4FRDA

Crystal structure of abba+udp+gal at ph 9.0 with mpd as the cryoprotectant
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
284
structure length
282
Chain Sequence
FMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histo-blood group ABO system transferase
publication title pH-induced conformational changes in human ABO(H) blood group glycosyltransferases confirm the importance of electrostatic interactions in the formation of the semi-closed state.
pubmed doi rcsb
source organism Homo sapiens
total genus 82
structure length 282
sequence length 284
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2012-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4frdA00
2JCLA 2JCJA 1FXJA 5C4FA 3CKJA 4AC3A 2VSIA 1HM9A 1VGUA 3E26A 2RITA 2YC3A 2XMHA 3T7OA 1ZI1A 5C3BA 3I0JA 4NALA 1LL2A 3SXAA 3ZLLA 3N9WA 3Q4SA 1GWWA 2YQHA 1FGGA 1S4PA 4MYBA 2V0HA 3U0YA 3DJ4A 1YP3A 2BO8A 5BXCA 1ZIZA 5C4DA 3KIAA 1JV1A 4FRQA 1H7LA 5IDTA 4KC4A 3U2WA 1SS9A 1H7TA 2BO6A 1VPAA 1INIA 3HL3A 1FRWA 1LZJA 3V0LA 3OH1A 4KPZA 3DUVA 2I5KA 4D11A 5C4EA 1ZJOA 1V83A 2RIYA 1R7TA 1QGQA 2UX8A 4EEGA 2JCOA 3I0DA 4P00A 3ZF8A 1W57A 1R7YA 2QKXA 1H7HA 2AECA 4FROA 4HO4A 4B2XA 3SX7A 1S4NA 1H7EA 1HM0A 2VSHA 3OKRA 5C4BA 1VM8A 1V82A 4M28A 1HJLA 3K8EA 4Y7FA 4HO2A 1H7FA 4Y7VA 4XWIA 1GX0A 4D11C 2WVLA 1H4EA 2YCMA 4D0TA 3D98A 2A8UA 3FWWA 3CKNA 1GQ9A 4EVWA 3F1YA 2W0WA 1VZXA 5FTSA 1GA8A 3RMWA 4LW3A 5CMGX 1WVCA 4FRBA 1H7QA 5C8RA 1EYRA 4MNDA 4E1KA 2A8WA 4NANA 4Y62A 4D48A 1LVWA 5I1FA 4B42A 1H5TA 1PZYB 5AJPA 3USRA 3RMVA 5CQMX 4EEMA 4KPXA 2O1FA 4FCEA 2APCA 5C36A 4HO8A 2AH9A 2D7RA 1V84A 1ZDFA 2V0IA 1WT3A 2Y4LA 3R2WA 1YROB 1QG8A 4M2AA 4P02A 4ZDQA 3V90A 1OQMB 1G95A 4IRPA 4G3SA 2YC5A 2YQCA 4HOCA 3DK5A 4Y6UA 1WSZA 2XWNA 1YP2A 2BO7A 3JTJA 1ZJ1A 5DDTA 1FO8A 4ECMA 2X5SA 3TQDA 1WT1A 3JUJA 1VH1A 2V0LA 1ZCUA 2NXVA 2AM4A 2V0KA 4EE4A 3SXBA 1ON8A 1ZCTA 5AJOA 2RJ6A 1G0RA 3GUEA 3USQA 1FG5N 5EIYA 1O7OA 5JQQA 3SXDA 1ZI4A 4EEOA 4EE3A 5DDVA 1PZTA 4IRQA 3SX5A 4DECA 1HM8A 1G97A 1MC3A 3SPTA 1G3LA 5IFYA 2RJ7A 3R3IA 4M2BA 4ASYA 2VXMA 3BCVA 5HS2A 5C1GA 1NHEB 1ZI3A 2X5ZA 3I0EA 1NF5B 1KWSA 4UEGA 1FWYA 2I5EA 2Y4KA 1FOAA 2WEEA 3JUKA 3ZGGA 1GX4A 1G2VA 1ZJ0A 1VGWA 1VICA 1H5SD 4GBPA 1O0RA 3OC9A 2ZU7A 1FZWA 2WVKA 2VFZA 3SXCA 4B3UA 2RJ0A 2P73A 2VS5A 1JVDA 4FRDA 3RSBA 2YQSA 1G23A 2D0JA 4BMAA 2MZBA 2PA4A 5C1HA 3D8VA 1S4OA 1H5SC 5C3AA 3V8YA 1H4CA 2P6WA 3TZTA 4YS8A 1TW1A 1ZI5A 1R7XA 4FRMA 4CVHA 5CQLX 5C38A 5CQOA 4C2SA 3I0CA 2Y7AA 5FUHA 1QGSA 5C4CA 1H5RA 4NAIA 4Y6NA 2JCKA 4Y7GA 1FR9A 2FY7A 2Y4MA 3I0IX 4HG6A 1H3MA 1ZJ3A 1IIMA 4CJCA 2BO4A 2GGOA 3I0LA 3Q80A 1FGXA 2AESA 2FYCB 3POLA 5C47A 4KNXA 2XWLA 4Y9XA 3IOJA 5FTVA 1XZ6A 4FRAA 4G3QA 2E8BA 4KXOA 5IDSA 2WGZA 2RIZA 5C49A 3I0HA 4CJBA 2X60A 3D5NA 2YQJA 4FRPA 4B5BA 4KRVA 2ICXA 1ZJ2A 5AJNA 4FREA 3ST8A 4AYLA 2AM3A 3LW6A 5L6VA 1INJA 5CMJA 1LL3A 1WT2A 3V0PA 2XMEA 3OGZA 4G3PA 1JV3A 5L6SA 1OMZA 3V0OA 2PGYA 2AE7A 2Z86A 1H5RB 2RJ8A 3U0XA 5FU8A 4KT7A 1NKHB 4DE7A 1YP4A 3V8ZA 1LZ0A 4KQLA 1NWGB 2RJ1A 1VH3A 3IOHA 4L41C 1JYLA 2PGVA 4R7PA 5CMHA 4D0ZA 3U2UA 1JVGA 1ZDGA 2VS4A 3K8DA 4JISA 1H4DA 3EE5A 2RJ5A 2V0JA 3CKOA 3CU0A 1H5SA 1TZFA 2YESA 1H5TB 1G8OA 1MP3A 4HO0A 3V0QA 1R7UA 5CMIA 2FYBA 1ZJPA 2VD4A 1QWJA 2ZU8A 2D7IA 1O23B 2Z87A 1LL0A 1VZTA 1H7GA 2ZU9A 1LZIA 1TVYA 2OEFA 4HO5A 3SXGA 5CQPA 1LZ7A 2OI7A 4AYJA 2E3DA 3BRKX 4HO6A 4AAWA 2WAWA 4J18A 2P72A 1NMMB 2RJ4A 1G93A 4G87A 4EEAA 1GQCA 1OMXA 2RIXA 1GWVA 3OAMA 3U2TA 2CU2A 2XWMA 3ZGFA 1IINA 2DPWA 1VGTA 2Y4JA 4Y63A 4KC2A 3CKVA 3Q7UA 3T7NA 3FOQA 3NGWA 3PKPA 4B4GA 