4MYBA

Crystal structure of francisella tularensis 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase (ispd)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
227
structure length
217
Chain Sequence
SNKYVIIPAAGIGDIPKQYYKLNNGKTILDNTLVKFIDNPLFDKIFVAIFWNNSLYYNHDKIVVCNGGETRFNSVYNALNVIDERKNDDWVFVHDAARPCVSIDSIIDLYEQTKSSHSQAGILAVRAYETVKQVTKNIVVKTLARDNIWLAQTPQLSRLGQLEKAFDFCYSNNLVAKVTDEASALEMFGINPIVVECSKKNIKITTKDDLEYANWQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
publication title Crystal Structure of Francisella tularensis 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (IspD)
rcsb
source organism Francisella tularensis
molecule tags Transferase
total genus 63
structure length 217
sequence length 227
ec nomenclature ec 2.7.7.60: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase.
pdb deposition date 2013-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4mybA00
1Z90A 2YQHA 4CJCA 1ZCVA 1ZHJA 5HS2A 1ON6A 4KQLA 4D11A 3O3PA 2Y4JA 2VS3A 1H5SC 2VS5A 2Z86A 1H3MA 1H5RA 3SXCA 4AYJA 2BO6A 4FROA 3IOHA 1LZ0A 4KPZA 5C1LA 4EEAA 1ZJ3A 1FG5N 1SS9A 1GWWA 1GQ9A 4KPXA 2RIYA 3OH3A 3Q80A 4MYBA 1LZ7A 2YCMA 1HJLA 2VSIA 2ICXA 5CQMX 5FU0A 4HO9A 3BCVA 5DDVA 5IDSA 2RJ4A 1QGQA 3PKPA 1VGWA 2XMHA 1EZIA 2OEFA 1NMMB 3ZGGA 4JD0A 1R80A 1G23A 4ASYA 1LL2A 5I1FA 4BMAA 4M4KA 4NAIA 4FRMA 3DUVA 3U0YA 5C3BA 1MP3A 5AJOA 1ZI1A 1NKHB 1YP3A 1K4VA 4KC1A 3V8YA 5C4DA 3OH0A 2Y4KA 4M28A 4Y63A 1VGTA 1INJA 2V0IA 2O1GA 2D7IA 3POLA 2YQJA 1FXJA 4P02A 1S4PA 1HJJA 3TZTA 1H5SA 1OMZA 5C49A 1FGXA 4FREA 4Y9XA 3I0DA 4B4BA 4FCEA 1NHEB 3I0HA 2Y6PA 5AJPA 2WGZA 2FYBA 2JCLA 5FU8A 2FYCB 1VICA 3I0CA 3D5NA 3IOJA 4B4MA 2AM5A 2VXLA 1WT2A 1QWJA 2AM3A 3RMVA 3V0QA 1JYLA 1O7QA 1G8OA 4KC4A 3RMWA 5CMGX 4KNRA 1GA8A 2FFUA 2FY7A 5CMIA 3V8ZA 1XZ6A 1W55A 1NQIB 2XWMA 1R7XA 3U2XA 3OH2A 1FR8A 4KRVA 2VXMA 2YESA 1ZJOA 4FRHA 2XWLA 2GGOA 2NXVA 1H7FA 4AAWA 1ZJPA 4BQHA 3OC9A 4IRPA 2RJ8A 3DJ4A 1YP2A 3LW6A 2PGYA 2QKXA 4G3SA 2VS4A 1V84A 3BRKX 3TQDA 3V0PA 1OMXA 1TZFA 5L6SA 1JYKA 1MP5A 3Q4SA 4EEOA 5C48A 2WE9A 4Y7TA 2X65A 4ASJA 3KIAA 3OKRA 2X60A 1HM9A 5C4EA 1HV9A 1H5SD 3K8EA 3F1CA 1ZJ2A 3I0JA 4NANA 2WVLA 3USRA 5L6VA 1TW5A 5EIYA 1VM8A 2O1FA 2VSHA 2BO4A 1R82A 1V82A 1ZJ0A 3CKOA 3SXDA 3SX5A 1H4EA 1VGUA 1IIMA 2YC5A 4J18A 4ARWA 3I0GA 3T7MA 3T7NA 5EJ1A 1PZYB 4HO3A 2AGDA 4CVHA 4AC3A 5C36A 4G3QA 5BXCA 1LZIA 3D98A 3Q7UA 1YROB 4Y64A 1H7GA 1TVYA 4CJ8A 1H7TA 4P00A 2Y4LA 5EJZA 2XMEA 1W57A 4L41C 2YC3A 4XWIA 5FTVA 3U2TA 4DECA 5FUHA 4EEMA 1VH3A 3OGZA 1G9RA 1FR9A 2DPWA 4M2AA 1R7TA 5CQLX 5C4BA 1G0RA 2AH9A 3CGXA 4HOCA 1ZCTA 2PX7A 2QGIA 2QH5A 4D0TA 4G3PA 4JISA 1JVGA 5FTSA 2RJ1A 5CMFX 3CKJA 4NAKA 2GGQA 1LVWA 1FO9A 2V0HA 2VFZA 1FXOA 1ZCYA 2RJ7A 1XHBA 5CQNX 1MC3A 1G97A 4B5BA 2Z87A 4HO5A 3SX8A 4EEGA 2O1HA 4FRLA 5C1HA 3SX3A 1WSZA 5C38A 3I0LA 1R81A 5FYEA 1YP4A 1MP4A 4D0ZA 1VZXA 2BO7A 5C47A 3SXAA 2RJ0A 1H5TA 2A8UA 2Q4JA 4D11C 2E3DA 4UEGA 3V91A 4FCUA 5IDTA 3U0XA 4EVWA 2BO8A 2RIZA 3ST8A 4Y62A 1H7QA 1H4DA 1ZIZA 3V0OA 1QG8A 1FRWA 1QGSA 3R2WA 4B4GA 4LW6A 2I5EA 2XWNA 3V0LA 5C4FA 1NWGB 1ZDGA 4B2WA 5FV9A 1ON8A 2RJ6A 1VGZA 5IFYA 2RIXA 2OI7A 2PGVA 1S4NA 4R7PA 4EE5A 4Y7GA 2A8WA 1ZCUA 2P6WA 3SX7A 4Y7VA 5J49A 2I5KA 1HM0A 2ICYA 4HO4A 2RJ5A 3U2UA 5C1GA 4K6RA 2D0JA 2P72A 4YS8A 2RITA 5CMJA 3V0NA 3E25A 2V0LA 2W0WA 3OH4A 3U2WA 3I0KA 2APCA 1G1LA 3HL3A 4Y7UA 4FRDA 4B3UA 1WT1A 3I0IX 1ZI4A 1H7HA 1GQCA 2ZU9A 1TW1A 2I7BA 4HO6A 1R7YA 4G87A 3DK5A 1R7UA 3N9WA 4B42A 1ZJ1A 1FO8A 1JV1A 2P73A 1VH1A 4HCQA 2WAWA 2D7RA 1HM8A 3K8DA 1I52A 1PZTA 3T7OA 2YQSA 4AYLA 1LZJA 3SXGA 2Y4MA 4KC2A 1FOAA 