1MP4A

W224h variant of s. enterica rmla
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
289
structure length
289
Chain Sequence
MKTRKGIILAGGSGTRLYPVTMAVSQQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGSQWGLNLQYKVQPSPDGLAQAFIIGEEFIGHDDCALVLGDNIFYGHDLPKLMEAAVNKESGATVFAYHVNDPERYGVVEFDQAGTAVSLEEKPLQPKSNYAVTGLYFYDNSVVEMAKNLKPSARGELEITDINRIYMEQGRLSVAMMGRGYAHLDTGTHQSLIEASNFIATIEERQGLKVSCPEEIAFRKNFINAQQVIELAGPLSKNDYGKYLLKMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords W224H Variant of S. Enterica RmlA Bound to UDP-Glucose
publication title Expanding pyrimidine diphosphosugar libraries via structure-based nucleotidylyltransferase engineering
pubmed doi rcsb
source organism Salmonella enterica
total genus 93
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 2.7.7.24: Glucose-1-phosphate thymidylyltransferase.
pdb deposition date 2002-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1mp4A00
4FRLA 1HJJA 4C2SA 1VZTA 3JTJA 1WVCA 1R7XA 1ZJ3A 2AH9A 1ZI4A 4ASJA 1FO8A 1LVWA 1G3LA 4D11A 4Y6UA 2VS4A 4J18A 2FYDB 3SX5A 4HO9A 1H5SC 2OI6A 4HO0A 4HO5A 4EEAA 5BXCA 1WT2A 5CQPA 4FRQA 1VGZA 3CKNA 1NQIB 4Y7FA 2XWLA 1H7EA 5C4EA 3OH2A 2FFVA 2WGZA 2BO8A 4CJCA 5C1LA 3V91A 1R7VA 2YQSA 1VZUA 1O7OA 2I5KA 2RJ4A 4AAWA 1HV9A 3SX8A 3U2TA 4B2XA 3OH1A 5I1FA 4DDZA 5FUHA 2AESA 4Y7VA 1I52A 5AJOA 5C1HA 5FV9A 1Z90A 3ST8A 2FY7A 3D8VA 5CQLX 2Y4JA 2WEEA 3OGZA 4M28A 1JV3A 3JUJA 1H5TA 2PX7A 1HJLA 3O3PA 3U0YA 3SXEA 1ZI5A 1LL3A 3V0PA 1FXOA 4FRHA 5CMIA 5EJ1A 4AYJA 3N9WA 4L41C 2PGVA 3V0OA 2Z87A 2QKXA 3I0DA 1YP4A 1E5KA 3NGWA 2X5ZA 4XWIA 1G8OA 3I0HA 1FO9A 5FU0A 5AJNA 4FRBA 3CKJA 5DDTA 1KWSA 5HS2A 1VGWA 1VM8A 1LZ0A 1H5SA 1FWYA 3T7NA 3FOQA 1LZ7A 3ZLKA 1H7QA 2WVKA 2RIZA 4HO4A 4KRVA 1FG5N 2YC5A 1WT3A 2XMHA 3F1CA 1ZI1A 2YQHA 2X5SA 1G0RA 2VS5A 2DPWA 3V8YA 4M2BA 2WVLA 3R2WA 5CQOA 5C3DA 5FTSA 1YP3A 1NF5B 1EYRA 2OEGA 3U2WA 3SXAA 3D98A 2PGYA 5C8RA 2D7IA 4ZDQA 2ICXA 3V0NA 2Z86A 1S4OA 1GQCA 4NALA 4B4GA 1GA8A 1JYLA 3ZLLA 2AM4A 1FR9A 1XHBA 3SXDA 1H4DA 2BO4A 1LZJA 1FOAA 2FYAA 4EVWA 1OMXA 3D5NA 4EE4A 1QWJA 1VZXA 4FRMA 2RJ6A 1H7LA 1VH1A 4LW3A 4D0ZA 5IDTA 3DK5A 3IOHA 1NKHB 1S4NA 2WAWA 3R3IA 2A8WA 5FU8A 2ZU9A 1ZIZA 3PNNA 3U0XA 4CJBA 3I0CA 3CKVA 4IRQA 4B2WA 5C36A 2WVMA 2ICYA 3SX7A 3JUKA 4B3UA 4Y7TA 4EEMA 2O1FA 4FROA 3I0EA 4EEGA 2RJ7A 2XWMA 4EEOA 2YQJA 4MYBA 2V0HA 3I0FA 1ZI3A 4Y9XA 1MP3A 3V0LA 4FCEA 3SX3A 4Y64A 2RJ0A 3USRA 1R81A 1NMMB 1WT0A 4Y6NA 2Q4JA 4HO8A 1VH3A 3I0LA 1V82A 1SS9A 1INJA 2CU2A 1TVYA 1MC3A 3Q80A 3I0IX 1QGQA 2V0LA 4P00A 2P72A 1H3MA 1V83A 1VPAA 2BO6A 2FYBA 4JISA 3CU0A 1HM0A 4LW6A 4UEGA 4KC2A 3OC9A 1JYKA 5C1GA 5CQMX 1GX0A 4Y62A 1WSZA 2VS3A 1GX4A 1GWVA 1HM8A 3K8EA 1ZHJA 1GWWA 1JVGA 4KNXA 2AM5A 1G97A 4KPZA 5CMHA 2V0KA 5C48A 2Y4KA 3SXBA 5CMFX 1G95A 2E8BA 3BCVA 2JCOA 2RJ8A 1ZJ0A 3U2XA 4M4KA 2RIYA 3U2VA 1H4CA 2V0IA 1H7GA 1W55A 1QGSA 3ZGFA 3F1YA 4B5BA 4FRAA 5FTVA 2NXVA 4HCQA 3EE5A 4HO2A 4D0TA 3RMVA 1G2VA 1PZYB 5L6SA 3TZTA 1PZTA 1H5SB 1LL0A 3LW6A 3GUEA 3POLA 4B4BA 1FGXA 4G3PA 5DDVA 4BMAA 1YP2A 1IINA 4AYLA 2RITA 3CKQA 1H5RA 3V8ZA 3SXGA 2Y4MA 4KC1A 1ZJ1A 2P6WA 3T7OA 1TZFA 1H5SD 1VGTA 4FCUA 2YQCA 5C3AA 1QG8A 2YC3A 1GQ9A 4D48A 3RMWA 2XWNA 1XZ6A 2VD4A 3PKPA 2AM3A 1TW5A 1ZJPA 4NAKA 2BO7A 3SXCA 1EZIA 1OQMB 4P02A 5EIYA 3I0GA 4HOCA 2JCLA 3CGXA 2OEFA 2OI5A 2Y7AA 2OI7A 5C49A 4HG6A 2AECA 1FGGA 4KPXA 2RJ5A 2RIXA 4BQHA 2VXLA 1G9RA 3Q4SA 4NAIA 2O1HA 2Y4LA 1K4VA 3ZGGA 1JV1A 1S4PA 4FRDA 4DECA 4KQLA 4FQWA 1G1LA 1NHEB 4EE3A 2ZU7A 4MNDA 2V0JA 2W0WA 3K8DA 4E1KA 3CKOA 1ZJOA 4ARWA 2VFZA 3BRKX 2GGQA 2GGOA 2XMEA 2VXMA 5L6VA 