2O1HA 1ZHJA 5FU0A 1R82A 2O1GA 4CJ8A 1ZCVA 4ASJA 3CGXA 1MP4A 1O7QA 1WT0A 3OH2A 3T7MA 4FRLA 3I0KA 2I7BA 4FQWA 2WVMA 2VS3A 1H5SB 1HJJA 2OEGA 4B4BA 2W0VA 3PKQA 3U2XA 3OH3A 1VGZA 2QH5A 2WE9A 1G9RA 4B2WA 3OH4A 1I52A 4NAKA 4LW6A 1TW5A 1FR8A 2PX7A 4KC1A 1E5KA 2AGDA 4FCUA 1FXOA 3V0MA 2Y6PA 5EJZA 4HO9A 4M4KA 1R80A 1NQIB 3I0GA 3IOIA 1EZIA 1MP5A 2FYAA 2ICYA 4FRHA 2QGIA 2FYDB 5C3DA 4HCQA 1R81A 1Z90A 2X65A 1ON6A 5CQNX 1HV9A 3QVBA 4Y64A 3SX3A 1JYKA 4Y7UA 4DDZA 5J49A 2VXLA 2RJ9A 2Q4JA 5C1LA 3O3PA 3E25A 2OI5A 1W77A 1G1LA 5CMFX 1VZUA 1FO9A 2FFUA 1XHBA 3ZLKA 5FV9A 3PNNA 3U2VA 4Y7TA 5FYEA 2FFVA 3CKQA 4ARWA 4BQHA 2GGQA 3F1CA 4JD0A 3OH0A 3SXEA 2OI6A 3V0NA 4EE5A 5C48A 1ZCYA 4B4MA 4KNRA 3I0FA 4K6RA 2AM5A 1R7VA 1K4VA 3SX8A 3V91A 1W55A 5EJ1A 4HO3A
chains in the Genus database with same CATH superfamily
2JCLA 2JCJA 1FXJA 5C4FA 3CKJA 4AC3A 2VSIA 4MIXA 2VK9A 1HM9A 1VGUA 3E26A 2RITA 2YC3A 2XMHA 3T7OA 1ZI1A 5C3BA 3I0JA 4NALA 1LL2A 3SXAA 3ZLLA 3N9WA 3Q4SA 1GWWA 2YQHA 1FGGA 1S4PA 4MYBA 2V0HA 3U0YA 3DJ4A 1YP3A 2BO8A 5BXCA 1ZIZA 5C4DA 3KIAA 1JV1A 4FRQA 1H7LA 5IDTA 4KC4A 3U2WA 1SS9A 1H7TA 2BO6A 4Q7CA 1VPAA 1INIA 3HL3A 1FRWA 1LZJA 3V0LA 3OH1A 4KPZA 3DUVA 2I5KA 4D11A 5C4EA 1ZJOA 1V83A 2RIYA 1R7TA 1QGQA 2UX8A 4EEGA 2JCOA 3I0DA 4P00A 3ZF8A 1W57A 1R7YA 2QKXA 1H7HA 2AECA 4FROA 4HO4A 4B2XA 3SX7A 1S4NA 1H7EA 1HM0A 2VSHA 3OKRA 5C4BA 1VM8A 1V82A 4M28A 1HJLA 3K8EA 4Y7FA 4HO2A 1H7FA 4Y7VA 2J0AA 4XWIA 1GX0A 4D11C 2WVLA 1H4EA 2YCMA 4D0TA 3D98A 2A8UA 3FWWA 3CKNA 1GQ9A 4EVWA 3F1YA 2W0WA 1VZXA 5FTSA 1GA8A 3RMWA 4LW3A 5CMGX 1WVCA 4FRBA 1H7QA 5C8RA 1EYRA 4MNDA 4E1KA 2A8WA 4NANA 4Y62A 4D48A 1LVWA 5I1FA 4B42A 1H5TA 1PZYB 5AJPA 3USRA 3RMVA 5CQMX 4EEMA 4KPXA 2O1FA 4FCEA 2APCA 5C36A 4HO8A 2AH9A 2D7RA 1V84A 1ZDFA 2V0IA 1WT3A 2Y4LA 3R2WA 1YROB 1QG8A 4M2AA 4P02A 4ZDQA 3V90A 1OQMB 1G95A 4IRPA 4G3SA 2YC5A 2YQCA 4HOCA 3DK5A 4Y6UA 1WSZA 2XWNA 1YP2A 4FIYA 2BO7A 3JTJA 1ZJ1A 5DDTA 1FO8A 4ECMA 2X5SA 3TQDA 1WT1A 3JUJA 1VH1A 2V0LA 1ZCUA 2NXVA 2AM4A 2V0KA 4EE4A 3SXBA 1ON8A 1ZCTA 5AJOA 2RJ6A 1G0RA 3GUEA 3USQA 1FG5N 5EIYA 1O7OA 5JQQA 3SXDA 1ZI4A 4EEOA 4EE3A 5DDVA 1PZTA 4IRQA 3SX5A 4DECA 1HM8A 1G97A 1MC3A 3SPTA 1G3LA 5IFYA 2RJ7A 3R3IA 4M2BA 4ASYA 2VXMA 4O6NA 3BCVA 5HS2A 5C1GA 1NHEB 1ZI3A 2X5ZA 3I0EA 1NF5B 1KWSA 4UEGA 1FWYA 2I5EA 2Y4KA 1FOAA 2WEEA 3JUKA 3ZGGA 1GX4A 1G2VA 1ZJ0A 1VGWA 1VICA 1H5SD 4GBPA 1O0RA 3OC9A 2ZU7A 1FZWA 2WVKA 2VFZA 3SXCA 4B3UA 2RJ0A 2P73A 2VS5A 1JVDA 4FRDA 3RSBA 2YQSA 1G23A 2D0JA 4BMAA 2MZBA 2PA4A 5C1HA 1S4OA 1H5SC 3D8VA 5C3AA 3V8YA 1H4CA 2P6WA 3TZTA 4YS8A 1TW1A 1ZI5A 1R7XA 4FRMA 2J0BA 4CVHA 5CQLX 5C38A 5CQOA 4C2SA 3I0CA 2Y7AA 5D92A 5FUHA 1QGSA 5C4CA 1H5RA 4NAIA 4Y6NA 2JCKA 4FIXA 4Y7GA 1FR9A 2FY7A 2Y4MA 3I0IX 4HG6A 1H3MA 1ZJ3A 1IIMA 4CJCA 2BO4A 2GGOA 3I0LA 3Q80A 1FGXA 2AESA 2FYCB 3POLA 5C47A 4KNXA 2XWLA 4Y9XA 3IOJA 5FTVA 1XZ6A 4FRAA 4G3QA 2E8BA 4KXOA 5IDSA 2WGZA 2RIZA 5C49A 3I0HA 4CJBA 2X60A 3D5NA 2YQJA 4FRPA 4B5BA 4KRVA 2ICXA 1ZJ2A 5AJNA 4FREA 3ST8A 4AYLA 2AM3A 3LW6A 5L6VA 1INJA 5CMJA 1LL3A 1WT2A 3V0PA 2XMEA 3OGZA 4G3PA 1JV3A 5L6SA 1OMZA 3V0OA 2PGYA 2AE7A 2Z86A 1H5RB 2RJ8A 3U0XA 5FU8A 4KT7A 1NKHB 4DE7A 1YP4A 3V8ZA 1LZ0A 4KQLA 1NWGB 2RJ1A 1VH3A 3IOHA 4L41C 1JYLA 2PGVA 4R7PA 5CMHA 4D0ZA 3U2UA 1JVGA 1ZDGA 2VS4A 3K8DA 4JISA 1H4DA 3EE5A 2RJ5A 2V0JA 3CKOA 3CU0A 1H5SA 1TZFA 2YESA 1H5TB 1G8OA 1MP3A 4HO0A 3V0QA 1R7UA 5CMIA 2FYBA 1ZJPA 2VD4A 1QWJA 2ZU8A 2D7IA 1O23B 2Z87A 1LL0A 1VZTA 1H7GA 2ZU9A 1LZIA 1TVYA 2OEFA 4HO5A 3SXGA 5CQPA 1LZ7A 2OI7A 4AYJA 2E3DA 3BRKX 4HO6A 4AAWA 2WAWA 4J18A 2P72A 1NMMB 