1JV3A 2ZU7A 1H7EA 4C2SA 1H5RB 1NF5B 1ZI3A 2FYDB 1VPAA 3FWWA 4HO0A 4KT7A 3ZF8A 4Y6NA 2OEGA 3NGWA 3FOQA 2AESA 3CKQA 1WT0A 1ZI5A 5CQOA 1G93A 4M2BA 4EE4A 4ZDQA 5C3DA 3F1YA 3R3IA 2Y7AA 3JUJA 1W77A 3SXEA 2UX8A 4B2XA 3V0MA 3I0FA 2AE7A 3EE5A 5C3AA 2W0VA 4FQWA 1INIA 2OI5A 3V90A 2OI6A 1O0RA 3ZLKA 5C8RA 1GX0A 3OAMA 2WVMA 2X5ZA 4Y7FA 1FZWA 3CU0A 2JCKA 1S4OA 4HO8A 4HO2A 2JCJA 4IRQA 1O23B 4FRAA 1H7LA 2AECA 2MZBA 2FYAA 1E5KA 2V0JA 1JVDA 4DDZA 3JUKA 3I0EA 1GWVA 2ZU8A 4FRQA 1R7VA 2CU2A 2FFVA 2YQCA 4LW3A 2AM4A 3U2VA 1H5SB 2WEEA 4KXOA 5C4CA 1LL0A 1LL3A 1VZUA 3D8VA 3PNNA 4EE3A 5JQQA 1OQMB 4E1KA 3QVBA 1H4CA 1WT3A 3CKVA 1ZDFA 3IOIA 2VD4A 4D48A 1EYRA 4KNXA 3PKQA 1G3LA 3USQA 1G95A 2X5SA 2RJ9A 1FGGA 5CMHA 1KWSA 1V83A 5CQPA 2V0KA 1FWYA 2PA4A 5DDTA 1G2VA 3GUEA 2E8BA 1GX4A 4ECMA 4HG6A 4Y6UA 3SPTA 2WVKA 4GBPA 1O7OA 3RSBA 4FRBA 3E26A 4NALA 3ZGFA 3OH1A 3SXBA 2JCOA 5AJNA 4MNDA 4FRPA 1VZTA 4CJBA 1IINA 1WVCA 1H5TB 3ZLLA 3CKNA 3JTJA 4DE7A
chains in the Genus database with same CATH superfamily
1Z90A 2YQHA 4CJCA 1ZCVA 1ZHJA 5HS2A 1ON6A 4KQLA 4D11A 3O3PA 2Y4JA 2VS3A 1H5SC 2VS5A 2Z86A 1H3MA 1H5RA 3SXCA 4AYJA 2BO6A 4FROA 3IOHA 1LZ0A 4KPZA 5C1LA 4EEAA 1ZJ3A 1FG5N 1SS9A 1GWWA 1GQ9A 4KPXA 2RIYA 3OH3A 3Q80A 4MYBA 1LZ7A 2YCMA 1HJLA 2VSIA 2ICXA 4FIYA 5CQMX 5FU0A 4HO9A 3BCVA 5DDVA 5IDSA 2RJ4A 1QGQA 3PKPA 1VGWA 2XMHA 1EZIA 2OEFA 1NMMB 3ZGGA 4JD0A 1R80A 1G23A 4ASYA 1LL2A 5I1FA 4BMAA 4M4KA 4NAIA 4FRMA 3DUVA 3U0YA 5C3BA 1MP3A 5AJOA 1ZI1A 5D92A 1NKHB 1YP3A 1K4VA 4KC1A 3V8YA 5C4DA 3OH0A 2Y4KA 4M28A 4Y63A 1VGTA 1INJA 2V0IA 2O1GA 2D7IA 3POLA 2YQJA 1FXJA 4P02A 1S4PA 1HJJA 3TZTA 1H5SA 1OMZA 5C49A 1FGXA 4FREA 4Y9XA 3I0DA 4B4BA 4FCEA 1NHEB 2J0BA 3I0HA 2Y6PA 5AJPA 2WGZA 2FYBA 2JCLA 5FU8A 2FYCB 1VICA 3I0CA 3D5NA 3IOJA 4B4MA 2AM5A 2VXLA 1WT2A 1QWJA 2AM3A 3RMVA 4FIXA 3V0QA 1JYLA 1O7QA 1G8OA 4KC4A 3RMWA 5CMGX 4KNRA 1GA8A 2FFUA 2FY7A 5CMIA 3V8ZA 1XZ6A 1W55A 1NQIB 2XWMA 1R7XA 3U2XA 3OH2A 1FR8A 4KRVA 2VXMA 2YESA 1ZJOA 4FRHA 2XWLA 2GGOA 2NXVA 1H7FA 4AAWA 1ZJPA 4BQHA 3OC9A 4IRPA 2RJ8A 3DJ4A 1YP2A 3LW6A 2PGYA 2QKXA 2C0NA 4G3SA 2VS4A 1V84A 3BRKX 3TQDA 3V0PA 1OMXA 1TZFA 5L6SA 1JYKA 1MP5A 3Q4SA 4EEOA 5C48A 2WE9A 4Y7TA 2X65A 4ASJA 3KIAA 3OKRA 2X60A 1HM9A 5C4EA 1HV9A 1H5SD 3K8EA 3F1CA 1ZJ2A 3I0JA 4NANA 2WVLA 3USRA 5L6VA 1TW5A 5EIYA 1VM8A 2O1FA 2VSHA 2BO4A 1R82A 1V82A 1ZJ0A 3CKOA 3SXDA 3SX5A 1H4EA 1VGUA 1IIMA 2YC5A 4J18A 4ARWA 3I0GA 3T7MA 3T7NA 5EJ1A 1PZYB 4HO3A 2AGDA 4CVHA 4AC3A 5C36A 4G3QA 5BXCA 1LZIA 3D98A 3Q7UA 1YROB 4Y64A 1H7GA 1TVYA 4CJ8A 1H7TA 4P00A 2Y4LA 5EJZA 2XMEA 1W57A 2VK9A 5D91A 4L41C 2YC3A 4XWIA 5FTVA 3U2TA 4DECA 5FUHA 4EEMA 1VH3A 3OGZA 1G9RA 1FR9A 2DPWA 4M2AA 1R7TA 5CQLX 5C4BA 1G0RA 2AH9A 3CGXA 4HOCA 1ZCTA 2PX7A 2QGIA 2QH5A 4D0TA 4G3PA 4JISA 1JVGA 5FTSA 2RJ1A 5CMFX 3CKJA 4NAKA 2GGQA 1LVWA 1FO9A 2V0HA 2VFZA 1FXOA 1ZCYA 2RJ7A 1XHBA 5CQNX 1MC3A 1G97A 4B5BA 2Z87A 4HO5A 3SX8A 4EEGA 2O1HA 4FRLA 5C1HA 3SX3A 1WSZA 5C38A 3I0LA 1R81A 5FYEA 1YP4A 1MP4A 4D0ZA 1VZXA 2BO7A 5C47A 3SXAA 2RJ0A 1H5TA 2A8UA 2Q4JA 4D11C 2E3DA 4UEGA 3V91A 4FCUA 5IDTA 3U0XA 4EVWA 2BO8A 2RIZA 3ST8A 4Y62A 1H7QA 1H4DA 1ZIZA 3V0OA 1QG8A 1FRWA 1QGSA 3R2WA 4B4GA 4LW6A 2I5EA 2XWNA 3V0LA 5C4FA 1NWGB 1ZDGA 4B2WA 5FV9A 1ON8A 2RJ6A 1VGZA 5IFYA 2RIXA 2OI7A 2PGVA 1S4NA 4R7PA 4EE5A 4Y7GA 2A8WA 1ZCUA 2P6WA 3SX7A 4Y7VA 5J49A 2I5KA 1HM0A 2ICYA 4HO4A 2RJ5A 3U2UA 4O6MA 5C1GA 4K6RA 2D0JA 2P72A 4YS8A 2RITA 5CMJA 3V0NA 3E25A 2V0LA 2W0WA 3OH4A 3U2WA 3I0KA 2APCA 1G1LA 3HL3A 4Y7UA 4O6NA 4FRDA 4B3UA 1WT1A 3I0IX 1ZI4A 1H7HA 1GQCA 2ZU9A 1TW1A 2I7BA 4HO6A 1R7YA 4G87A 3DK5A 1R7UA 3N9WA 