4B42A 1ZDGA 3ZF8A 2I7BA 2D7RA 3SPTA 2QH5A 3V0QA 1R82A 2A8UA 2VSIA 2JCKA 2UX8A 4Y7UA 4M2AA 2P73A 1G93A 5C3BA 4Y7GA 2ZU8A 1ZJ2A 4G3SA 3OAMA 1FR8A 1LL2A 1ZCTA 2RJ1A 2AE7A 3OKRA 5C4BA 1H5TB 1FRWA 1ON6A 4KT7A 3TQDA 4FREA 1H7TA 2X65A 5C38A 2I5EA 1R7UA 3I0KA 1W57A 1HM9A 1LZIA 1O7QA 1TW1A 2WE9A 5J49A 3USQA 1JVDA 1MP4A 4KNRA 4FRPA 1H7FA 4R7PA 1ZDFA 5C4FA 4D11C 1R80A 3FWWA 1O23B 1V84A 2VSHA 3E25A 3IOJA 2QGIA 3V0MA 1ZCYA 2X60A 5C4DA 1MP5A 1G23A 1R7YA 1FZWA 3Q7UA 3KIAA 1W77A 5C47A 4K6RA 2D0JA 2MZBA 3QVBA 5JQQA 4ECMA 5FYEA 5CQNX 2JCJA 2RJ9A 3IOIA 3E26A 2APCA 1VICA 1H7HA 2YCMA 4YS8A 1WT1A 3OH3A 1ON8A 4IRPA 4ASYA 2AGDA 5C4CA 1H5RB 4HO3A 2PA4A 4CJ8A 3OH0A 1ZCVA 2E3DA 3T7MA 4JD0A 1FXJA 4HO6A 1O0RA 4DE7A 2FFUA 5IFYA 1ZCUA 4G3QA 4KXOA 3U2UA 3RSBA 1IIMA 5EJZA 4G87A 4CVHA 4KC4A 1NWGB 3OH4A 3V90A 3DJ4A 5CMGX 5CMJA 2Y6PA 4AC3A 1OMZA 2FYCB 5AJPA 4EE5A 1INIA 2O1GA 2YESA 2W0VA 1R7TA 3DUVA 4NANA 4Y63A 1YROB 3I0JA 3PKQA 4GBPA 1H4EA 5IDSA 3HL3A 4B4MA 1VGUA
chains in the Genus database with same CATH superfamily
4FRLA 1HJJA 4C2SA 1VZTA 3JTJA 1WVCA 1R7XA 1ZJ3A 2AH9A 1ZI4A 4ASJA 1FO8A 1LVWA 1G3LA 4D11A 4Y6UA 2VS4A 4J18A 2FYDB 3SX5A 4HO9A 1H5SC 2OI6A 4HO0A 4HO5A 4EEAA 5BXCA 1WT2A 5CQPA 4FRQA 1VGZA 3CKNA 1NQIB 4Y7FA 2XWLA 1H7EA 5C4EA 3OH2A 2FFVA 2WGZA 2BO8A 4CJCA 5C1LA 3V91A 1R7VA 2YQSA 1VZUA 1O7OA 2I5KA 2RJ4A 4AAWA 1HV9A 3SX8A 3U2TA 4B2XA 3OH1A 5I1FA 4DDZA 5FUHA 2AESA 4Y7VA 1I52A 5AJOA 5C1HA 5FV9A 1Z90A 3ST8A 2FY7A 3D8VA 5CQLX 2Y4JA 2WEEA 3OGZA 4M28A 1JV3A 3JUJA 1H5TA 2PX7A 1HJLA 3O3PA 3U0YA 3SXEA 1ZI5A 1LL3A 3V0PA 1FXOA 4FRHA 5CMIA 5EJ1A 4AYJA 3N9WA 4L41C 2PGVA 3V0OA 2Z87A 2QKXA 3I0DA 1YP4A 1E5KA 3NGWA 2X5ZA 4XWIA 1G8OA 3I0HA 1FO9A 2J0AA 5FU0A 5AJNA 4FRBA 3CKJA 5DDTA 1KWSA 5HS2A 1VGWA 1VM8A 4MIXA 1LZ0A 1H5SA 1FWYA 3T7NA 3FOQA 1LZ7A 3ZLKA 1H7QA 2WVKA 2RIZA 4HO4A 4KRVA 1FG5N 2YC5A 1WT3A 2XMHA 3F1CA 1ZI1A 2YQHA 2X5SA 1G0RA 2VS5A 2DPWA 3V8YA 4M2BA 2WVLA 3R2WA 5CQOA 5C3DA 5FTSA 1YP3A 1NF5B 1EYRA 2OEGA 3U2WA 3SXAA 3D98A 2PGYA 5C8RA 2D7IA 4O6MA 4ZDQA 2ICXA 3V0NA 2Z86A 1S4OA 1GQCA 4NALA 4B4GA 1GA8A 1JYLA 3ZLLA 2AM4A 1FR9A 1XHBA 3SXDA 1H4DA 2BO4A 1LZJA 1FOAA 2FYAA 4EVWA 1OMXA 3D5NA 4EE4A 1QWJA 1VZXA 4FRMA 2RJ6A 1H7LA 1VH1A 4LW3A 4D0ZA 5IDTA 3DK5A 3IOHA 1NKHB 1S4NA 2WAWA 3R3IA 2A8WA 5FU8A 2ZU9A 1ZIZA 3PNNA 3U0XA 4CJBA 3I0CA 3CKVA 4IRQA 4B2WA 5C36A 2WVMA 2ICYA 3SX7A 3JUKA 4B3UA 4Y7TA 4EEMA 2O1FA 4FROA 3I0EA 4EEGA 2RJ7A 2XWMA 4EEOA 2YQJA 4MYBA 2V0HA 3I0FA 1ZI3A 4Y9XA 1MP3A 3V0LA 4FCEA 3SX3A 4Y64A 2RJ0A 3USRA 1R81A 1NMMB 1WT0A 4Y6NA 2Q4JA 4HO8A 1VH3A 3I0LA 1V82A 1SS9A 1INJA 2CU2A 1TVYA 1MC3A 3Q80A 3I0IX 1QGQA 2V0LA 4P00A 2P72A 1H3MA 1V83A 1VPAA 2BO6A 2FYBA 4JISA 3CU0A 1HM0A 4LW6A 4UEGA 4KC2A 3OC9A 1JYKA 5C1GA 5CQMX 1GX0A 4Y62A 1WSZA 2VS3A 1GX4A 1GWVA 1HM8A 3K8EA 1ZHJA 1GWWA 1JVGA 4KNXA 2AM5A 1G97A 4KPZA 5CMHA 2V0KA 4FIYA 2C0NA 2Y4KA 5C48A 3SXBA 5CMFX 1G95A 2E8BA 3BCVA 4Q7CA 2JCOA 2RJ8A 1ZJ0A 3U2XA 4M4KA 2RIYA 3U2VA 1H4CA 2V0IA 1H7GA 1W55A 1QGSA 3ZGFA 3F1YA 4B5BA 4FRAA 5FTVA 2NXVA 4HCQA 3EE5A 4HO2A 4D0TA 3RMVA 1G2VA 1PZYB 5L6SA 3TZTA 1PZTA 1H5SB 1LL0A 3LW6A 3GUEA 3POLA 4B4BA 1FGXA 4G3PA 5DDVA 4BMAA 1YP2A 1IINA 4AYLA 2RITA 3CKQA 1H5RA 3V8ZA 3SXGA 2Y4MA 4KC1A 1ZJ1A 2P6WA 3T7OA 1TZFA 1H5SD 1VGTA 4FCUA 2YQCA 5C3AA 1QG8A 2YC3A 1GQ9A 4D48A 4O6NA 2XWNA 3RMWA 1XZ6A 2VD4A 3PKPA 2AM3A 1TW5A 1ZJPA 4NAKA 2BO7A 3SXCA 1EZIA 1OQMB 4P02A 5EIYA 3I0GA 4HOCA 2JCLA 3CGXA 2OEFA 2OI5A 2Y7AA 2OI7A 5C49A 4HG6A 2AECA 1FGGA 4FIXA 4KPXA 2RJ5A 2RIXA 4BQHA 2VXLA 1G9RA 3Q4SA 4NAIA 2O1HA 2Y4LA 1K4VA 3ZGGA 1JV1A 1S4PA 4FRDA 4DECA 4KQLA 