2RJ4A 1G93A 4G87A 4EEAA 1GQCA 1OMXA 2RIXA 1GWVA 3OAMA 3U2TA 2CU2A 2XWMA 3ZGFA 1IINA 2DPWA 1VGTA 2Y4JA 4Y63A 4KC2A 3CKVA 3Q7UA 3T7NA 3FOQA 3NGWA 3PKPA 4B4GA 2O1HA 1ZHJA 5FU0A 1R82A 2O1GA 4CJ8A 1ZCVA 4ASJA 3CGXA 1MP4A 1O7QA 1WT0A 3OH2A 3T7MA 4FRLA 2C0NA 3I0KA 2I7BA 4FQWA 2WVMA 2VS3A 1H5SB 1HJJA 2OEGA 4B4BA 2W0VA 3PKQA 3U2XA 3OH3A 1VGZA 2QH5A 2WE9A 1G9RA 4B2WA 3OH4A 1I52A 4NAKA 4LW6A 1TW5A 1FR8A 2PX7A 4KC1A 1E5KA 2AGDA 4FCUA 1FXOA 3V0MA 2Y6PA 5EJZA 4HO9A 4M4KA 4O6MA 1R80A 1NQIB 3I0GA 3IOIA 1EZIA 1MP5A 2FYAA 2ICYA 4FRHA 5D91A 2QGIA 2FYDB 5C3DA 4HCQA 1R81A 1Z90A 2X65A 1ON6A 5CQNX 1HV9A 3QVBA 4Y64A 3SX3A 1JYKA 4Y7UA 4DDZA 5J49A 2VXLA 2RJ9A 2Q4JA 5C1LA 3O3PA 3E25A 2OI5A 1W77A 1G1LA 5CMFX 1VZUA 1FO9A 2FFUA 1XHBA 3ZLKA 5FV9A 3PNNA 3U2VA 4Y7TA 5FYEA 2FFVA 3CKQA 4ARWA 4BQHA 2GGQA 3F1CA 4JD0A 3OH0A 3SXEA 2OI6A 3V0NA 4EE5A 5C48A 1ZCYA 4B4MA 4KNRA 3I0FA 4K6RA 2AM5A 1R7VA 1K4VA 3SX8A 3V91A 1W55A 5EJ1A 4HO3A
chains in the Genus database with same CATH topology
2JCLA 2JCJA 1FXJA 5C4FA 3CKJA 4AC3A 2VSIA 4MIXA 2VK9A 1HM9A 1VGUA 3E26A 2RITA 2YC3A 2XMHA 3T7OA 1ZI1A 5C3BA 3I0JA 4NALA 1LL2A 3SXAA 3ZLLA 3N9WA 3Q4SA 1GWWA 2YQHA 1FGGA 1S4PA 4MYBA 2V0HA 3U0YA 3DJ4A 1YP3A 2BO8A 5BXCA 1ZIZA 5C4DA 3KIAA 1JV1A 4FRQA 1H7LA 5IDTA 4KC4A 3U2WA 1SS9A 1H7TA 2BO6A 4Q7CA 1VPAA 1INIA 3HL3A 1FRWA 1LZJA 3V0LA 3OH1A 4KPZA 3DUVA 2I5KA 4D11A 5C4EA 1ZJOA 1V83A 2RIYA 1R7TA 1QGQA 2UX8A 4EEGA 2JCOA 3I0DA 4P00A 3ZF8A 1W57A 1R7YA 2QKXA 1H7HA 2AECA 4FROA 4HO4A 4B2XA 3SX7A 1S4NA 1H7EA 1HM0A 2VSHA 3OKRA 5C4BA 1VM8A 1V82A 4M28A 1HJLA 3K8EA 4Y7FA 4HO2A 1H7FA 4Y7VA 2J0AA 4XWIA 1GX0A 4D11C 2WVLA 1H4EA 2YCMA 4D0TA 3D98A 2A8UA 3FWWA 3CKNA 1GQ9A 4EVWA 3F1YA 2W0WA 1VZXA 5FTSA 1GA8A 3RMWA 4LW3A 5CMGX 1WVCA 4FRBA 1H7QA 5C8RA 1EYRA 4MNDA 4E1KA 2A8WA 4NANA 4Y62A 4D48A 1LVWA 5I1FA 4B42A 1H5TA 1PZYB 5AJPA 3USRA 3RMVA 5CQMX 4EEMA 4KPXA 2O1FA 4FCEA 2APCA 5C36A 4HO8A 2AH9A 2D7RA 1V84A 1ZDFA 2V0IA 1WT3A 2Y4LA 3R2WA 1YROB 1QG8A 4M2AA 4P02A 4ZDQA 3V90A 1OQMB 1G95A 4IRPA 4G3SA 2YC5A 2YQCA 4HOCA 3DK5A 4Y6UA 1WSZA 2XWNA 1YP2A 4FIYA 2BO7A 3JTJA 1ZJ1A 5DDTA 1FO8A 4ECMA 2X5SA 3TQDA 1WT1A 3JUJA 1VH1A 2V0LA 1ZCUA 2NXVA 2AM4A 2V0KA 4EE4A 3SXBA 1ON8A 1ZCTA 5AJOA 2RJ6A 1G0RA 3GUEA 3USQA 1FG5N 5EIYA 1O7OA 5JQQA 3SXDA 1ZI4A 4EEOA 4EE3A 5DDVA 1PZTA 4IRQA 3SX5A 4DECA 1HM8A 1G97A 1MC3A 3SPTA 1G3LA 5IFYA 2RJ7A 3R3IA 4M2BA 4ASYA 2VXMA 4O6NA 3BCVA 5HS2A 5C1GA 1NHEB 1ZI3A 2X5ZA 3I0EA 1NF5B 1KWSA 4UEGA 1FWYA 2I5EA 2Y4KA 1FOAA 2WEEA 3JUKA 3ZGGA 1GX4A 1G2VA 1ZJ0A 1VGWA 1VICA 1H5SD 4GBPA 1O0RA 3OC9A 2ZU7A 1FZWA 2WVKA 2VFZA 3SXCA 4B3UA 2RJ0A 2P73A 2VS5A 1JVDA 4FRDA 3RSBA 2YQSA 1G23A 2D0JA 4BMAA 2MZBA 2PA4A 5C1HA 1S4OA 1H5SC 3D8VA 5C3AA 3V8YA 1H4CA 2P6WA 3TZTA 4YS8A 1TW1A 1ZI5A 1R7XA 4FRMA 2J0BA 4CVHA 5CQLX 5C38A 5CQOA 4C2SA 3I0CA 2Y7AA 5D92A 5FUHA 1QGSA 5C4CA 1H5RA 4NAIA 4Y6NA 2JCKA 4FIXA 4Y7GA 1FR9A 2FY7A 2Y4MA 3I0IX 4HG6A 1H3MA 1ZJ3A 1IIMA 4CJCA 2BO4A 2GGOA 3I0LA 3Q80A 1FGXA 2AESA 2FYCB 3POLA 5C47A 4KNXA 2XWLA 4Y9XA 3IOJA 5FTVA 1XZ6A 4FRAA 4G3QA 2E8BA 4KXOA 5IDSA 2WGZA 2RIZA 5C49A 3I0HA 4CJBA 2X60A 3D5NA 2YQJA 4FRPA 4B5BA 4KRVA 2ICXA 1ZJ2A 5AJNA 4FREA 3ST8A 4AYLA 2AM3A 3LW6A 5L6VA 1INJA 5CMJA 1LL3A 1WT2A 3V0PA 2XMEA 3OGZA 4G3PA 1JV3A 5L6SA 1OMZA 3V0OA 2PGYA 2AE7A 2Z86A 1H5RB 2RJ8A 3U0XA 5FU8A 4KT7A 1NKHB 4DE7A 1YP4A 3V8ZA 1LZ0A 4KQLA 1NWGB 2RJ1A 1VH3A 3IOHA 4L41C 1JYLA 2PGVA 4R7PA 5CMHA 4D0ZA 3U2UA 1JVGA 1ZDGA 2VS4A 3K8DA 4JISA 1H4DA 3EE5A 2RJ5A 2V0JA 3CKOA 3CU0A 1H5SA 1TZFA 2YESA 1H5TB 1G8OA 1MP3A 4HO0A 3V0QA 1R7UA 5CMIA 2FYBA 