4B42A 1ZJ1A 1FO8A 1JV1A 2P73A 1VH1A 4HCQA 2WAWA 2D7RA 1HM8A 3K8DA 1I52A 1PZTA 3T7OA 2YQSA 4AYLA 1LZJA 3SXGA 2Y4MA 4KC2A 1FOAA 1JV3A 2ZU7A 1H7EA 4C2SA 4MIXA 1H5RB 1NF5B 1ZI3A 2FYDB 1VPAA 3FWWA 4HO0A 4KT7A 3ZF8A 4Y6NA 2OEGA 3NGWA 3FOQA 2AESA 3CKQA 1WT0A 1ZI5A 5CQOA 1G93A 4M2BA 4EE4A 4ZDQA 5C3DA 3F1YA 3R3IA 2Y7AA 3JUJA 1W77A 3SXEA 2J0AA 2UX8A 4B2XA 3V0MA 3I0FA 2AE7A 3EE5A 5C3AA 2W0VA 4FQWA 1INIA 2OI5A 3V90A 2OI6A 1O0RA 3ZLKA 5C8RA 1GX0A 3OAMA 2WVMA 2X5ZA 4Y7FA 1FZWA 3CU0A 2JCKA 1S4OA 4HO8A 4HO2A 2JCJA 4IRQA 1O23B 4FRAA 1H7LA 2AECA 2MZBA 2FYAA 1E5KA 2V0JA 1JVDA 4DDZA 3JUKA 4Q7CA 3I0EA 1GWVA 2ZU8A 4FRQA 1R7VA 2CU2A 2FFVA 2YQCA 4LW3A 2AM4A 3U2VA 1H5SB 2WEEA 4KXOA 5C4CA 1LL0A 1LL3A 1VZUA 3D8VA 3PNNA 4EE3A 5JQQA 1OQMB 4E1KA 3QVBA 1H4CA 1WT3A 3CKVA 1ZDFA 3IOIA 2VD4A 4D48A 1EYRA 4KNXA 3PKQA 1G3LA 3USQA 1G95A 2X5SA 2RJ9A 1FGGA 5CMHA 1KWSA 1V83A 5CQPA 2V0KA 1FWYA 2PA4A 5DDTA 1G2VA 3GUEA 2E8BA 1GX4A 4ECMA 4HG6A 4Y6UA 3SPTA 2WVKA 4GBPA 1O7OA 3RSBA 4FRBA 3E26A 4NALA 3ZGFA 3OH1A 3SXBA 2JCOA 5AJNA 4MNDA 4FRPA 1VZTA 4CJBA 1IINA 1WVCA 1H5TB 3ZLLA 3CKNA 3JTJA 4DE7A
chains in the Genus database with same CATH topology
1Z90A 2YQHA 4CJCA 1ZCVA 1ZHJA 5HS2A 1ON6A 4KQLA 4D11A 3O3PA 2Y4JA 2VS3A 1H5SC 2VS5A 2Z86A 1H3MA 1H5RA 3SXCA 4AYJA 2BO6A 4FROA 3IOHA 1LZ0A 4KPZA 5C1LA 4EEAA 1ZJ3A 1FG5N 1SS9A 1GWWA 1GQ9A 4KPXA 2RIYA 3OH3A 3Q80A 4MYBA 1LZ7A 2YCMA 1HJLA 2VSIA 2ICXA 4FIYA 5CQMX 5FU0A 4HO9A 3BCVA 5DDVA 5IDSA 2RJ4A 1QGQA 3PKPA 1VGWA 2XMHA 1EZIA 2OEFA 1NMMB 3ZGGA 4JD0A 1R80A 1G23A 4ASYA 1LL2A 5I1FA 4BMAA 4M4KA 4NAIA 4FRMA 3DUVA 3U0YA 5C3BA 1MP3A 5AJOA 1ZI1A 5D92A 1NKHB 1YP3A 1K4VA 4KC1A 3V8YA 5C4DA 3OH0A 2Y4KA 4M28A 4Y63A 1VGTA 1INJA 2V0IA 2O1GA 2D7IA 3POLA 2YQJA 1FXJA 4P02A 1S4PA 1HJJA 3TZTA 1H5SA 1OMZA 5C49A 1FGXA 4FREA 4Y9XA 3I0DA 4B4BA 4FCEA 1NHEB 2J0BA 3I0HA 2Y6PA 5AJPA 2WGZA 2FYBA 2JCLA 5FU8A 2FYCB 1VICA 3I0CA 3D5NA 3IOJA 4B4MA 2AM5A 2VXLA 1WT2A 1QWJA 2AM3A 3RMVA 4FIXA 3V0QA 1JYLA 1O7QA 1G8OA 4KC4A 3RMWA 5CMGX 4KNRA 1GA8A 2FFUA 2FY7A 5CMIA 3V8ZA 1XZ6A 1W55A 1NQIB 2XWMA 1R7XA 3U2XA 3OH2A 1FR8A 4KRVA 2VXMA 2YESA 1ZJOA 4FRHA 2XWLA 2GGOA 2NXVA 1H7FA 4AAWA 1ZJPA 4BQHA 3OC9A 4IRPA 2RJ8A 3DJ4A 1YP2A 3LW6A 2PGYA 2QKXA 2C0NA 4G3SA 2VS4A 1V84A 3BRKX 3TQDA 3V0PA 1OMXA 1TZFA 5L6SA 1JYKA 1MP5A 3Q4SA 4EEOA 5C48A 2WE9A 4Y7TA 2X65A 4ASJA 3KIAA 3OKRA 2X60A 1HM9A 5C4EA 1HV9A 1H5SD 3K8EA 3F1CA 1ZJ2A 3I0JA 4NANA 2WVLA 3USRA 5L6VA 1TW5A 5EIYA 1VM8A 2O1FA 2VSHA 2BO4A 1R82A 1V82A 1ZJ0A 3CKOA 3SXDA 3SX5A 1H4EA 1VGUA 1IIMA 2YC5A 4J18A 4ARWA 3I0GA 3T7MA 3T7NA 5EJ1A 1PZYB 4HO3A 2AGDA 4CVHA 4AC3A 5C36A 4G3QA 5BXCA 1LZIA 3D98A 3Q7UA 1YROB 4Y64A 1H7GA 1TVYA 4CJ8A 1H7TA 4P00A 2Y4LA 5EJZA 2XMEA 1W57A 2VK9A 5D91A 4L41C 2YC3A 4XWIA 5FTVA 3U2TA 4DECA 5FUHA 4EEMA 1VH3A 3OGZA 1G9RA 1FR9A 2DPWA 4M2AA 1R7TA 5CQLX 5C4BA 1G0RA 2AH9A 3CGXA 4HOCA 1ZCTA 2PX7A 2QGIA 2QH5A 4D0TA 4G3PA 4JISA 1JVGA 5FTSA 2RJ1A 5CMFX 3CKJA 4NAKA 2GGQA 1LVWA 1FO9A 2V0HA 2VFZA 1FXOA 1ZCYA 2RJ7A 1XHBA 5CQNX 1MC3A 1G97A 4B5BA 2Z87A 4HO5A 3SX8A 4EEGA 2O1HA 4FRLA 5C1HA 3SX3A 1WSZA 5C38A 3I0LA 1R81A 5FYEA 1YP4A 1MP4A 4D0ZA 1VZXA 2BO7A 5C47A 3SXAA 2RJ0A 1H5TA 2A8UA 2Q4JA 4D11C 2E3DA 4UEGA 3V91A 4FCUA 5IDTA 3U0XA 4EVWA 2BO8A 2RIZA 3ST8A 4Y62A 1H7QA 1H4DA 1ZIZA 3V0OA 1QG8A 1FRWA 1QGSA 3R2WA 4B4GA 4LW6A 2I5EA 2XWNA 3V0LA 5C4FA 1NWGB 1ZDGA 4B2WA 5FV9A 1ON8A 2RJ6A 1VGZA 5IFYA 2RIXA 2OI7A 2PGVA 1S4NA 4R7PA 4EE5A 4Y7GA 2A8WA 1ZCUA 2P6WA 3SX7A 4Y7VA 5J49A 2I5KA 1HM0A 2ICYA 4HO4A 2RJ5A 3U2UA 4O6MA 5C1GA 4K6RA 2D0JA 2P72A 4YS8A 2RITA 5CMJA 3V0NA 3E25A 2V0LA 2W0WA 