4FQWA 1G1LA 1NHEB 4EE3A 2ZU7A 4MNDA 2V0JA 2W0WA 3K8DA 4E1KA 3CKOA 1ZJOA 4ARWA 2VFZA 2VK9A 3BRKX 2GGQA 2GGOA 2J0BA 2XMEA 2VXMA 5L6VA 4B42A 1ZDGA 3ZF8A 2I7BA 2D7RA 3SPTA 2QH5A 3V0QA 1R82A 2A8UA 2VSIA 2JCKA 2UX8A 4Y7UA 4M2AA 2P73A 1G93A 5C3BA 4Y7GA 2ZU8A 1ZJ2A 4G3SA 3OAMA 1FR8A 1LL2A 1ZCTA 2RJ1A 2AE7A 3OKRA 5C4BA 1H5TB 1FRWA 1ON6A 4KT7A 3TQDA 4FREA 1H7TA 2X65A 5C38A 2I5EA 1R7UA 3I0KA 1W57A 1HM9A 1LZIA 1O7QA 1TW1A 2WE9A 5J49A 3USQA 1JVDA 1MP4A 4KNRA 4FRPA 1H7FA 4R7PA 1ZDFA 5C4FA 4D11C 1R80A 3FWWA 1O23B 1V84A 2VSHA 3E25A 3IOJA 2QGIA 3V0MA 1ZCYA 2X60A 5C4DA 1MP5A 1G23A 1R7YA 1FZWA 3Q7UA 3KIAA 1W77A 5C47A 4K6RA 2D0JA 5D92A 2MZBA 3QVBA 5JQQA 4ECMA 5FYEA 5CQNX 2JCJA 2RJ9A 3IOIA 3E26A 2APCA 1VICA 1H7HA 2YCMA 4YS8A 1WT1A 3OH3A 1ON8A 4IRPA 4ASYA 2AGDA 5C4CA 1H5RB 4HO3A 2PA4A 4CJ8A 3OH0A 1ZCVA 5D91A 2E3DA 3T7MA 4JD0A 1FXJA 4HO6A 1O0RA 4DE7A 2FFUA 5IFYA 1ZCUA 4G3QA 4KXOA 3U2UA 3RSBA 1IIMA 5EJZA 4G87A 4CVHA 4KC4A 1NWGB 3OH4A 3V90A 3DJ4A 5CMGX 5CMJA 2Y6PA 4AC3A 1OMZA 2FYCB 5AJPA 4EE5A 1INIA 2O1GA 2YESA 2W0VA 1R7TA 3DUVA 4NANA 4Y63A 1YROB 3I0JA 3PKQA 4GBPA 1H4EA 5IDSA 3HL3A 4B4MA 1VGUA
chains in the Genus database with same CATH topology
4FRLA 1HJJA 4C2SA 1VZTA 3JTJA 1WVCA 1R7XA 1ZJ3A 2AH9A 1ZI4A 4ASJA 1FO8A 1LVWA 1G3LA 4D11A 4Y6UA 2VS4A 4J18A 2FYDB 3SX5A 4HO9A 1H5SC 2OI6A 4HO0A 4HO5A 4EEAA 5BXCA 1WT2A 5CQPA 4FRQA 1VGZA 3CKNA 1NQIB 4Y7FA 2XWLA 1H7EA 5C4EA 3OH2A 2FFVA 2WGZA 2BO8A 4CJCA 5C1LA 3V91A 1R7VA 2YQSA 1VZUA 1O7OA 2I5KA 2RJ4A 4AAWA 1HV9A 3SX8A 3U2TA 4B2XA 3OH1A 5I1FA 4DDZA 5FUHA 2AESA 4Y7VA 1I52A 5AJOA 5C1HA 5FV9A 1Z90A 3ST8A 2FY7A 3D8VA 5CQLX 2Y4JA 2WEEA 3OGZA 4M28A 1JV3A 3JUJA 1H5TA 2PX7A 1HJLA 3O3PA 3U0YA 3SXEA 1ZI5A 1LL3A 3V0PA 1FXOA 4FRHA 5CMIA 5EJ1A 4AYJA 3N9WA 4L41C 2PGVA 3V0OA 2Z87A 2QKXA 3I0DA 1YP4A 1E5KA 3NGWA 2X5ZA 4XWIA 1G8OA 3I0HA 1FO9A 2J0AA 5FU0A 5AJNA 4FRBA 3CKJA 5DDTA 1KWSA 5HS2A 1VGWA 1VM8A 4MIXA 1LZ0A 1H5SA 1FWYA 3T7NA 3FOQA 1LZ7A 3ZLKA 1H7QA 2WVKA 2RIZA 4HO4A 4KRVA 1FG5N 2YC5A 1WT3A 2XMHA 3F1CA 1ZI1A 2YQHA 2X5SA 1G0RA 2VS5A 2DPWA 3V8YA 4M2BA 2WVLA 3R2WA 5CQOA 5C3DA 5FTSA 1YP3A 1NF5B 1EYRA 2OEGA 3U2WA 3SXAA 3D98A 2PGYA 5C8RA 2D7IA 4O6MA 4ZDQA 2ICXA 3V0NA 2Z86A 1S4OA 1GQCA 4NALA 4B4GA 1GA8A 1JYLA 3ZLLA 2AM4A 1FR9A 1XHBA 3SXDA 1H4DA 2BO4A 1LZJA 1FOAA 2FYAA 4EVWA 1OMXA 3D5NA 4EE4A 1QWJA 1VZXA 4FRMA 2RJ6A 1H7LA 1VH1A 4LW3A 4D0ZA 5IDTA 3DK5A 3IOHA 1NKHB 1S4NA 2WAWA 3R3IA 2A8WA 5FU8A 2ZU9A 1ZIZA 3PNNA 3U0XA 4CJBA 3I0CA 3CKVA 4IRQA 4B2WA 5C36A 2WVMA 2ICYA 3SX7A 3JUKA 4B3UA 4Y7TA 4EEMA 2O1FA 4FROA 3I0EA 4EEGA 2RJ7A 2XWMA 4EEOA 2YQJA 4MYBA 2V0HA 3I0FA 1ZI3A 4Y9XA 1MP3A 3V0LA 4FCEA 3SX3A 4Y64A 2RJ0A 3USRA 1R81A 1NMMB 1WT0A 4Y6NA 2Q4JA 4HO8A 1VH3A 3I0LA 1V82A 1SS9A 1INJA 2CU2A 1TVYA 1MC3A 3Q80A 3I0IX 1QGQA 2V0LA 4P00A 2P72A 1H3MA 1V83A 1VPAA 2BO6A 2FYBA 4JISA 3CU0A 1HM0A 4LW6A 4UEGA 4KC2A 3OC9A 1JYKA 5C1GA 5CQMX 1GX0A 4Y62A 1WSZA 2VS3A 1GX4A 1GWVA 1HM8A 3K8EA 1ZHJA 1GWWA 1JVGA 4KNXA 2AM5A 1G97A 4KPZA 5CMHA 2V0KA 4FIYA 2C0NA 2Y4KA 5C48A 3SXBA 5CMFX 1G95A 2E8BA 3BCVA 4Q7CA 2JCOA 2RJ8A 1ZJ0A 3U2XA 4M4KA 2RIYA 3U2VA 1H4CA 2V0IA 1H7GA 1W55A 1QGSA 3ZGFA 3F1YA 4B5BA 4FRAA 5FTVA 2NXVA 4HCQA 3EE5A 4HO2A 4D0TA 3RMVA 1G2VA 1PZYB 5L6SA 3TZTA 1PZTA 1H5SB 1LL0A 3LW6A 3GUEA 3POLA 4B4BA 1FGXA 4G3PA 5DDVA 4BMAA 1YP2A 1IINA 4AYLA 2RITA 3CKQA 1H5RA 3V8ZA 3SXGA 2Y4MA 4KC1A 1ZJ1A 2P6WA 3T7OA 1TZFA 1H5SD 1VGTA 4FCUA 2YQCA 5C3AA 1QG8A 2YC3A 1GQ9A 4D48A 4O6NA 2XWNA 3RMWA 1XZ6A 2VD4A 3PKPA 2AM3A 1TW5A 1ZJPA 4NAKA 2BO7A 3SXCA 1EZIA 1OQMB 4P02A 5EIYA 3I0GA 4HOCA 2JCLA 3CGXA 2OEFA 2OI5A 2Y7AA 