1ZJPA 2VD4A 1QWJA 2ZU8A 2D7IA 1O23B 2Z87A 1LL0A 1VZTA 1H7GA 2ZU9A 1LZIA 1TVYA 2OEFA 4HO5A 3SXGA 5CQPA 1LZ7A 2OI7A 4AYJA 2E3DA 3BRKX 4HO6A 4AAWA 2WAWA 4J18A 2P72A 1NMMB 2RJ4A 1G93A 4G87A 4EEAA 1GQCA 1OMXA 2RIXA 1GWVA 3OAMA 3U2TA 2CU2A 2XWMA 3ZGFA 1IINA 2DPWA 1VGTA 2Y4JA 4Y63A 4KC2A 3CKVA 3Q7UA 3T7NA 3FOQA 3NGWA 3PKPA 4B4GA 2O1HA 1ZHJA 5FU0A 1R82A 2O1GA 4CJ8A 1ZCVA 4ASJA 3CGXA 1MP4A 1O7QA 1WT0A 3OH2A 3T7MA 4FRLA 2C0NA 3I0KA 2I7BA 4FQWA 2WVMA 2VS3A 1H5SB 1HJJA 2OEGA 4B4BA 2W0VA 3PKQA 3U2XA 3OH3A 1VGZA 2QH5A 2WE9A 1G9RA 4B2WA 3OH4A 1I52A 4NAKA 4LW6A 1TW5A 1FR8A 2PX7A 4KC1A 1E5KA 2AGDA 4FCUA 1FXOA 3V0MA 2Y6PA 5EJZA 4HO9A 4M4KA 4O6MA 1R80A 1NQIB 3I0GA 3IOIA 1EZIA 1MP5A 2FYAA 2ICYA 4FRHA 5D91A 2QGIA 2FYDB 5C3DA 4HCQA 1R81A 1Z90A 2X65A 1ON6A 5CQNX 1HV9A 3QVBA 4Y64A 3SX3A 1JYKA 4Y7UA 4DDZA 5J49A 2VXLA 2RJ9A 2Q4JA 5C1LA 3O3PA 3E25A 2OI5A 1W77A 1G1LA 5CMFX 1VZUA 1FO9A 2FFUA 1XHBA 3ZLKA 5FV9A 3PNNA 3U2VA 4Y7TA 5FYEA 2FFVA 3CKQA 4ARWA 4BQHA 2GGQA 3F1CA 4JD0A 3OH0A 3SXEA 2OI6A 3V0NA 4EE5A 5C48A 1ZCYA 4B4MA 4KNRA 3I0FA 4K6RA 2AM5A 1R7VA 1K4VA 3SX8A 3V91A 1W55A 5EJ1A 4HO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JCL A;  2JCJ A;  1FXJ A;  5C4F A;  3CKJ A;  4AC3 A;  2VSI A;  1HM9 A;  1VGU A;  3E26 A;  2RIT A;  2YC3 A;  2XMH A;  3T7O A;  1ZI1 A;  5C3B A;  3I0J A;  4NAL A;  1LL2 A;  3SXA A;  3ZLL A;  3N9W A;  3Q4S A;  1GWW A;  2YQH A;  1FGG A;  1S4P A;  4MYB A;  2V0H A;  3U0Y A;  3DJ4 A;  1YP3 A;  2BO8 A;  5BXC A;  1ZIZ A;  5C4D A;  3KIA A;  1JV1 A;  4FRQ A;  1H7L A;  5IDT A;  4KC4 A;  3U2W A;  1SS9 A;  1H7T A;  2BO6 A;  1VPA A;  1INI A;  3HL3 A;  1FRW A;  1LZJ A;  3V0L A;  3OH1 A;  4KPZ A;  3DUV A;  2I5K A;  4D11 A;  5C4E A;  1ZJO A;  1V83 A;  2RIY A;  1R7T A;  1QGQ A;  2UX8 A;  4EEG A;  2JCO A;  3I0D A;  4P00 A;  3ZF8 A;  1W57 A;  1R7Y A;  2QKX A;  1H7H A;  2AEC A;  4FRO A;  4HO4 A;  4B2X A;  3SX7 A;  1S4N A;  1H7E A;  1HM0 A;  2VSH A;  3OKR A;  5C4B A;  1VM8 A;  1V82 A;  4M28 A;  1HJL A;  3K8E A;  4Y7F A;  4HO2 A;  1H7F A;  4Y7V A;  4XWI A;  1GX0 A;  4D11 C;  2WVL A;  1H4E A;  2YCM A;  4D0T A;  3D98 A;  2A8U A;  3FWW A;  3CKN A;  1GQ9 A;  4EVW A;  3F1Y A;  2W0W A;  1VZX A;  5FTS A;  1GA8 A;  3RMW A;  4LW3 A;  5CMG X;  1WVC A;  4FRB A;  1H7Q A;  5C8R A;  1EYR A;  4MND A;  4E1K A;  2A8W A;  4NAN A;  4Y62 A;  4D48 A;  1LVW A;  5I1F A;  4B42 A;  1H5T A;  1PZY B;  5AJP A;  3USR A;  3RMV A;  5CQM X;  4EEM A;  4KPX A;  2O1F A;  4FCE A;  2APC A;  5C36 A;  4HO8 A;  2AH9 A;  2D7R A;  1V84 A;  1ZDF A;  2V0I A;  1WT3 A;  2Y4L A;  3R2W A;  1YRO B;  1QG8 A;  4M2A A;  4P02 A;  4ZDQ A;  3V90 A;  1OQM B;  1G95 A;  4IRP A;  4G3S A;  2YC5 A;  2YQC A;  4HOC A;  3DK5 A;  4Y6U A;  1WSZ A;  2XWN A;  1YP2 A;  2BO7 A;  3JTJ A;  1ZJ1 A;  5DDT A;  1FO8 A;  4ECM A;  2X5S A;  3TQD A;  1WT1 A;  3JUJ A;  1VH1 A;  2V0L A;  1ZCU A;  2NXV A;  2AM4 A;  2V0K A;  4EE4 A;  3SXB A;  1ON8 A;  1ZCT A;  5AJO A;  2RJ6 A;  1G0R A;  3GUE A;  3USQ A;  1FG5 N;  5EIY A;  1O7O A;  5JQQ A;  3SXD A;  1ZI4 A;  4EEO A;  4EE3 A;  5DDV A;  1PZT A;  4IRQ A;  3SX5 A;  4DEC A;  1HM8 A;  1G97 A;  1MC3 A;  3SPT A;  1G3L A;  5IFY A;  2RJ7 A;  3R3I A;  4M2B A;  4ASY A;  2VXM A;  3BCV A;  5HS2 A;  5C1G A;  1NHE B;  1ZI3 A;  2X5Z A;  3I0E A;  1NF5 B;  1KWS A;  4UEG A;  1FWY A;  2I5E A;  2Y4K A;  1FOA A;  2WEE A;  3JUK A;  3ZGG A;  1GX4 A;  1G2V A;  1ZJ0 A;  1VGW A;  1VIC A;  1H5S D;  4GBP A;  1O0R A;  3OC9 A;  2ZU7 A;  1FZW A;  2WVK A;  2VFZ A;  3SXC A;  4B3U A;  2RJ0 A;  2P73 A;  2VS5 A;  1JVD A;  4FRD