3OH4A 3U2WA 3I0KA 2APCA 1G1LA 3HL3A 4Y7UA 4O6NA 4FRDA 4B3UA 1WT1A 3I0IX 1ZI4A 1H7HA 1GQCA 2ZU9A 1TW1A 2I7BA 4HO6A 1R7YA 4G87A 3DK5A 1R7UA 3N9WA 4B42A 1ZJ1A 1FO8A 1JV1A 2P73A 1VH1A 4HCQA 2WAWA 2D7RA 1HM8A 3K8DA 1I52A 1PZTA 3T7OA 2YQSA 4AYLA 1LZJA 3SXGA 2Y4MA 4KC2A 1FOAA 1JV3A 2ZU7A 1H7EA 4C2SA 4MIXA 1H5RB 1NF5B 1ZI3A 2FYDB 1VPAA 3FWWA 4HO0A 4KT7A 3ZF8A 4Y6NA 2OEGA 3NGWA 3FOQA 2AESA 3CKQA 1WT0A 1ZI5A 5CQOA 1G93A 4M2BA 4EE4A 4ZDQA 5C3DA 3F1YA 3R3IA 2Y7AA 3JUJA 1W77A 3SXEA 2J0AA 2UX8A 4B2XA 3V0MA 3I0FA 2AE7A 3EE5A 5C3AA 2W0VA 4FQWA 1INIA 2OI5A 3V90A 2OI6A 1O0RA 3ZLKA 5C8RA 1GX0A 3OAMA 2WVMA 2X5ZA 4Y7FA 1FZWA 3CU0A 2JCKA 1S4OA 4HO8A 4HO2A 2JCJA 4IRQA 1O23B 4FRAA 1H7LA 2AECA 2MZBA 2FYAA 1E5KA 2V0JA 1JVDA 4DDZA 3JUKA 4Q7CA 3I0EA 1GWVA 2ZU8A 4FRQA 1R7VA 2CU2A 2FFVA 2YQCA 4LW3A 2AM4A 3U2VA 1H5SB 2WEEA 4KXOA 5C4CA 1LL0A 1LL3A 1VZUA 3D8VA 3PNNA 4EE3A 5JQQA 1OQMB 4E1KA 3QVBA 1H4CA 1WT3A 3CKVA 1ZDFA 3IOIA 2VD4A 4D48A 1EYRA 4KNXA 3PKQA 1G3LA 3USQA 1G95A 2X5SA 2RJ9A 1FGGA 5CMHA 1KWSA 1V83A 5CQPA 2V0KA 1FWYA 2PA4A 5DDTA 1G2VA 3GUEA 2E8BA 1GX4A 4ECMA 4HG6A 4Y6UA 3SPTA 2WVKA 4GBPA 1O7OA 3RSBA 4FRBA 3E26A 4NALA 3ZGFA 3OH1A 3SXBA 2JCOA 5AJNA 4MNDA 4FRPA 1VZTA 4CJBA 1IINA 1WVCA 1H5TB 3ZLLA 3CKNA 3JTJA 4DE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z90 A;  2YQH A;  4CJC A;  1ZCV A;  1ZHJ A;  5HS2 A;  1ON6 A;  4KQL A;  4D11 A;  3O3P A;  2Y4J A;  2VS3 A;  1H5S C;  2VS5 A;  2Z86 A;  1H3M A;  1H5R A;  3SXC A;  4AYJ A;  2BO6 A;  4FRO A;  3IOH A;  1LZ0 A;  4KPZ A;  5C1L A;  4EEA A;  1ZJ3 A;  1FG5 N;  1SS9 A;  1GWW A;  1GQ9 A;  4KPX A;  2RIY A;  3OH3 A;  3Q80 A;  4MYB A;  1LZ7 A;  2YCM A;  1HJL A;  2VSI A;  2ICX A;  5CQM X;  5FU0 A;  4HO9 A;  3BCV A;  5DDV A;  5IDS A;  2RJ4 A;  1QGQ A;  3PKP A;  1VGW A;  2XMH A;  1EZI A;  2OEF A;  1NMM B;  3ZGG A;  4JD0 A;  1R80 A;  1G23 A;  4ASY A;  1LL2 A;  5I1F A;  4BMA A;  4M4K A;  4NAI A;  4FRM A;  3DUV A;  3U0Y A;  5C3B A;  1MP3 A;  5AJO A;  1ZI1 A;  1NKH B;  1YP3 A;  1K4V A;  4KC1 A;  3V8Y A;  5C4D A;  3OH0 A;  2Y4K A;  4M28 A;  4Y63 A;  1VGT A;  1INJ A;  2V0I A;  2O1G A;  2D7I A;  3POL A;  2YQJ A;  1FXJ A;  4P02 A;  1S4P A;  1HJJ A;  3TZT A;  1H5S A;  1OMZ A;  5C49 A;  1FGX A;  4FRE A;  4Y9X A;  3I0D A;  4B4B A;  4FCE A;  1NHE B;  3I0H A;  2Y6P A;  5AJP A;  2WGZ A;  2FYB A;  2JCL A;  5FU8 A;  2FYC B;  1VIC A;  3I0C A;  3D5N A;  3IOJ A;  4B4M A;  2AM5 A;  2VXL A;  1WT2 A;  1QWJ A;  2AM3 A;  3RMV A;  3V0Q A;  1JYL A;  1O7Q A;  1G8O A;  4KC4 A;  3RMW A;  5CMG X;  4KNR A;  1GA8 A;  2FFU A;  2FY7 A;  5CMI A;  3V8Z A;  1XZ6 A;  1W55 A;  1NQI B;  2XWM A;  1R7X A;  3U2X A;  3OH2 A;  1FR8 A;  4KRV A;  2VXM A;  2YES A;  1ZJO A;  4FRH A;  2XWL A;  2GGO A;  2NXV A;  1H7F A;  4AAW A;  1ZJP A;  4BQH A;  3OC9 A;  4IRP A;  2RJ8 A;  3DJ4 A;  1YP2 A;  3LW6 A;  2PGY A;  2QKX A;  4G3S A;  2VS4 A;  1V84 A;  3BRK X;  3TQD A;  3V0P A;  1OMX A;  1TZF A;  5L6S A;  1JYK A;  1MP5 A;  3Q4S A;  4EEO A;  5C48 A;  2WE9 A;  4Y7T A;  2X65 A;  4ASJ A;  3KIA A;  3OKR A;  2X60 A;  1HM9 A;  5C4E A;  1HV9 A;  1H5S D;  3K8E A;  3F1C A;  1ZJ2 A;  3I0J A;  4NAN A;  2WVL A;  3USR A;  5L6V A;  1TW5 A;  5EIY A;  1VM8 A;  2O1F A;  2VSH A;  2BO4 A;  1R82 A;  1V82 A;  1ZJ0 A;  3CKO A;  3SXD A;  3SX5 A;  1H4E A;  1VGU A;  1IIM A;  2YC5 A;  4J18 A;  4ARW A;  3I0G A;  3T7M A;  3T7N A;  5EJ1 A;  1PZY B;  4HO3 A;  2AGD A;  4CVH A;  4AC3 A;  5C36 A;  4G3Q A;  5BXC A;  1LZI A;  3D98 A;  3Q7U A;  1YRO B;  4Y64 A;  1H7G A;  1TVY A;  4CJ8 A;  1H7T A;  4P00 A;  2Y4L A;  5EJZ A;  2XME A;  1W57 