2OI7A 5C49A 4HG6A 2AECA 1FGGA 4FIXA 4KPXA 2RJ5A 2RIXA 4BQHA 2VXLA 1G9RA 3Q4SA 4NAIA 2O1HA 2Y4LA 1K4VA 3ZGGA 1JV1A 1S4PA 4FRDA 4DECA 4KQLA 4FQWA 1G1LA 1NHEB 4EE3A 2ZU7A 4MNDA 2V0JA 2W0WA 3K8DA 4E1KA 3CKOA 1ZJOA 4ARWA 2VFZA 2VK9A 3BRKX 2GGQA 2GGOA 2J0BA 2XMEA 2VXMA 5L6VA 4B42A 1ZDGA 3ZF8A 2I7BA 2D7RA 3SPTA 2QH5A 3V0QA 1R82A 2A8UA 2VSIA 2JCKA 2UX8A 4Y7UA 4M2AA 2P73A 1G93A 5C3BA 4Y7GA 2ZU8A 1ZJ2A 4G3SA 3OAMA 1FR8A 1LL2A 1ZCTA 2RJ1A 2AE7A 3OKRA 5C4BA 1H5TB 1FRWA 1ON6A 4KT7A 3TQDA 4FREA 1H7TA 2X65A 5C38A 2I5EA 1R7UA 3I0KA 1W57A 1HM9A 1LZIA 1O7QA 1TW1A 2WE9A 5J49A 3USQA 1JVDA 1MP4A 4KNRA 4FRPA 1H7FA 4R7PA 1ZDFA 5C4FA 4D11C 1R80A 3FWWA 1O23B 1V84A 2VSHA 3E25A 3IOJA 2QGIA 3V0MA 1ZCYA 2X60A 5C4DA 1MP5A 1G23A 1R7YA 1FZWA 3Q7UA 3KIAA 1W77A 5C47A 4K6RA 2D0JA 5D92A 2MZBA 3QVBA 5JQQA 4ECMA 5FYEA 5CQNX 2JCJA 2RJ9A 3IOIA 3E26A 2APCA 1VICA 1H7HA 2YCMA 4YS8A 1WT1A 3OH3A 1ON8A 4IRPA 4ASYA 2AGDA 5C4CA 1H5RB 4HO3A 2PA4A 4CJ8A 3OH0A 1ZCVA 5D91A 2E3DA 3T7MA 4JD0A 1FXJA 4HO6A 1O0RA 4DE7A 2FFUA 5IFYA 1ZCUA 4G3QA 4KXOA 3U2UA 3RSBA 1IIMA 5EJZA 4G87A 4CVHA 4KC4A 1NWGB 3OH4A 3V90A 3DJ4A 5CMGX 5CMJA 2Y6PA 4AC3A 1OMZA 2FYCB 5AJPA 4EE5A 1INIA 2O1GA 2YESA 2W0VA 1R7TA 3DUVA 4NANA 4Y63A 1YROB 3I0JA 3PKQA 4GBPA 1H4EA 5IDSA 3HL3A 4B4MA 1VGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FRL A;  1HJJ A;  4C2S A;  1VZT A;  3JTJ A;  1WVC A;  1R7X A;  1ZJ3 A;  2AH9 A;  1ZI4 A;  4ASJ A;  1FO8 A;  1LVW A;  1G3L A;  4D11 A;  4Y6U A;  2VS4 A;  4J18 A;  2FYD B;  3SX5 A;  4HO9 A;  1H5S C;  2OI6 A;  4HO0 A;  4HO5 A;  4EEA A;  5BXC A;  1WT2 A;  5CQP A;  4FRQ A;  1VGZ A;  3CKN A;  1NQI B;  4Y7F A;  2XWL A;  1H7E A;  5C4E A;  3OH2 A;  2FFV A;  2WGZ A;  2BO8 A;  4CJC A;  5C1L A;  3V91 A;  1R7V A;  2YQS A;  1VZU A;  1O7O A;  2I5K A;  2RJ4 A;  4AAW A;  1HV9 A;  3SX8 A;  3U2T A;  4B2X A;  3OH1 A;  5I1F A;  4DDZ A;  5FUH A;  2AES A;  4Y7V A;  1I52 A;  5AJO A;  5C1H A;  5FV9 A;  1Z90 A;  3ST8 A;  2FY7 A;  3D8V A;  5CQL X;  2Y4J A;  2WEE A;  3OGZ A;  4M28 A;  1JV3 A;  3JUJ A;  1H5T A;  2PX7 A;  1HJL A;  3O3P A;  3U0Y A;  3SXE A;  1ZI5 A;  1LL3 A;  3V0P A;  1FXO A;  4FRH A;  5CMI A;  5EJ1 A;  4AYJ A;  3N9W A;  4L41 C;  2PGV A;  3V0O A;  2Z87 A;  2QKX A;  3I0D A;  1YP4 A;  1E5K A;  3NGW A;  2X5Z A;  4XWI A;  1G8O A;  3I0H A;  1FO9 A;  5FU0 A;  5AJN A;  4FRB A;  3CKJ A;  5DDT A;  1KWS A;  5HS2 A;  1VGW A;  1VM8 A;  1LZ0 A;  1H5S A;  1FWY A;  3T7N A;  3FOQ A;  1LZ7 A;  3ZLK A;  1H7Q A;  2WVK A;  2RIZ A;  4HO4 A;  4KRV A;  1FG5 N;  2YC5 A;  1WT3 A;  2XMH A;  3F1C A;  1ZI1 A;  2YQH A;  2X5S A;  1G0R A;  2VS5 A;  2DPW A;  3V8Y A;  4M2B A;  2WVL A;  3R2W A;  5CQO A;  5C3D A;  5FTS A;  1YP3 A;  1NF5 B;  1EYR A;  2OEG A;  3U2W A;  3SXA A;  3D98 A;  2PGY A;  5C8R A;  2D7I A;  4ZDQ A;  2ICX A;  3V0N A;  2Z86 A;  1S4O A;  1GQC A;  4NAL A;  4B4G A;  1GA8 A;  1JYL A;  3ZLL A;  2AM4 A;  1FR9 A;  1XHB A;  3SXD A;  1H4D A;  2BO4 A;  1LZJ A;  1FOA A;  2FYA A;  4EVW A;  1OMX A;  3D5N A;  4EE4 A;  1QWJ A;  1VZX A;  4FRM A;  2RJ6 A;  1H7L A;  1VH1 A;  4LW3 A;  4D0Z A;  5IDT A;  3DK5 A;  3IOH A;  1NKH B;  1S4N A;  2WAW A;  3R3I A;  2A8W A;  5FU8 A;  2ZU9 A;  1ZIZ A;  3PNN A;  3U0X A;  4CJB A;  3I0C A;  3CKV A;  4IRQ A;  4B2W A;  5C36 A;  2WVM A;  2ICY A;  3SX7 A;  3JUK A;  4B3U A;  4Y7T A;  4EEM A;  2O1F A;  4FRO A;  3I0E A;  4EEG A;  2RJ7 A;  2XWM A;  4EEO A;  2YQJ A;  4MYB A;  2V0H A;  3I0F A;  1ZI3 A;  4Y9X A;  1MP3 A;  3V0L A;  4FCE A;  3SX3 A;  4Y64 A;  2RJ0 A;  3USR A;  1R81 A;  1NMM B;  1WT0 A;  4Y6N A;  2Q4J A;  4HO8 A;  1VH3 A;  