A;  3RSB A;  2YQS A;  1G23 A;  2D0J A;  4BMA A;  2MZB A;  2PA4 A;  5C1H A;  3D8V A;  1S4O A;  1H5S C;  5C3A A;  3V8Y A;  1H4C A;  2P6W A;  3TZT A;  4YS8 A;  1TW1 A;  1ZI5 A;  1R7X A;  4FRM A;  4CVH A;  5CQL X;  5C38 A;  5CQO A;  4C2S A;  3I0C A;  2Y7A A;  5FUH A;  1QGS A;  5C4C A;  1H5R A;  4NAI A;  4Y6N A;  2JCK A;  4Y7G A;  1FR9 A;  2FY7 A;  2Y4M A;  3I0I X;  4HG6 A;  1H3M A;  1ZJ3 A;  1IIM A;  4CJC A;  2BO4 A;  2GGO A;  3I0L A;  3Q80 A;  1FGX A;  2AES A;  2FYC B;  3POL A;  5C47 A;  4KNX A;  2XWL A;  4Y9X A;  3IOJ A;  5FTV A;  1XZ6 A;  4FRA A;  4G3Q A;  2E8B A;  4KXO A;  5IDS A;  2WGZ A;  2RIZ A;  5C49 A;  3I0H A;  4CJB A;  2X60 A;  3D5N A;  2YQJ A;  4FRP A;  4B5B A;  4KRV A;  2ICX A;  1ZJ2 A;  5AJN A;  4FRE A;  3ST8 A;  4AYL A;  2AM3 A;  3LW6 A;  5L6V A;  1INJ A;  5CMJ A;  1LL3 A;  1WT2 A;  3V0P A;  2XME A;  3OGZ A;  4G3P A;  1JV3 A;  5L6S A;  1OMZ A;  3V0O A;  2PGY A;  2AE7 A;  2Z86 A;  1H5R B;  2RJ8 A;  3U0X A;  5FU8 A;  4KT7 A;  1NKH B;  4DE7 A;  1YP4 A;  3V8Z A;  1LZ0 A;  4KQL A;  1NWG B;  2RJ1 A;  1VH3 A;  3IOH A;  4L41 C;  1JYL A;  2PGV A;  4R7P A;  5CMH A;  4D0Z A;  3U2U A;  1JVG A;  1ZDG A;  2VS4 A;  3K8D A;  4JIS A;  1H4D A;  3EE5 A;  2RJ5 A;  2V0J A;  3CKO A;  3CU0 A;  1H5S A;  1TZF A;  2YES A;  1H5T B;  1G8O A;  1MP3 A;  4HO0 A;  3V0Q A;  1R7U A;  5CMI A;  2FYB A;  1ZJP A;  2VD4 A;  1QWJ A;  2ZU8 A;  2D7I A;  1O23 B;  2Z87 A;  1LL0 A;  1VZT A;  1H7G A;  2ZU9 A;  1LZI A;  1TVY A;  2OEF A;  4HO5 A;  3SXG A;  5CQP A;  1LZ7 A;  2OI7 A;  4AYJ A;  2E3D A;  3BRK X;  4HO6 A;  4AAW A;  2WAW A;  4J18 A;  2P72 A;  1NMM B;  2RJ4 A;  1G93 A;  4G87 A;  4EEA A;  1GQC A;  1OMX A;  2RIX A;  1GWV A;  3OAM A;  3U2T A;  2CU2 A;  2XWM A;  3ZGF A;  1IIN A;  2DPW A;  1VGT A;  2Y4J A;  4Y63 A;  4KC2 A;  3CKV A;  3Q7U A;  3T7N A;  3FOQ A;  3NGW A;  3PKP A;  4B4G A;  2O1H A;  1ZHJ A;  5FU0 A;  1R82 A;  2O1G A;  4CJ8 A;  1ZCV A;  4ASJ A;  3CGX A;  1MP4 A;  1O7Q A;  1WT0 A;  3OH2 A;  3T7M A;  4FRL A;  3I0K A;  2I7B A;  4FQW A;  2WVM A;  2VS3 A;  1H5S B;  1HJJ A;  2OEG A;  4B4B A;  2W0V A;  3PKQ A;  3U2X A;  3OH3 A;  1VGZ A;  2QH5 A;  2WE9 A;  1G9R A;  4B2W A;  3OH4 A;  1I52 A;  4NAK A;  4LW6 A;  1TW5 A;  1FR8 A;  2PX7 A;  4KC1 A;  1E5K A;  2AGD A;  4FCU A;  1FXO A;  3V0M A;  2Y6P A;  5EJZ A;  4HO9 A;  4M4K A;  1R80 A;  1NQI B;  3I0G A;  3IOI A;  1EZI A;  1MP5 A;  2FYA A;  2ICY A;  4FRH A;  2QGI A;  2FYD B;  5C3D A;  4HCQ A;  1R81 A;  1Z90 A;  2X65 A;  1ON6 A;  5CQN X;  1HV9 A;  3QVB A;  4Y64 A;  3SX3 A;  1JYK A;  4Y7U A;  4DDZ A;  5J49 A;  2VXL A;  2RJ9 A;  2Q4J A;  5C1L A;  3O3P A;  3E25 A;  2OI5 A;  1W77 A;  1G1L A;  5CMF X;  1VZU A;  1FO9 A;  2FFU A;  1XHB A;  3ZLK A;  5FV9 A;  3PNN A;  3U2V A;  4Y7T A;  5FYE A;  2FFV A;  3CKQ A;  4ARW A;  4BQH A;  2GGQ A;  3F1C A;  4JD0 A;  3OH0 A;  3SXE A;  2OI6 A;  3V0N A;  4EE5 A;  5C48 A;  1ZCY A;  4B4M A;  4KNR A;  3I0F A;  4K6R A;  2AM5 A;  1R7V A;  1K4V A;  3SX8 A;  3V91 A;  1W55 A;  5EJ1 A;  4HO3 A; 
#chains in the Genus database with same CATH topology