A;  4L41 C;  2YC3 A;  4XWI A;  5FTV A;  3U2T A;  4DEC A;  5FUH A;  4EEM A;  1VH3 A;  3OGZ A;  1G9R A;  1FR9 A;  2DPW A;  4M2A A;  1R7T A;  5CQL X;  5C4B A;  1G0R A;  2AH9 A;  3CGX A;  4HOC A;  1ZCT A;  2PX7 A;  2QGI A;  2QH5 A;  4D0T A;  4G3P A;  4JIS A;  1JVG A;  5FTS A;  2RJ1 A;  5CMF X;  3CKJ A;  4NAK A;  2GGQ A;  1LVW A;  1FO9 A;  2V0H A;  2VFZ A;  1FXO A;  1ZCY A;  2RJ7 A;  1XHB A;  5CQN X;  1MC3 A;  1G97 A;  4B5B A;  2Z87 A;  4HO5 A;  3SX8 A;  4EEG A;  2O1H A;  4FRL A;  5C1H A;  3SX3 A;  1WSZ A;  5C38 A;  3I0L A;  1R81 A;  5FYE A;  1YP4 A;  1MP4 A;  4D0Z A;  1VZX A;  2BO7 A;  5C47 A;  3SXA A;  2RJ0 A;  1H5T A;  2A8U A;  2Q4J A;  4D11 C;  2E3D A;  4UEG A;  3V91 A;  4FCU A;  5IDT A;  3U0X A;  4EVW A;  2BO8 A;  2RIZ A;  3ST8 A;  4Y62 A;  1H7Q A;  1H4D A;  1ZIZ A;  3V0O A;  1QG8 A;  1FRW A;  1QGS A;  3R2W A;  4B4G A;  4LW6 A;  2I5E A;  2XWN A;  3V0L A;  5C4F A;  1NWG B;  1ZDG A;  4B2W A;  5FV9 A;  1ON8 A;  2RJ6 A;  1VGZ A;  5IFY A;  2RIX A;  2OI7 A;  2PGV A;  1S4N A;  4R7P A;  4EE5 A;  4Y7G A;  2A8W A;  1ZCU A;  2P6W A;  3SX7 A;  4Y7V A;  5J49 A;  2I5K A;  1HM0 A;  2ICY A;  4HO4 A;  2RJ5 A;  3U2U A;  5C1G A;  4K6R A;  2D0J A;  2P72 A;  4YS8 A;  2RIT A;  5CMJ A;  3V0N A;  3E25 A;  2V0L A;  2W0W A;  3OH4 A;  3U2W A;  3I0K A;  2APC A;  1G1L A;  3HL3 A;  4Y7U A;  4FRD A;  4B3U A;  1WT1 A;  3I0I X;  1ZI4 A;  1H7H A;  1GQC A;  2ZU9 A;  1TW1 A;  2I7B A;  4HO6 A;  1R7Y A;  4G87 A;  3DK5 A;  1R7U A;  3N9W A;  4B42 A;  1ZJ1 A;  1FO8 A;  1JV1 A;  2P73 A;  1VH1 A;  4HCQ A;  2WAW A;  2D7R A;  1HM8 A;  3K8D A;  1I52 A;  1PZT A;  3T7O A;  2YQS A;  4AYL A;  1LZJ A;  3SXG A;  2Y4M A;  4KC2 A;  1FOA A;  1JV3 A;  2ZU7 A;  1H7E A;  4C2S A;  1H5R B;  1NF5 B;  1ZI3 A;  2FYD B;  1VPA A;  3FWW A;  4HO0 A;  4KT7 A;  3ZF8 A;  4Y6N A;  2OEG A;  3NGW A;  3FOQ A;  2AES A;  3CKQ A;  1WT0 A;  1ZI5 A;  5CQO A;  1G93 A;  4M2B A;  4EE4 A;  4ZDQ A;  5C3D A;  3F1Y A;  3R3I A;  2Y7A A;  3JUJ A;  1W77 A;  3SXE A;  2UX8 A;  4B2X A;  3V0M A;  3I0F A;  2AE7 A;  3EE5 A;  5C3A A;  2W0V A;  4FQW A;  1INI A;  2OI5 A;  3V90 A;  2OI6 A;  1O0R A;  3ZLK A;  5C8R A;  1GX0 A;  3OAM A;  2WVM A;  2X5Z A;  4Y7F A;  1FZW A;  3CU0 A;  2JCK A;  1S4O A;  4HO8 A;  4HO2 A;  2JCJ A;  4IRQ A;  1O23 B;  4FRA A;  1H7L A;  2AEC A;  2MZB A;  2FYA A;  1E5K A;  2V0J A;  1JVD A;  4DDZ A;  3JUK A;  3I0E A;  1GWV A;  2ZU8 A;  4FRQ A;  1R7V A;  2CU2 A;  2FFV A;  2YQC A;  4LW3 A;  2AM4 A;  3U2V A;  1H5S B;  2WEE A;  4KXO A;  5C4C A;  1LL0 A;  1LL3 A;  1VZU A;  3D8V A;  3PNN A;  4EE3 A;  5JQQ A;  1OQM B;  4E1K A;  3QVB A;  1H4C A;  1WT3 A;  3CKV A;  1ZDF A;  3IOI A;  2VD4 A;  4D48 A;  1EYR A;  4KNX A;  3PKQ A;  1G3L A;  3USQ A;  1G95 A;  2X5S A;  2RJ9 A;  1FGG A;  5CMH A;  1KWS A;  1V83 A;  5CQP A;  2V0K A;  1FWY A;  2PA4 A;  5DDT A;  1G2V A;  3GUE A;  2E8B A;  1GX4 A;  4ECM A;  4HG6 A;  4Y6U A;  3SPT A;  2WVK A;  4GBP A;  1O7O A;  3RSB A;  4FRB A;  3E26 A;  4NAL A;  3ZGF A;  3OH1 A;  3SXB A;  2JCO A;  5AJN A;  4MND A;  4FRP A;  1VZT A;  4CJB A;  1IIN A;  1WVC A;  1H5T B;  3ZLL A;  3CKN A;  3JTJ A;  4DE7 A; 
#chains in the Genus database with same CATH topology