3I0L A;  1V82 A;  1SS9 A;  1INJ A;  2CU2 A;  1TVY A;  1MC3 A;  3Q80 A;  3I0I X;  1QGQ A;  2V0L A;  4P00 A;  2P72 A;  1H3M A;  1V83 A;  1VPA A;  2BO6 A;  2FYB A;  4JIS A;  3CU0 A;  1HM0 A;  4LW6 A;  4UEG A;  4KC2 A;  3OC9 A;  1JYK A;  5C1G A;  5CQM X;  1GX0 A;  4Y62 A;  1WSZ A;  2VS3 A;  1GX4 A;  1GWV A;  1HM8 A;  3K8E A;  1ZHJ A;  1GWW A;  1JVG A;  4KNX A;  2AM5 A;  1G97 A;  4KPZ A;  5CMH A;  2V0K A;  5C48 A;  2Y4K A;  3SXB A;  5CMF X;  1G95 A;  2E8B A;  3BCV A;  2JCO A;  2RJ8 A;  1ZJ0 A;  3U2X A;  4M4K A;  2RIY A;  3U2V A;  1H4C A;  2V0I A;  1H7G A;  1W55 A;  1QGS A;  3ZGF A;  3F1Y A;  4B5B A;  4FRA A;  5FTV A;  2NXV A;  4HCQ A;  3EE5 A;  4HO2 A;  4D0T A;  3RMV A;  1G2V A;  1PZY B;  5L6S A;  3TZT A;  1PZT A;  1H5S B;  1LL0 A;  3LW6 A;  3GUE A;  3POL A;  4B4B A;  1FGX A;  4G3P A;  5DDV A;  4BMA A;  1YP2 A;  1IIN A;  4AYL A;  2RIT A;  3CKQ A;  1H5R A;  3V8Z A;  3SXG A;  2Y4M A;  4KC1 A;  1ZJ1 A;  2P6W A;  3T7O A;  1TZF A;  1H5S D;  1VGT A;  4FCU A;  2YQC A;  5C3A A;  1QG8 A;  2YC3 A;  1GQ9 A;  4D48 A;  3RMW A;  2XWN A;  1XZ6 A;  2VD4 A;  3PKP A;  2AM3 A;  1TW5 A;  1ZJP A;  4NAK A;  2BO7 A;  3SXC A;  1EZI A;  1OQM B;  4P02 A;  5EIY A;  3I0G A;  4HOC A;  2JCL A;  3CGX A;  2OEF A;  2OI5 A;  2Y7A A;  2OI7 A;  5C49 A;  4HG6 A;  2AEC A;  1FGG A;  4KPX A;  2RJ5 A;  2RIX A;  4BQH A;  2VXL A;  1G9R A;  3Q4S A;  4NAI A;  2O1H A;  2Y4L A;  1K4V A;  3ZGG A;  1JV1 A;  1S4P A;  4FRD A;  4DEC A;  4KQL A;  4FQW A;  1G1L A;  1NHE B;  4EE3 A;  2ZU7 A;  4MND A;  2V0J A;  2W0W A;  3K8D A;  4E1K A;  3CKO A;  1ZJO A;  4ARW A;  2VFZ A;  3BRK X;  2GGQ A;  2GGO A;  2XME A;  2VXM A;  5L6V A;  4B42 A;  1ZDG A;  3ZF8 A;  2I7B A;  2D7R A;  3SPT A;  2QH5 A;  3V0Q A;  1R82 A;  2A8U A;  2VSI A;  2JCK A;  2UX8 A;  4Y7U A;  4M2A A;  2P73 A;  1G93 A;  5C3B A;  4Y7G A;  2ZU8 A;  1ZJ2 A;  4G3S A;  3OAM A;  1FR8 A;  1LL2 A;  1ZCT A;  2RJ1 A;  2AE7 A;  3OKR A;  5C4B A;  1H5T B;  1FRW A;  1ON6 A;  4KT7 A;  3TQD A;  4FRE A;  1H7T A;  2X65 A;  5C38 A;  2I5E A;  1R7U A;  3I0K A;  1W57 A;  1HM9 A;  1LZI A;  1O7Q A;  1TW1 A;  2WE9 A;  5J49 A;  3USQ A;  1JVD A;  1MP4 A;  4KNR A;  4FRP A;  1H7F A;  4R7P A;  1ZDF A;  5C4F A;  4D11 C;  1R80 A;  3FWW A;  1O23 B;  1V84 A;  2VSH A;  3E25 A;  3IOJ A;  2QGI A;  3V0M A;  1ZCY A;  2X60 A;  5C4D A;  1MP5 A;  1G23 A;  1R7Y A;  1FZW A;  3Q7U A;  3KIA A;  1W77 A;  5C47 A;  4K6R A;  2D0J A;  2MZB A;  3QVB A;  5JQQ A;  4ECM A;  5FYE A;  5CQN X;  2JCJ A;  2RJ9 A;  3IOI A;  3E26 A;  2APC A;  1VIC A;  1H7H A;  2YCM A;  4YS8 A;  1WT1 A;  3OH3 A;  1ON8 A;  4IRP A;  4ASY A;  2AGD A;  5C4C A;  1H5R B;  4HO3 A;  2PA4 A;  4CJ8 A;  3OH0 A;  1ZCV A;  2E3D A;  3T7M A;  4JD0 A;  1FXJ A;  4HO6 A;  1O0R A;  4DE7 A;  2FFU A;  5IFY A;  1ZCU A;  4G3Q A;  4KXO A;  3U2U A;  3RSB A;  1IIM A;  5EJZ A;  4G87 A;  4CVH A;  4KC4 A;  1NWG B;  3OH4 A;  3V90 A;  3DJ4 A;  5CMG X;  5CMJ A;  2Y6P A;  4AC3 A;  1OMZ A;  2FYC B;  5AJP A;  4EE5 A;  1INI A;  2O1G A;  2YES A;  2W0V A;  1R7T A;  3DUV A;  4NAN A;  4Y63 A;  1YRO B;  3I0J A;  3PKQ A;  4GBP A;  1H4E A;  5IDS A;  3HL3 A;  4B4M A;  1VGU A; 
#chains in the Genus database with same CATH topology