 2JCL A;  2JCJ A;  1FXJ A;  5C4F A;  3CKJ A;  4AC3 A;  2VSI A;  4MIX A;  2VK9 A;  1HM9 A;  1VGU A;  3E26 A;  2RIT A;  2YC3 A;  2XMH A;  3T7O A;  1ZI1 A;  5C3B A;  3I0J A;  4NAL A;  1LL2 A;  3SXA A;  3ZLL A;  3N9W A;  3Q4S A;  1GWW A;  2YQH A;  1FGG A;  1S4P A;  4MYB A;  2V0H A;  3U0Y A;  3DJ4 A;  1YP3 A;  2BO8 A;  5BXC A;  1ZIZ A;  5C4D A;  3KIA A;  1JV1 A;  4FRQ A;  1H7L A;  5IDT A;  4KC4 A;  3U2W A;  1SS9 A;  1H7T A;  2BO6 A;  4Q7C A;  1VPA A;  1INI A;  3HL3 A;  1FRW A;  1LZJ A;  3V0L A;  3OH1 A;  4KPZ A;  3DUV A;  2I5K A;  4D11 A;  5C4E A;  1ZJO A;  1V83 A;  2RIY A;  1R7T A;  1QGQ A;  2UX8 A;  4EEG A;  2JCO A;  3I0D A;  4P00 A;  3ZF8 A;  1W57 A;  1R7Y A;  2QKX A;  1H7H A;  2AEC A;  4FRO A;  4HO4 A;  4B2X A;  3SX7 A;  1S4N A;  1H7E A;  1HM0 A;  2VSH A;  3OKR A;  5C4B A;  1VM8 A;  1V82 A;  4M28 A;  1HJL A;  3K8E A;  4Y7F A;  4HO2 A;  1H7F A;  4Y7V A;  2J0A A;  4XWI A;  1GX0 A;  4D11 C;  2WVL A;  1H4E A;  2YCM A;  4D0T A;  3D98 A;  2A8U A;  3FWW A;  3CKN A;  1GQ9 A;  4EVW A;  3F1Y A;  2W0W A;  1VZX A;  5FTS A;  1GA8 A;  3RMW A;  4LW3 A;  5CMG X;  1WVC A;  4FRB A;  1H7Q A;  5C8R A;  1EYR A;  4MND A;  4E1K A;  2A8W A;  4NAN A;  4Y62 A;  4D48 A;  1LVW A;  5I1F A;  4B42 A;  1H5T A;  1PZY B;  5AJP A;  3USR A;  3RMV A;  5CQM X;  4EEM A;  4KPX A;  2O1F A;  4FCE A;  2APC A;  5C36 A;  4HO8 A;  2AH9 A;  2D7R A;  1V84 A;  1ZDF A;  2V0I A;  1WT3 A;  2Y4L A;  3R2W A;  1YRO B;  1QG8 A;  4M2A A;  4P02 A;  4ZDQ A;  3V90 A;  1OQM B;  1G95 A;  4IRP A;  4G3S A;  2YC5 A;  2YQC A;  4HOC A;  3DK5 A;  4Y6U A;  1WSZ A;  2XWN A;  1YP2 A;  4FIY A;  2BO7 A;  3JTJ A;  1ZJ1 A;  5DDT A;  1FO8 A;  4ECM A;  2X5S A;  3TQD A;  1WT1 A;  3JUJ A;  1VH1 A;  2V0L A;  1ZCU A;  2NXV A;  2AM4 A;  2V0K A;  4EE4 A;  3SXB A;  1ON8 A;  1ZCT A;  5AJO A;  2RJ6 A;  1G0R A;  3GUE A;  3USQ A;  1FG5 N;  5EIY A;  1O7O A;  5JQQ A;  3SXD A;  1ZI4 A;  4EEO A;  4EE3 A;  5DDV A;  1PZT A;  4IRQ A;  3SX5 A;  4DEC A;  1HM8 A;  1G97 A;  1MC3 A;  3SPT A;  1G3L A;  5IFY A;  2RJ7 A;  3R3I A;  4M2B A;  4ASY A;  2VXM A;  4O6N A;  3BCV A;  5HS2 A;  5C1G A;  1NHE B;  1ZI3 A;  2X5Z A;  3I0E A;  1NF5 B;  1KWS A;  4UEG A;  1FWY A;  2I5E A;  2Y4K A;  1FOA A;  2WEE A;  3JUK A;  3ZGG A;  1GX4 A;  1G2V A;  1ZJ0 A;  1VGW A;  1VIC A;  1H5S D;  4GBP A;  1O0R A;  3OC9 A;  2ZU7 A;  1FZW A;  2WVK A;  2VFZ A;  3SXC A;  4B3U A;  2RJ0 A;  2P73 A;  2VS5 A;  1JVD A;  4FRD A;  3RSB A;  2YQS A;  1G23 A;  2D0J A;  4BMA A;  2MZB A;  2PA4 A;  5C1H A;  1S4O A;  1H5S C;  3D8V A;  5C3A A;  3V8Y A;  1H4C A;  2P6W A;  3TZT A;  4YS8 A;  1TW1 A;  1ZI5 A;  1R7X A;  4FRM A;  2J0B A;  4CVH A;  5CQL X;  5C38 A;  5CQO A;  4C2S A;  3I0C A;  2Y7A A;  5D92 A;  5FUH A;  1QGS A;  5C4C A;  1H5R A;  4NAI A;  4Y6N A;  2JCK A;  4FIX A;  4Y7G A;  1FR9 A;  2FY7 A;  2Y4M A;  3I0I X;  4HG6 A;  1H3M A;  1ZJ3 A;  1IIM A;  4CJC A;  2BO4 A;  2GGO A;  3I0L A;  3Q80 A;  1FGX A;  2AES A;  2FYC B;  3POL A;  5C47 A;  4KNX A;  2XWL A;  4Y9X A;  3IOJ A;  5FTV A;  1XZ6 A;  4FRA A;  4G3Q A;  2E8B A;  4KXO A;  5IDS A;  2WGZ A;  2RIZ A;  5C49 A;  3I0H A;  4CJB A;  2X60 A;  3D5N A;  2YQJ A;  4FRP A;  4B5B A;  4KRV A;  2ICX A;  1ZJ2 A;  5AJN A;  4FRE A;  3ST8 A;  4AYL A;  2AM3 A;  3LW6 A;  5L6V A;  1INJ A;  5CMJ A;  1LL3 A;  1WT2 A;  3V0P A;  2XME A;  3OGZ A;  4G3P A;  1JV3 A;  5L6S A;  1OMZ A;  3V0O A;  2PGY A;  2AE7 A;  2Z86 A;  1H5R B;  2RJ8 A;  3U0X A;  5FU8 A;  4KT7 A;  1NKH B;  4DE7 A;  1YP4 A;  3V8Z A;  1LZ0 A;  4KQL A;  1NWG B;  2RJ1 A;  1VH3 A;  3IOH A;  4L41 C;  1JYL A;  2PGV A;  4R7P A;  5CMH A;  4D0Z A;  3U2U A;  1JVG A;  1ZDG A;  2VS4 A;  3K8D A;  4JIS A;  1H4D A;  3EE5 A;  2RJ5 A;  2V0J A;  3CKO A;  3CU0 A;  1H5S A;  1TZF A;  2YES A;  1H5T B;  1G8O A;  1MP3 A;  4HO0 A;  3V0Q A;  1R7U A;  5CMI A;  2FYB A;  1ZJP A;  2VD4 A;  1QWJ A;  2ZU8 A;  2D7I A;  1O23 B;  2Z87 A;  1LL0 A;  1VZT A;  1H7G A;  2ZU9 A;  1LZI A;  1TVY A;  2OEF A;  4HO5 A;  3SXG A;  5CQP A;  1LZ7 A;  2OI7 A;  4AYJ A;  2E3D A;  3BRK