 1Z90 A;  2YQH A;  4CJC A;  1ZCV A;  1ZHJ A;  5HS2 A;  1ON6 A;  4KQL A;  4D11 A;  3O3P A;  2Y4J A;  2VS3 A;  1H5S C;  2VS5 A;  2Z86 A;  1H3M A;  1H5R A;  3SXC A;  4AYJ A;  2BO6 A;  4FRO A;  3IOH A;  1LZ0 A;  4KPZ A;  5C1L A;  4EEA A;  1ZJ3 A;  1FG5 N;  1SS9 A;  1GWW A;  1GQ9 A;  4KPX A;  2RIY A;  3OH3 A;  3Q80 A;  4MYB A;  1LZ7 A;  2YCM A;  1HJL A;  2VSI A;  2ICX A;  4FIY A;  5CQM X;  5FU0 A;  4HO9 A;  3BCV A;  5DDV A;  5IDS A;  2RJ4 A;  1QGQ A;  3PKP A;  1VGW A;  2XMH A;  1EZI A;  2OEF A;  1NMM B;  3ZGG A;  4JD0 A;  1R80 A;  1G23 A;  4ASY A;  1LL2 A;  5I1F A;  4BMA A;  4M4K A;  4NAI A;  4FRM A;  3DUV A;  3U0Y A;  5C3B A;  1MP3 A;  5AJO A;  1ZI1 A;  5D92 A;  1NKH B;  1YP3 A;  1K4V A;  4KC1 A;  3V8Y A;  5C4D A;  3OH0 A;  2Y4K A;  4M28 A;  4Y63 A;  1VGT A;  1INJ A;  2V0I A;  2O1G A;  2D7I A;  3POL A;  2YQJ A;  1FXJ A;  4P02 A;  1S4P A;  1HJJ A;  3TZT A;  1H5S A;  1OMZ A;  5C49 A;  1FGX A;  4FRE A;  4Y9X A;  3I0D A;  4B4B A;  4FCE A;  1NHE B;  2J0B A;  3I0H A;  2Y6P A;  5AJP A;  2WGZ A;  2FYB A;  2JCL A;  5FU8 A;  2FYC B;  1VIC A;  3I0C A;  3D5N A;  3IOJ A;  4B4M A;  2AM5 A;  2VXL A;  1WT2 A;  1QWJ A;  2AM3 A;  3RMV A;  4FIX A;  3V0Q A;  1JYL A;  1O7Q A;  1G8O A;  4KC4 A;  3RMW A;  5CMG X;  4KNR A;  1GA8 A;  2FFU A;  2FY7 A;  5CMI A;  3V8Z A;  1XZ6 A;  1W55 A;  1NQI B;  2XWM A;  1R7X A;  3U2X A;  3OH2 A;  1FR8 A;  4KRV A;  2VXM A;  2YES A;  1ZJO A;  4FRH A;  2XWL A;  2GGO A;  2NXV A;  1H7F A;  4AAW A;  1ZJP A;  4BQH A;  3OC9 A;  4IRP A;  2RJ8 A;  3DJ4 A;  1YP2 A;  3LW6 A;  2PGY A;  2QKX A;  2C0N A;  4G3S A;  2VS4 A;  1V84 A;  3BRK X;  3TQD A;  3V0P A;  1OMX A;  1TZF A;  5L6S A;  1JYK A;  1MP5 A;  3Q4S A;  4EEO A;  5C48 A;  2WE9 A;  4Y7T A;  2X65 A;  4ASJ A;  3KIA A;  3OKR A;  2X60 A;  1HM9 A;  5C4E A;  1HV9 A;  1H5S D;  3K8E A;  3F1C A;  1ZJ2 A;  3I0J A;  4NAN A;  2WVL A;  3USR A;  5L6V A;  1TW5 A;  5EIY A;  1VM8 A;  2O1F A;  2VSH A;  2BO4 A;  1R82 A;  1V82 A;  1ZJ0 A;  3CKO A;  3SXD A;  3SX5 A;  1H4E A;  1VGU A;  1IIM A;  2YC5 A;  4J18 A;  4ARW A;  3I0G A;  3T7M A;  3T7N A;  5EJ1 A;  1PZY B;  4HO3 A;  2AGD A;  4CVH A;  4AC3 A;  5C36 A;  4G3Q A;  5BXC A;  1LZI A;  3D98 A;  3Q7U A;  1YRO B;  4Y64 A;  1H7G A;  1TVY A;  4CJ8 A;  1H7T A;  4P00 A;  2Y4L A;  5EJZ A;  2XME A;  1W57 A;  2VK9 A;  5D91 A;  4L41 C;  2YC3 A;  4XWI A;  5FTV A;  3U2T A;  4DEC A;  5FUH A;  4EEM A;  1VH3 A;  3OGZ A;  1G9R A;  1FR9 A;  2DPW A;  4M2A A;  1R7T A;  5CQL X;  5C4B A;  1G0R A;  2AH9 A;  3CGX A;  4HOC A;  1ZCT A;  2PX7 A;  2QGI A;  2QH5 A;  4D0T A;  4G3P A;  4JIS A;  1JVG A;  5FTS A;  2RJ1 A;  5CMF X;  3CKJ A;  4NAK A;  2GGQ A;  1LVW A;  1FO9 A;  2V0H A;  2VFZ A;  1FXO A;  1ZCY A;  2RJ7 A;  1XHB A;  5CQN X;  1MC3 A;  1G97 A;  4B5B A;  2Z87 A;  4HO5 A;  3SX8 A;  4EEG A;  2O1H A;  4FRL A;  5C1H A;  3SX3 A;  1WSZ A;  5C38 A;  3I0L A;  1R81 A;  5FYE A;  1YP4 A;  1MP4 A;  4D0Z A;  1VZX A;  2BO7 A;  5C47 A;  3SXA A;  2RJ0 A;  1H5T A;  2A8U A;  2Q4J A;  4D11 C;  2E3D A;  4UEG A;  3V91 A;  4FCU A;  5IDT A;  3U0X A;  4EVW A;  2BO8 A;  2RIZ A;  3ST8 A;  4Y62 A;  1H7Q A;  1H4D A;  1ZIZ A;  3V0O A;  1QG8 A;  1FRW A;  1QGS A;  3R2W A;  4B4G A;  4LW6 A;  2I5E A;  2XWN A;  3V0L A;  5C4F A;  1NWG B;  1ZDG A;  4B2W A;  5FV9 A;  1ON8 A;  2RJ6 A;  1VGZ A;  5IFY A;  2RIX A;  2OI7 A;  2PGV A;  1S4N A;  4R7P A;  4EE5 A;  4Y7G A;  2A8W A;  1ZCU A;  2P6W A;  3SX7 A;  4Y7V A;  5J49 A;  2I5K A;  1HM0 A;  2ICY A;  4HO4 A;  2RJ5 A;  3U2U A;  4O6M A;  5C1G A;  4K6R A;  2D0J A;  2P72 A;  4YS8 A;  2RIT A;  5CMJ A;  3V0N A;  3E25 A;  2V0L A;  2W0W A;  3OH4 A;  3U2W A;  3I0K A;  2APC A;  1G1L A;  3HL3 A;  4Y7U A;  4O6N A;  4FRD A;  4B3U A;  1WT1 A;  3I0I X;  1ZI4 A;  1H7H A;  1GQC A;  2ZU9 A;  1TW1 A;  2I7B A;  4HO6 A;  1R7Y A;  4G87 A;  3DK5 A;  1R7U A;  3N9W A;  4B42 A;  1ZJ1 A;  1FO8 A;  1JV1 A;  2P73 A;  1VH1 A;  4HCQ A;  2WAW A;  2D7R A;  1HM8 A;  3K8D A;  1I52 A;  1PZT A;  3T7O