 4FRL A;  1HJJ A;  4C2S A;  1VZT A;  3JTJ A;  1WVC A;  1R7X A;  1ZJ3 A;  2AH9 A;  1ZI4 A;  4ASJ A;  1FO8 A;  1LVW A;  1G3L A;  4D11 A;  4Y6U A;  2VS4 A;  4J18 A;  2FYD B;  3SX5 A;  4HO9 A;  1H5S C;  2OI6 A;  4HO0 A;  4HO5 A;  4EEA A;  5BXC A;  1WT2 A;  5CQP A;  4FRQ A;  1VGZ A;  3CKN A;  1NQI B;  4Y7F A;  2XWL A;  1H7E A;  5C4E A;  3OH2 A;  2FFV A;  2WGZ A;  2BO8 A;  4CJC A;  5C1L A;  3V91 A;  1R7V A;  2YQS A;  1VZU A;  1O7O A;  2I5K A;  2RJ4 A;  4AAW A;  1HV9 A;  3SX8 A;  3U2T A;  4B2X A;  3OH1 A;  5I1F A;  4DDZ A;  5FUH A;  2AES A;  4Y7V A;  1I52 A;  5AJO A;  5C1H A;  5FV9 A;  1Z90 A;  3ST8 A;  2FY7 A;  3D8V A;  5CQL X;  2Y4J A;  2WEE A;  3OGZ A;  4M28 A;  1JV3 A;  3JUJ A;  1H5T A;  2PX7 A;  1HJL A;  3O3P A;  3U0Y A;  3SXE A;  1ZI5 A;  1LL3 A;  3V0P A;  1FXO A;  4FRH A;  5CMI A;  5EJ1 A;  4AYJ A;  3N9W A;  4L41 C;  2PGV A;  3V0O A;  2Z87 A;  2QKX A;  3I0D A;  1YP4 A;  1E5K A;  3NGW A;  2X5Z A;  4XWI A;  1G8O A;  3I0H A;  1FO9 A;  2J0A A;  5FU0 A;  5AJN A;  4FRB A;  3CKJ A;  5DDT A;  1KWS A;  5HS2 A;  1VGW A;  1VM8 A;  4MIX A;  1LZ0 A;  1H5S A;  1FWY A;  3T7N A;  3FOQ A;  1LZ7 A;  3ZLK A;  1H7Q A;  2WVK A;  2RIZ A;  4HO4 A;  4KRV A;  1FG5 N;  2YC5 A;  1WT3 A;  2XMH A;  3F1C A;  1ZI1 A;  2YQH A;  2X5S A;  1G0R A;  2VS5 A;  2DPW A;  3V8Y A;  4M2B A;  2WVL A;  3R2W A;  5CQO A;  5C3D A;  5FTS A;  1YP3 A;  1NF5 B;  1EYR A;  2OEG A;  3U2W A;  3SXA A;  3D98 A;  2PGY A;  5C8R A;  2D7I A;  4O6M A;  4ZDQ A;  2ICX A;  3V0N A;  2Z86 A;  1S4O A;  1GQC A;  4NAL A;  4B4G A;  1GA8 A;  1JYL A;  3ZLL A;  2AM4 A;  1FR9 A;  1XHB A;  3SXD A;  1H4D A;  2BO4 A;  1LZJ A;  1FOA A;  2FYA A;  4EVW A;  1OMX A;  3D5N A;  4EE4 A;  1QWJ A;  1VZX A;  4FRM A;  2RJ6 A;  1H7L A;  1VH1 A;  4LW3 A;  4D0Z A;  5IDT A;  3DK5 A;  3IOH A;  1NKH B;  1S4N A;  2WAW A;  3R3I A;  2A8W A;  5FU8 A;  2ZU9 A;  1ZIZ A;  3PNN A;  3U0X A;  4CJB A;  3I0C A;  3CKV A;  4IRQ A;  4B2W A;  5C36 A;  2WVM A;  2ICY A;  3SX7 A;  3JUK A;  4B3U A;  4Y7T A;  4EEM A;  2O1F A;  4FRO A;  3I0E A;  4EEG A;  2RJ7 A;  2XWM A;  4EEO A;  2YQJ A;  4MYB A;  2V0H A;  3I0F A;  1ZI3 A;  4Y9X A;  1MP3 A;  3V0L A;  4FCE A;  3SX3 A;  4Y64 A;  2RJ0 A;  3USR A;  1R81 A;  1NMM B;  1WT0 A;  4Y6N A;  2Q4J A;  4HO8 A;  1VH3 A;  3I0L A;  1V82 A;  1SS9 A;  1INJ A;  2CU2 A;  1TVY A;  1MC3 A;  3Q80 A;  3I0I X;  1QGQ A;  2V0L A;  4P00 A;  2P72 A;  1H3M A;  1V83 A;  1VPA A;  2BO6 A;  2FYB A;  4JIS A;  3CU0 A;  1HM0 A;  4LW6 A;  4UEG A;  4KC2 A;  3OC9 A;  1JYK A;  5C1G A;  5CQM X;  1GX0 A;  4Y62 A;  1WSZ A;  2VS3 A;  1GX4 A;  1GWV A;  1HM8 A;  3K8E A;  1ZHJ A;  1GWW A;  1JVG A;  4KNX A;  2AM5 A;  1G97 A;  4KPZ A;  5CMH A;  2V0K A;  4FIY A;  2C0N A;  2Y4K A;  5C48 A;  3SXB A;  5CMF X;  1G95 A;  2E8B A;  3BCV A;  4Q7C A;  2JCO A;  2RJ8 A;  1ZJ0 A;  3U2X A;  4M4K A;  2RIY A;  3U2V A;  1H4C A;  2V0I A;  1H7G A;  1W55 A;  1QGS A;  3ZGF A;  3F1Y A;  4B5B A;  4FRA A;  5FTV A;  2NXV A;  4HCQ A;  3EE5 A;  4HO2 A;  4D0T A;  3RMV A;  1G2V A;  1PZY B;  5L6S A;  3TZT A;  1PZT A;  1H5S B;  1LL0 A;  3LW6 A;  3GUE A;  3POL A;  4B4B A;  1FGX A;  4G3P A;  5DDV A;  4BMA A;  1YP2 A;  1IIN A;  4AYL A;  2RIT A;  3CKQ A;  1H5R A;  3V8Z A;  3SXG A;  2Y4M A;  4KC1 A;  1ZJ1 A;  2P6W A;  3T7O A;  1TZF A;  1H5S D;  1VGT A;  4FCU A;  2YQC A;  5C3A A;  1QG8 A;  2YC3 A;  1GQ9 A;  4D48 A;  4O6N A;  2XWN A;  3RMW A;  1XZ6 A;  2VD4 A;  3PKP A;  2AM3 A;  1TW5 A;  1ZJP A;  4NAK A;  2BO7 A;  3SXC A;  1EZI A;  1OQM B;  4P02 A;  5EIY A;  3I0G A;  4HOC A;  2JCL A;  3CGX A;  2OEF A;  2OI5 A;  2Y7A A;  2OI7 A;  5C49 A;  4HG6 A;  2AEC A;  1FGG A;  4FIX A;  4KPX A;  2RJ5 A;  2RIX A;  4BQH A;  2VXL A;  1G9R A;  3Q4S A;  4NAI A;  2O1H A;  2Y4L A;  1K4V A;  3ZGG A;  1JV1 A;  1S4P A;  4FRD A;  4DEC A;  4KQL A;  4FQW A;  1G1L A;  1NHE B;  4EE3 A;  2ZU7 A;  4MND A;  2V0J A;  2W0W A;  3K8D A;  4E1K A;  3CKO A;  1ZJO A;  4ARW A;  2VFZ A;  2VK9 A;  3BRK X;  2GGQ A;  