X;  4HO6 A;  4AAW A;  2WAW A;  4J18 A;  2P72 A;  1NMM B;  2RJ4 A;  1G93 A;  4G87 A;  4EEA A;  1GQC A;  1OMX A;  2RIX A;  1GWV A;  3OAM A;  3U2T A;  2CU2 A;  2XWM A;  3ZGF A;  1IIN A;  2DPW A;  1VGT A;  2Y4J A;  4Y63 A;  4KC2 A;  3CKV A;  3Q7U A;  3T7N A;  3FOQ A;  3NGW A;  3PKP A;  4B4G A;  2O1H A;  1ZHJ A;  5FU0 A;  1R82 A;  2O1G A;  4CJ8 A;  1ZCV A;  4ASJ A;  3CGX A;  1MP4 A;  1O7Q A;  1WT0 A;  3OH2 A;  3T7M A;  4FRL A;  2C0N A;  3I0K A;  2I7B A;  4FQW A;  2WVM A;  2VS3 A;  1H5S B;  1HJJ A;  2OEG A;  4B4B A;  2W0V A;  3PKQ A;  3U2X A;  3OH3 A;  1VGZ A;  2QH5 A;  2WE9 A;  1G9R A;  4B2W A;  3OH4 A;  1I52 A;  4NAK A;  4LW6 A;  1TW5 A;  1FR8 A;  2PX7 A;  4KC1 A;  1E5K A;  2AGD A;  4FCU A;  1FXO A;  3V0M A;  2Y6P A;  5EJZ A;  4HO9 A;  4M4K A;  4O6M A;  1R80 A;  1NQI B;  3I0G A;  3IOI A;  1EZI A;  1MP5 A;  2FYA A;  2ICY A;  4FRH A;  5D91 A;  2QGI A;  2FYD B;  5C3D A;  4HCQ A;  1R81 A;  1Z90 A;  2X65 A;  1ON6 A;  5CQN X;  1HV9 A;  3QVB A;  4Y64 A;  3SX3 A;  1JYK A;  4Y7U A;  4DDZ A;  5J49 A;  2VXL A;  2RJ9 A;  2Q4J A;  5C1L A;  3O3P A;  3E25 A;  2OI5 A;  1W77 A;  1G1L A;  5CMF X;  1VZU A;  1FO9 A;  2FFU A;  1XHB A;  3ZLK A;  5FV9 A;  3PNN A;  3U2V A;  4Y7T A;  5FYE A;  2FFV A;  3CKQ A;  4ARW A;  4BQH A;  2GGQ A;  3F1C A;  4JD0 A;  3OH0 A;  3SXE A;  2OI6 A;  3V0N A;  4EE5 A;  5C48 A;  1ZCY A;  4B4M A;  4KNR A;  3I0F A;  4K6R A;  2AM5 A;  1R7V A;  1K4V A;  3SX8 A;  3V91 A;  1W55 A;  5EJ1 A;  4HO3 A; 
#chains in the Genus database with same CATH homology
 2JCL A;  2JCJ A;  1FXJ A;  5C4F A;  3CKJ A;  4AC3 A;  2VSI A;  4MIX A;  2VK9 A;  1HM9 A;  1VGU A;  3E26 A;  2RIT A;  2YC3 A;  2XMH A;  3T7O A;  1ZI1 A;  5C3B A;  3I0J A;  4NAL A;  1LL2 A;  3SXA A;  3ZLL A;  3N9W A;  3Q4S A;  1GWW A;  2YQH A;  1FGG A;  1S4P A;  4MYB A;  2V0H A;  3U0Y A;  3DJ4 A;  1YP3 A;  2BO8 A;  5BXC A;  1ZIZ A;  5C4D A;  3KIA A;  1JV1 A;  4FRQ A;  1H7L A;  5IDT A;  4KC4 A;  3U2W A;  1SS9 A;  1H7T A;  2BO6 A;  4Q7C A;  1VPA A;  1INI A;  3HL3 A;  1FRW A;  1LZJ A;  3V0L A;  3OH1 A;  4KPZ A;  3DUV A;  2I5K A;  4D11 A;  5C4E A;  1ZJO A;  1V83 A;  2RIY A;  1R7T A;  1QGQ A;  2UX8 A;  4EEG A;  2JCO A;  3I0D A;  4P00 A;  3ZF8 A;  1W57 A;  1R7Y A;  2QKX A;  1H7H A;  2AEC A;  4FRO A;  4HO4 A;  4B2X A;  3SX7 A;  1S4N A;  1H7E A;  1HM0 A;  2VSH A;  3OKR A;  5C4B A;  1VM8 A;  1V82 A;  4M28 A;  1HJL A;  3K8E A;  4Y7F A;  4HO2 A;  1H7F A;  4Y7V A;  2J0A A;  4XWI A;  1GX0 A;  4D11 C;  2WVL A;  1H4E A;  2YCM A;  4D0T A;  3D98 A;  2A8U A;  3FWW A;  3CKN A;  1GQ9 A;  4EVW A;  3F1Y A;  2W0W A;  1VZX A;  5FTS A;  1GA8 A;  3RMW A;  4LW3 A;  5CMG X;  1WVC A;  4FRB A;  1H7Q A;  5C8R A;  1EYR A;  4MND A;  4E1K A;  2A8W A;  4NAN A;  4Y62 A;  4D48 A;  1LVW A;  5I1F A;  4B42 A;  1H5T A;  1PZY B;  5AJP A;  3USR A;  3RMV A;  5CQM X;  4EEM A;  4KPX A;  2O1F A;  4FCE A;  2APC A;  5C36 A;  4HO8 A;  2AH9 A;  2D7R A;  1V84 A;  1ZDF A;  2V0I A;  1WT3 A;  2Y4L A;  3R2W A;  1YRO B;  1QG8 A;  4M2A A;  4P02 A;  4ZDQ A;  3V90 A;  1OQM B;  1G95 A;  4IRP A;  4G3S A;  2YC5 A;  2YQC A;  4HOC A;  3DK5 A;  4Y6U A;  1WSZ A;  2XWN A;  1YP2 A;  4FIY A;  2BO7 A;  3JTJ A;  1ZJ1 A;  5DDT A;  1FO8 A;  4ECM A;  2X5S A;  3TQD A;  1WT1 A;  3JUJ A;  1VH1 A;  2V0L A;  1ZCU A;  2NXV A;  2AM4 A;  2V0K A;  4EE4 A;  3SXB A;  1ON8 A;  1ZCT A;  5AJO A;  2RJ6 A;  1G0R A;  3GUE A;  3USQ A;  1FG5 N;  5EIY A;  1O7O A;  5JQQ A;  3SXD A;  1ZI4 A;  4EEO A;  4EE3 A;  5DDV A;  1PZT A;  4IRQ A;  3SX5 A;  4DEC A;  1HM8 A;  1G97 A;  1MC3 A;  3SPT