5IDS A;  4FRP A;  3RMV A;  1JV3 A;  1LZJ A;  2A8U A;  1FR9 A;  2VS3 A;  4HO0 A;  4DDZ A;  1LL3 A;  1VGW A;  5C4F A;  2MZB A;  3V0L A;  1PZT A;  4D11 A;  3ZF8 A;  5CMJ A;  4NAI A;  4Y6N A;  2X5Z A;  4O6N A;  4K6R A;  5J49 A;  2V0I A;  1HJJ A;  1H7T A;  4KQL A;  4HO9 A;  3V0Q A;  1GA8 A;  1ZHJ A;  5C8R A;  1G0R A;  5EIY A;  2RJ6 A;  2UX8 A;  3POL A;  2AH9 A;  3JTJ A;  1G3L A;  3F1C A;  2JCJ A;  2O1F A;  1VIC A;  1VH1 A;  2GGQ A;  3PKP A;  3K8E A;  4R7P A;  1WT2 A;  3OH2 A;  3F1Y A;  2OEG A;  3D98 A;  2VS5 A;  3Q4S A;  3USQ A;  1LVW A;  2Z86 A;  4LW3 A;  5D91 A;  3PNN A;  5L6V A;  4KPZ A;  2RIT A;  1VGU A;  2Y4K A;  5IDT A;  1MP5 A;  5FU8 A;  1ZJ1 A;  5C38 A;  3T7O A;  4HCQ A;  1NKH B;  3GUE A;  1O7O A;  2JCL A;  4G3S A;  4DE7 A;  1NHE B;  3SXB A;  4B2X A;  1LZ7 A;  1S4O A;  2ZU8 A;  5CQL X;  3SXC A;  4NAL A;  2FYD B;  4FRM A;  2V0H A;  2I5E A;  3SPT A;  1WSZ A;  4AC3 A;  3FOQ A;  4ECM A;  1GQ9 A;  3U2V A;  2FFU A;  3I0G A;  2XWM A;  1HM9 A;  1VZX A;  4EEA A;  2ZU9 A;  5DDT A;  3U2X A;  3I0E A;  1V82 A;  2E3D A;  3N9W A;  2OI5 A;  1ZCY A;  3SXA A;  3ZGG A;  1INJ A;  3SX7 A;  3QVB A;  1R7Y A;  2APC A;  3T7M A;  3OKR A;  5C47 A;  4D0T A;  1NF5 B;  3DJ4 A;  2D7I A;  4KC2 A;  3TQD A;  1H4D A;  1QWJ A;  1EYR A;  2VK9 A;  2BO6 A;  2YC3 A;  4G3Q A;  1G9R A;  3CKV A;  5EJ1 A;  2BO8 A;  4Y7G A;  1H5R A;  3RMW A;  4FRL A;  2XMH A;  2RIZ A;  4EE4 A;  5HS2 A;  5C1H A;  1VM8 A;  4C2S A;  1G8O A;  1Z90 A;  3RSB A;  4EVW A;  4Y63 A;  2WVK A;  2VFZ A;  4B3U A;  2YQS A;  1ZCU A;  1ZJ3 A;  1ZCT A;  1W57 A;  1H7G A;  1LL2 A;  2A8W A;  1ZJO A;  2BO7 A;  3DK5 A;  2NXV A;  4HO6 A;  4UEG A;  1O23 B;  3T7N A;  1JVD A;  2YQJ A;  1G93 A;  2FYA A;  1O0R A;  4FRA A;  2YQC A;  4HG6 A;  2OEF A;  1ZI5 A;  1YP4 A;  2WEE A;  4KC4 A;  1FOA A;  5CQO A;  3OH1 A;  2WGZ A;  5C1G A;  2D0J A;  1G97 A;  2RJ8 A;  4KPX A;  5FUH A;  3Q80 A;  1ZDG A;  4D11 C;  4Y7T A;  3LW6 A;  3ZLL A;  2P6W A;  3OAM A;  1GX0 A;  4FCU A;  1H5S A;  1V83 A;  1XZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...