2GGO A;  2J0B A;  2XME A;  2VXM A;  5L6V A;  4B42 A;  1ZDG A;  3ZF8 A;  2I7B A;  2D7R A;  3SPT A;  2QH5 A;  3V0Q A;  1R82 A;  2A8U A;  2VSI A;  2JCK A;  2UX8 A;  4Y7U A;  4M2A A;  2P73 A;  1G93 A;  5C3B A;  4Y7G A;  2ZU8 A;  1ZJ2 A;  4G3S A;  3OAM A;  1FR8 A;  1LL2 A;  1ZCT A;  2RJ1 A;  2AE7 A;  3OKR A;  5C4B A;  1H5T B;  1FRW A;  1ON6 A;  4KT7 A;  3TQD A;  4FRE A;  1H7T A;  2X65 A;  5C38 A;  2I5E A;  1R7U A;  3I0K A;  1W57 A;  1HM9 A;  1LZI A;  1O7Q A;  1TW1 A;  2WE9 A;  5J49 A;  3USQ A;  1JVD A;  1MP4 A;  4KNR A;  4FRP A;  1H7F A;  4R7P A;  1ZDF A;  5C4F A;  4D11 C;  1R80 A;  3FWW A;  1O23 B;  1V84 A;  2VSH A;  3E25 A;  3IOJ A;  2QGI A;  3V0M A;  1ZCY A;  2X60 A;  5C4D A;  1MP5 A;  1G23 A;  1R7Y A;  1FZW A;  3Q7U A;  3KIA A;  1W77 A;  5C47 A;  4K6R A;  2D0J A;  5D92 A;  2MZB A;  3QVB A;  5JQQ A;  4ECM A;  5FYE A;  5CQN X;  2JCJ A;  2RJ9 A;  3IOI A;  3E26 A;  2APC A;  1VIC A;  1H7H A;  2YCM A;  4YS8 A;  1WT1 A;  3OH3 A;  1ON8 A;  4IRP A;  4ASY A;  2AGD A;  5C4C A;  1H5R B;  4HO3 A;  2PA4 A;  4CJ8 A;  3OH0 A;  1ZCV A;  5D91 A;  2E3D A;  3T7M A;  4JD0 A;  1FXJ A;  4HO6 A;  1O0R A;  4DE7 A;  2FFU A;  5IFY A;  1ZCU A;  4G3Q A;  4KXO A;  3U2U A;  3RSB A;  1IIM A;  5EJZ A;  4G87 A;  4CVH A;  4KC4 A;  1NWG B;  3OH4 A;  3V90 A;  3DJ4 A;  5CMG X;  5CMJ A;  2Y6P A;  4AC3 A;  1OMZ A;  2FYC B;  5AJP A;  4EE5 A;  1INI A;  2O1G A;  2YES A;  2W0V A;  1R7T A;  3DUV A;  4NAN A;  4Y63 A;  1YRO B;  3I0J A;  3PKQ A;  4GBP A;  1H4E A;  5IDS A;  3HL3 A;  4B4M A;  1VGU A; 
#chains in the Genus database with same CATH homology
 4FRL A;  1HJJ A;  4C2S A;  1VZT A;  3JTJ A;  1WVC A;  1R7X A;  1ZJ3 A;  2AH9 A;  1ZI4 A;  4ASJ A;  1FO8 A;  1LVW A;  1G3L A;  4D11 A;  4Y6U A;  2VS4 A;  4J18 A;  2FYD B;  3SX5 A;  4HO9 A;  1H5S C;  2OI6 A;  4HO0 A;  4HO5 A;  4EEA A;  5BXC A;  1WT2 A;  5CQP A;  4FRQ A;  1VGZ A;  3CKN A;  1NQI B;  4Y7F A;  2XWL A;  1H7E A;  5C4E A;  3OH2 A;  2FFV A;  2WGZ A;  2BO8 A;  4CJC A;  5C1L A;  3V91 A;  1R7V A;  2YQS A;  1VZU A;  1O7O A;  2I5K A;  2RJ4 A;  4AAW A;  1HV9 A;  3SX8 A;  3U2T A;  4B2X A;  3OH1 A;  5I1F A;  4DDZ A;  5FUH A;  2AES A;  4Y7V A;  1I52 A;  5AJO A;  5C1H A;  5FV9 A;  1Z90 A;  3ST8 A;  2FY7 A;  3D8V A;  5CQL X;  2Y4J A;  2WEE A;  3OGZ A;  4M28 A;  1JV3 A;  3JUJ A;  1H5T A;  2PX7 A;  1HJL A;  3O3P A;  3U0Y A;  3SXE A;  1ZI5 A;  1LL3 A;  3V0P A;  1FXO A;  4FRH A;  5CMI A;  5EJ1 A;  4AYJ A;  3N9W A;  4L41 C;  2PGV A;  3V0O A;  2Z87 A;  2QKX A;  3I0D A;  1YP4 A;  1E5K A;  3NGW A;  2X5Z A;  4XWI A;  1G8O A;  3I0H A;  1FO9 A;  2J0A A;  5FU0 A;  5AJN A;  4FRB A;  3CKJ A;  5DDT A;  1KWS A;  5HS2 A;  1VGW A;  1VM8 A;  4MIX A;  1LZ0 A;  1H5S A;  1FWY A;  3T7N A;  3FOQ A;  1LZ7 A;  3ZLK A;  1H7Q A;  2WVK A;  2RIZ A;  4HO4 A;  4KRV A;  1FG5 N;  2YC5 A;  1WT3 A;  2XMH A;  3F1C A;  1ZI1 A;  2YQH A;  2X5S A;  1G0R A;  2VS5 A;  2DPW A;  3V8Y A;  4M2B A;  2WVL A;  3R2W A;  5CQO A;  5C3D A;  5FTS A;  1YP3 A;  1NF5 B;  1EYR A;  2OEG A;  3U2W A;  3SXA A;  3D98 A;  2PGY A;  5C8R A;  2D7I A;  4O6M A;  4ZDQ A;  2ICX A;  3V0N A;  2Z86 A;  1S4O A;  1GQC A;  4NAL A;  4B4G A;  1GA8 A;  1JYL A;  3ZLL A;  2AM4 A;  1FR9 A;  1XHB A;  3SXD A;  1H4D A;  2BO4 A;  1LZJ A;  1FOA A;  2FYA A;  4EVW A;  1OMX A;  3D5N A;  4EE4 A;  1QWJ A;  1VZX A;  4FRM A;  2RJ6 A;  1H7L A;  1VH1 A;  4LW3 A;  4D0Z A;  5IDT A;  3DK5 A;  3IOH A;  1NKH B;  1S4N A;  2WAW A;  3R3I A;  2A8W A;  5FU8 A;  2ZU9 A;  1ZIZ A;  3PNN A;  3U0X A;  4CJB A;  3I0C A;  3CKV A;  4IRQ A;  4B2W A;  5C36 A;  2WVM A;  2ICY A;  