A;  1G3L A;  5IFY A;  2RJ7 A;  3R3I A;  4M2B A;  4ASY A;  2VXM A;  4O6N A;  3BCV A;  5HS2 A;  5C1G A;  1NHE B;  1ZI3 A;  2X5Z A;  3I0E A;  1NF5 B;  1KWS A;  4UEG A;  1FWY A;  2I5E A;  2Y4K A;  1FOA A;  2WEE A;  3JUK A;  3ZGG A;  1GX4 A;  1G2V A;  1ZJ0 A;  1VGW A;  1VIC A;  1H5S D;  4GBP A;  1O0R A;  3OC9 A;  2ZU7 A;  1FZW A;  2WVK A;  2VFZ A;  3SXC A;  4B3U A;  2RJ0 A;  2P73 A;  2VS5 A;  1JVD A;  4FRD A;  3RSB A;  2YQS A;  1G23 A;  2D0J A;  4BMA A;  2MZB A;  2PA4 A;  5C1H A;  1S4O A;  1H5S C;  3D8V A;  5C3A A;  3V8Y A;  1H4C A;  2P6W A;  3TZT A;  4YS8 A;  1TW1 A;  1ZI5 A;  1R7X A;  4FRM A;  2J0B A;  4CVH A;  5CQL X;  5C38 A;  5CQO A;  4C2S A;  3I0C A;  2Y7A A;  5D92 A;  5FUH A;  1QGS A;  5C4C A;  1H5R A;  4NAI A;  4Y6N A;  2JCK A;  4FIX A;  4Y7G A;  1FR9 A;  2FY7 A;  2Y4M A;  3I0I X;  4HG6 A;  1H3M A;  1ZJ3 A;  1IIM A;  4CJC A;  2BO4 A;  2GGO A;  3I0L A;  3Q80 A;  1FGX A;  2AES A;  2FYC B;  3POL A;  5C47 A;  4KNX A;  2XWL A;  4Y9X A;  3IOJ A;  5FTV A;  1XZ6 A;  4FRA A;  4G3Q A;  2E8B A;  4KXO A;  5IDS A;  2WGZ A;  2RIZ A;  5C49 A;  3I0H A;  4CJB A;  2X60 A;  3D5N A;  2YQJ A;  4FRP A;  4B5B A;  4KRV A;  2ICX A;  1ZJ2 A;  5AJN A;  4FRE A;  3ST8 A;  4AYL A;  2AM3 A;  3LW6 A;  5L6V A;  1INJ A;  5CMJ A;  1LL3 A;  1WT2 A;  3V0P A;  2XME A;  3OGZ A;  4G3P A;  1JV3 A;  5L6S A;  1OMZ A;  3V0O A;  2PGY A;  2AE7 A;  2Z86 A;  1H5R B;  2RJ8 A;  3U0X A;  5FU8 A;  4KT7 A;  1NKH B;  4DE7 A;  1YP4 A;  3V8Z A;  1LZ0 A;  4KQL A;  1NWG B;  2RJ1 A;  1VH3 A;  3IOH A;  4L41 C;  1JYL A;  2PGV A;  4R7P A;  5CMH A;  4D0Z A;  3U2U A;  1JVG A;  1ZDG A;  2VS4 A;  3K8D A;  4JIS A;  1H4D A;  3EE5 A;  2RJ5 A;  2V0J A;  3CKO A;  3CU0 A;  1H5S A;  1TZF A;  2YES A;  1H5T B;  1G8O A;  1MP3 A;  4HO0 A;  3V0Q A;  1R7U A;  5CMI A;  2FYB A;  1ZJP A;  2VD4 A;  1QWJ A;  2ZU8 A;  2D7I A;  1O23 B;  2Z87 A;  1LL0 A;  1VZT A;  1H7G A;  2ZU9 A;  1LZI A;  1TVY A;  2OEF A;  4HO5 A;  3SXG A;  5CQP A;  1LZ7 A;  2OI7 A;  4AYJ A;  2E3D A;  3BRK X;  4HO6 A;  4AAW A;  2WAW A;  4J18 A;  2P72 A;  1NMM B;  2RJ4 A;  1G93 A;  4G87 A;  4EEA A;  1GQC A;  1OMX A;  2RIX A;  1GWV A;  3OAM A;  3U2T A;  2CU2 A;  2XWM A;  3ZGF A;  1IIN A;  2DPW A;  1VGT A;  2Y4J A;  4Y63 A;  4KC2 A;  3CKV A;  3Q7U A;  3T7N A;  3FOQ A;  3NGW A;  3PKP A;  4B4G A;  2O1H A;  1ZHJ A;  5FU0 A;  1R82 A;  2O1G A;  4CJ8 A;  1ZCV A;  4ASJ A;  3CGX A;  1MP4 A;  1O7Q A;  1WT0 A;  3OH2 A;  3T7M A;  4FRL A;  2C0N A;  3I0K A;  2I7B A;  4FQW A;  2WVM A;  2VS3 A;  1H5S B;  1HJJ A;  2OEG A;  4B4B A;  2W0V A;  3PKQ A;  3U2X A;  3OH3 A;  1VGZ A;  2QH5 A;  2WE9 A;  1G9R A;  4B2W A;  3OH4 A;  1I52 A;  4NAK A;  4LW6 A;  1TW5 A;  1FR8 A;  2PX7 A;  4KC1 A;  1E5K A;  2AGD A;  4FCU A;  1FXO A;  3V0M A;  2Y6P A;  5EJZ A;  4HO9 A;  4M4K A;  4O6M A;  1R80 A;  1NQI B;  3I0G A;  3IOI A;  1EZI A;  1MP5 A;  2FYA A;  2ICY A;  4FRH A;  5D91 A;  2QGI A;  2FYD B;  5C3D A;  4HCQ A;  1R81 A;  1Z90 A;  2X65 A;  1ON6 A;  5CQN X;  1HV9 A;  3QVB A;  4Y64 A;  3SX3 A;  1JYK A;  4Y7U A;  4DDZ A;  5J49 A;  2VXL A;  2RJ9 A;  2Q4J A;  5C1L A;  3O3P A;  3E25 A;  2OI5 A;  1W77 A;  1G1L A;  5CMF X;  1VZU A;  1FO9 A;  2FFU A;  1XHB A;  3ZLK A;  5FV9 A;  3PNN A;  3U2V A;  4Y7T A;  5FYE A;  2FFV A;  3CKQ A;  4ARW A;  4BQH A;  2GGQ A;  3F1C A;  4JD0 A;  3OH0 A;  3SXE A;  2OI6 A;  3V0N A;  4EE5 A;  5C48 A;  1ZCY A;  4B4M A;  4KNR A;  3I0F A;  4K6R A;  2AM5 A;  1R7V A;  1K4V A;  3SX8 A;  3V91 A;  1W55 A;  5EJ1 A;  4HO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...