A;  2YQS A;  4AYL A;  1LZJ A;  3SXG A;  2Y4M A;  4KC2 A;  1FOA A;  1JV3 A;  2ZU7 A;  1H7E A;  4C2S A;  4MIX A;  1H5R B;  1NF5 B;  1ZI3 A;  2FYD B;  1VPA A;  3FWW A;  4HO0 A;  4KT7 A;  3ZF8 A;  4Y6N A;  2OEG A;  3NGW A;  3FOQ A;  2AES A;  3CKQ A;  1WT0 A;  1ZI5 A;  5CQO A;  1G93 A;  4M2B A;  4EE4 A;  4ZDQ A;  5C3D A;  3F1Y A;  3R3I A;  2Y7A A;  3JUJ A;  1W77 A;  3SXE A;  2J0A A;  2UX8 A;  4B2X A;  3V0M A;  3I0F A;  2AE7 A;  3EE5 A;  5C3A A;  2W0V A;  4FQW A;  1INI A;  2OI5 A;  3V90 A;  2OI6 A;  1O0R A;  3ZLK A;  5C8R A;  1GX0 A;  3OAM A;  2WVM A;  2X5Z A;  4Y7F A;  1FZW A;  3CU0 A;  2JCK A;  1S4O A;  4HO8 A;  4HO2 A;  2JCJ A;  4IRQ A;  1O23 B;  4FRA A;  1H7L A;  2AEC A;  2MZB A;  2FYA A;  1E5K A;  2V0J A;  1JVD A;  4DDZ A;  3JUK A;  4Q7C A;  3I0E A;  1GWV A;  2ZU8 A;  4FRQ A;  1R7V A;  2CU2 A;  2FFV A;  2YQC A;  4LW3 A;  2AM4 A;  3U2V A;  1H5S B;  2WEE A;  4KXO A;  5C4C A;  1LL0 A;  1LL3 A;  1VZU A;  3D8V A;  3PNN A;  4EE3 A;  5JQQ A;  1OQM B;  4E1K A;  3QVB A;  1H4C A;  1WT3 A;  3CKV A;  1ZDF A;  3IOI A;  2VD4 A;  4D48 A;  1EYR A;  4KNX A;  3PKQ A;  1G3L A;  3USQ A;  1G95 A;  2X5S A;  2RJ9 A;  1FGG A;  5CMH A;  1KWS A;  1V83 A;  5CQP A;  2V0K A;  1FWY A;  2PA4 A;  5DDT A;  1G2V A;  3GUE A;  2E8B A;  1GX4 A;  4ECM A;  4HG6 A;  4Y6U A;  3SPT A;  2WVK A;  4GBP A;  1O7O A;  3RSB A;  4FRB A;  3E26 A;  4NAL A;  3ZGF A;  3OH1 A;  3SXB A;  2JCO A;  5AJN A;  4MND A;  4FRP A;  1VZT A;  4CJB A;  1IIN A;  1WVC A;  1H5T B;  3ZLL A;  3CKN A;  3JTJ A;  4DE7 A; 
#chains in the Genus database with same CATH homology
 1Z90 A;  2YQH A;  4CJC A;  1ZCV A;  1ZHJ A;  5HS2 A;  1ON6 A;  4KQL A;  4D11 A;  3O3P A;  2Y4J A;  2VS3 A;  1H5S C;  2VS5 A;  2Z86 A;  1H3M A;  1H5R A;  3SXC A;  4AYJ A;  2BO6 A;  4FRO A;  3IOH A;  1LZ0 A;  4KPZ A;  5C1L A;  4EEA A;  1ZJ3 A;  1FG5 N;  1SS9 A;  1GWW A;  1GQ9 A;  4KPX A;  2RIY A;  3OH3 A;  3Q80 A;  4MYB A;  1LZ7 A;  2YCM A;  1HJL A;  2VSI A;  2ICX A;  4FIY A;  5CQM X;  5FU0 A;  4HO9 A;  3BCV A;  5DDV A;  5IDS A;  2RJ4 A;  1QGQ A;  3PKP A;  1VGW A;  2XMH A;  1EZI A;  2OEF A;  1NMM B;  3ZGG A;  4JD0 A;  1R80 A;  1G23 A;  4ASY A;  1LL2 A;  5I1F A;  4BMA A;  4M4K A;  4NAI A;  4FRM A;  3DUV A;  3U0Y A;  5C3B A;  1MP3 A;  5AJO A;  1ZI1 A;  5D92 A;  1NKH B;  1YP3 A;  1K4V A;  4KC1 A;  3V8Y A;  5C4D A;  3OH0 A;  2Y4K A;  4M28 A;  4Y63 A;  1VGT A;  1INJ A;  2V0I A;  2O1G A;  2D7I A;  3POL A;  2YQJ A;  1FXJ A;  4P02 A;  1S4P A;  1HJJ A;  3TZT A;  1H5S A;  1OMZ A;  5C49 A;  1FGX A;  4FRE A;  4Y9X A;  3I0D A;  4B4B A;  4FCE A;  1NHE B;  2J0B A;  3I0H A;  2Y6P A;  5AJP A;  2WGZ A;  2FYB A;  2JCL A;  5FU8 A;  2FYC B;  1VIC A;  3I0C A;  3D5N A;  3IOJ A;  4B4M A;  2AM5 A;  2VXL A;  1WT2 A;  1QWJ A;  2AM3 A;  3RMV A;  4FIX A;  3V0Q A;  1JYL A;  1O7Q A;  1G8O A;  4KC4 A;  3RMW A;  5CMG X;  4KNR A;  1GA8 A;  2FFU A;  2FY7 A;  5CMI A;  3V8Z A;  1XZ6 A;  1W55 A;  1NQI B;  2XWM A;  1R7X A;  3U2X A;  3OH2 A;  1FR8 A;  4KRV A;  2VXM A;  2YES A;  1ZJO A;  4FRH A;  2XWL A;  2GGO A;  2NXV A;  1H7F A;  4AAW A;  1ZJP A;  4BQH A;  3OC9 A;  4IRP A;  2RJ8 A;  3DJ4 A;  1YP2 A;  3LW6 A;  2PGY A;  2QKX A;  2C0N A;  4G3S A;  2VS4 A;  1V84 A;  3BRK X;  3TQD A;  3V0P A;  1OMX A;  1TZF A;  5L6S A;  1JYK A;  1MP5 A;  3Q4S A;  4EEO A;  5C48 A;  2WE9 A;  4Y7T A;  2X65 A;  4ASJ A;  3KIA A;  3OKR A;  2X60 A;  1HM9 A;  5C4E A;  1HV9 A;  1H5S D;  3K8E A;  3F1C A;  1ZJ2 A;  3I0J A;  4NAN A;  2WVL A;  3USR A;  5L6V A;  1TW5 A;  5EIY A;  1VM8 A;  2O1F A;  2VSH A;  2BO4 A;  1R82 A;  1V82 A;  1ZJ0 