3SX7 A;  3JUK A;  4B3U A;  4Y7T A;  4EEM A;  2O1F A;  4FRO A;  3I0E A;  4EEG A;  2RJ7 A;  2XWM A;  4EEO A;  2YQJ A;  4MYB A;  2V0H A;  3I0F A;  1ZI3 A;  4Y9X A;  1MP3 A;  3V0L A;  4FCE A;  3SX3 A;  4Y64 A;  2RJ0 A;  3USR A;  1R81 A;  1NMM B;  1WT0 A;  4Y6N A;  2Q4J A;  4HO8 A;  1VH3 A;  3I0L A;  1V82 A;  1SS9 A;  1INJ A;  2CU2 A;  1TVY A;  1MC3 A;  3Q80 A;  3I0I X;  1QGQ A;  2V0L A;  4P00 A;  2P72 A;  1H3M A;  1V83 A;  1VPA A;  2BO6 A;  2FYB A;  4JIS A;  3CU0 A;  1HM0 A;  4LW6 A;  4UEG A;  4KC2 A;  3OC9 A;  1JYK A;  5C1G A;  5CQM X;  1GX0 A;  4Y62 A;  1WSZ A;  2VS3 A;  1GX4 A;  1GWV A;  1HM8 A;  3K8E A;  1ZHJ A;  1GWW A;  1JVG A;  4KNX A;  2AM5 A;  1G97 A;  4KPZ A;  5CMH A;  2V0K A;  4FIY A;  2C0N A;  2Y4K A;  5C48 A;  3SXB A;  5CMF X;  1G95 A;  2E8B A;  3BCV A;  4Q7C A;  2JCO A;  2RJ8 A;  1ZJ0 A;  3U2X A;  4M4K A;  2RIY A;  3U2V A;  1H4C A;  2V0I A;  1H7G A;  1W55 A;  1QGS A;  3ZGF A;  3F1Y A;  4B5B A;  4FRA A;  5FTV A;  2NXV A;  4HCQ A;  3EE5 A;  4HO2 A;  4D0T A;  3RMV A;  1G2V A;  1PZY B;  5L6S A;  3TZT A;  1PZT A;  1H5S B;  1LL0 A;  3LW6 A;  3GUE A;  3POL A;  4B4B A;  1FGX A;  4G3P A;  5DDV A;  4BMA A;  1YP2 A;  1IIN A;  4AYL A;  2RIT A;  3CKQ A;  1H5R A;  3V8Z A;  3SXG A;  2Y4M A;  4KC1 A;  1ZJ1 A;  2P6W A;  3T7O A;  1TZF A;  1H5S D;  1VGT A;  4FCU A;  2YQC A;  5C3A A;  1QG8 A;  2YC3 A;  1GQ9 A;  4D48 A;  4O6N A;  2XWN A;  3RMW A;  1XZ6 A;  2VD4 A;  3PKP A;  2AM3 A;  1TW5 A;  1ZJP A;  4NAK A;  2BO7 A;  3SXC A;  1EZI A;  1OQM B;  4P02 A;  5EIY A;  3I0G A;  4HOC A;  2JCL A;  3CGX A;  2OEF A;  2OI5 A;  2Y7A A;  2OI7 A;  5C49 A;  4HG6 A;  2AEC A;  1FGG A;  4FIX A;  4KPX A;  2RJ5 A;  2RIX A;  4BQH A;  2VXL A;  1G9R A;  3Q4S A;  4NAI A;  2O1H A;  2Y4L A;  1K4V A;  3ZGG A;  1JV1 A;  1S4P A;  4FRD A;  4DEC A;  4KQL A;  4FQW A;  1G1L A;  1NHE B;  4EE3 A;  2ZU7 A;  4MND A;  2V0J A;  2W0W A;  3K8D A;  4E1K A;  3CKO A;  1ZJO A;  4ARW A;  2VFZ A;  2VK9 A;  3BRK X;  2GGQ A;  2GGO A;  2J0B A;  2XME A;  2VXM A;  5L6V A;  4B42 A;  1ZDG A;  3ZF8 A;  2I7B A;  2D7R A;  3SPT A;  2QH5 A;  3V0Q A;  1R82 A;  2A8U A;  2VSI A;  2JCK A;  2UX8 A;  4Y7U A;  4M2A A;  2P73 A;  1G93 A;  5C3B A;  4Y7G A;  2ZU8 A;  1ZJ2 A;  4G3S A;  3OAM A;  1FR8 A;  1LL2 A;  1ZCT A;  2RJ1 A;  2AE7 A;  3OKR A;  5C4B A;  1H5T B;  1FRW A;  1ON6 A;  4KT7 A;  3TQD A;  4FRE A;  1H7T A;  2X65 A;  5C38 A;  2I5E A;  1R7U A;  3I0K A;  1W57 A;  1HM9 A;  1LZI A;  1O7Q A;  1TW1 A;  2WE9 A;  5J49 A;  3USQ A;  1JVD A;  1MP4 A;  4KNR A;  4FRP A;  1H7F A;  4R7P A;  1ZDF A;  5C4F A;  4D11 C;  1R80 A;  3FWW A;  1O23 B;  1V84 A;  2VSH A;  3E25 A;  3IOJ A;  2QGI A;  3V0M A;  1ZCY A;  2X60 A;  5C4D A;  1MP5 A;  1G23 A;  1R7Y A;  1FZW A;  3Q7U A;  3KIA A;  1W77 A;  5C47 A;  4K6R A;  2D0J A;  5D92 A;  2MZB A;  3QVB A;  5JQQ A;  4ECM A;  5FYE A;  5CQN X;  2JCJ A;  2RJ9 A;  3IOI A;  3E26 A;  2APC A;  1VIC A;  1H7H A;  2YCM A;  4YS8 A;  1WT1 A;  3OH3 A;  1ON8 A;  4IRP A;  4ASY A;  2AGD A;  5C4C A;  1H5R B;  4HO3 A;  2PA4 A;  4CJ8 A;  3OH0 A;  1ZCV A;  5D91 A;  2E3D A;  3T7M A;  4JD0 A;  1FXJ A;  4HO6 A;  1O0R A;  4DE7 A;  2FFU A;  5IFY A;  1ZCU A;  4G3Q A;  4KXO A;  3U2U A;  3RSB A;  1IIM A;  5EJZ A;  4G87 A;  4CVH A;  4KC4 A;  1NWG B;  3OH4 A;  3V90 A;  3DJ4 A;  5CMG X;  5CMJ A;  2Y6P A;  4AC3 A;  1OMZ A;  2FYC B;  5AJP A;  4EE5 A;  1INI A;  2O1G A;  2YES A;  2W0V A;  1R7T A;  3DUV A;  4NAN A;  4Y63 A;  1YRO B;  3I0J A;  3PKQ A;  4GBP A;  1H4E A;  5IDS A;  3HL3 A;  4B4M A;  1VGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...