A;  3CKO A;  3SXD A;  3SX5 A;  1H4E A;  1VGU A;  1IIM A;  2YC5 A;  4J18 A;  4ARW A;  3I0G A;  3T7M A;  3T7N A;  5EJ1 A;  1PZY B;  4HO3 A;  2AGD A;  4CVH A;  4AC3 A;  5C36 A;  4G3Q A;  5BXC A;  1LZI A;  3D98 A;  3Q7U A;  1YRO B;  4Y64 A;  1H7G A;  1TVY A;  4CJ8 A;  1H7T A;  4P00 A;  2Y4L A;  5EJZ A;  2XME A;  1W57 A;  2VK9 A;  5D91 A;  4L41 C;  2YC3 A;  4XWI A;  5FTV A;  3U2T A;  4DEC A;  5FUH A;  4EEM A;  1VH3 A;  3OGZ A;  1G9R A;  1FR9 A;  2DPW A;  4M2A A;  1R7T A;  5CQL X;  5C4B A;  1G0R A;  2AH9 A;  3CGX A;  4HOC A;  1ZCT A;  2PX7 A;  2QGI A;  2QH5 A;  4D0T A;  4G3P A;  4JIS A;  1JVG A;  5FTS A;  2RJ1 A;  5CMF X;  3CKJ A;  4NAK A;  2GGQ A;  1LVW A;  1FO9 A;  2V0H A;  2VFZ A;  1FXO A;  1ZCY A;  2RJ7 A;  1XHB A;  5CQN X;  1MC3 A;  1G97 A;  4B5B A;  2Z87 A;  4HO5 A;  3SX8 A;  4EEG A;  2O1H A;  4FRL A;  5C1H A;  3SX3 A;  1WSZ A;  5C38 A;  3I0L A;  1R81 A;  5FYE A;  1YP4 A;  1MP4 A;  4D0Z A;  1VZX A;  2BO7 A;  5C47 A;  3SXA A;  2RJ0 A;  1H5T A;  2A8U A;  2Q4J A;  4D11 C;  2E3D A;  4UEG A;  3V91 A;  4FCU A;  5IDT A;  3U0X A;  4EVW A;  2BO8 A;  2RIZ A;  3ST8 A;  4Y62 A;  1H7Q A;  1H4D A;  1ZIZ A;  3V0O A;  1QG8 A;  1FRW A;  1QGS A;  3R2W A;  4B4G A;  4LW6 A;  2I5E A;  2XWN A;  3V0L A;  5C4F A;  1NWG B;  1ZDG A;  4B2W A;  5FV9 A;  1ON8 A;  2RJ6 A;  1VGZ A;  5IFY A;  2RIX A;  2OI7 A;  2PGV A;  1S4N A;  4R7P A;  4EE5 A;  4Y7G A;  2A8W A;  1ZCU A;  2P6W A;  3SX7 A;  4Y7V A;  5J49 A;  2I5K A;  1HM0 A;  2ICY A;  4HO4 A;  2RJ5 A;  3U2U A;  4O6M A;  5C1G A;  4K6R A;  2D0J A;  2P72 A;  4YS8 A;  2RIT A;  5CMJ A;  3V0N A;  3E25 A;  2V0L A;  2W0W A;  3OH4 A;  3U2W A;  3I0K A;  2APC A;  1G1L A;  3HL3 A;  4Y7U A;  4O6N A;  4FRD A;  4B3U A;  1WT1 A;  3I0I X;  1ZI4 A;  1H7H A;  1GQC A;  2ZU9 A;  1TW1 A;  2I7B A;  4HO6 A;  1R7Y A;  4G87 A;  3DK5 A;  1R7U A;  3N9W A;  4B42 A;  1ZJ1 A;  1FO8 A;  1JV1 A;  2P73 A;  1VH1 A;  4HCQ A;  2WAW A;  2D7R A;  1HM8 A;  3K8D A;  1I52 A;  1PZT A;  3T7O A;  2YQS A;  4AYL A;  1LZJ A;  3SXG A;  2Y4M A;  4KC2 A;  1FOA A;  1JV3 A;  2ZU7 A;  1H7E A;  4C2S A;  4MIX A;  1H5R B;  1NF5 B;  1ZI3 A;  2FYD B;  1VPA A;  3FWW A;  4HO0 A;  4KT7 A;  3ZF8 A;  4Y6N A;  2OEG A;  3NGW A;  3FOQ A;  2AES A;  3CKQ A;  1WT0 A;  1ZI5 A;  5CQO A;  1G93 A;  4M2B A;  4EE4 A;  4ZDQ A;  5C3D A;  3F1Y A;  3R3I A;  2Y7A A;  3JUJ A;  1W77 A;  3SXE A;  2J0A A;  2UX8 A;  4B2X A;  3V0M A;  3I0F A;  2AE7 A;  3EE5 A;  5C3A A;  2W0V A;  4FQW A;  1INI A;  2OI5 A;  3V90 A;  2OI6 A;  1O0R A;  3ZLK A;  5C8R A;  1GX0 A;  3OAM A;  2WVM A;  2X5Z A;  4Y7F A;  1FZW A;  3CU0 A;  2JCK A;  1S4O A;  4HO8 A;  4HO2 A;  2JCJ A;  4IRQ A;  1O23 B;  4FRA A;  1H7L A;  2AEC A;  2MZB A;  2FYA A;  1E5K A;  2V0J A;  1JVD A;  4DDZ A;  3JUK A;  4Q7C A;  3I0E A;  1GWV A;  2ZU8 A;  4FRQ A;  1R7V A;  2CU2 A;  2FFV A;  2YQC A;  4LW3 A;  2AM4 A;  3U2V A;  1H5S B;  2WEE A;  4KXO A;  5C4C A;  1LL0 A;  1LL3 A;  1VZU A;  3D8V A;  3PNN A;  4EE3 A;  5JQQ A;  1OQM B;  4E1K A;  3QVB A;  1H4C A;  1WT3 A;  3CKV A;  1ZDF A;  3IOI A;  2VD4 A;  4D48 A;  1EYR A;  4KNX A;  3PKQ A;  1G3L A;  3USQ A;  1G95 A;  2X5S A;  2RJ9 A;  1FGG A;  5CMH A;  1KWS A;  1V83 A;  5CQP A;  2V0K A;  1FWY A;  2PA4 A;  5DDT A;  1G2V A;  3GUE A;  2E8B A;  1GX4 A;  4ECM A;  4HG6 A;  4Y6U A;  3SPT A;  2WVK A;  4GBP A;  1O7O A;  3RSB A;  4FRB A;  3E26 A;  4NAL A;  3ZGF A;  3OH1 A;  3SXB A;  2JCO A;  5AJN A;  4MND A;  4FRP A;  1VZT A;  4CJB A;  1IIN A;  1WVC A;  1H5T B;  3ZLL A;  3CKN A;  3JTJ A;  4DE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...