3CGXA

Crystal structure of putative nucleotide-diphospho-sugar transferase (yp_389115.1) from desulfovibrio desulfuricans g20 at 1.90 a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
231
structure length
231
Chain Sequence
MSESCILFFVKYPEPGKVKTRLGEVVGNDKAAMLYRHFVQDMLQGLARLHADLHICYVPGDADLPEKFKAWLGPQHMFAAQQGLDLGERMKHAMQKAFDDGYDRVVLMGSDIPDYPCELVQKALNDLQHYDAAIGPAFDGGYYLIGFRKDSFCPDVFDGIRWGEADVYQPTVEKMRRARLEVLQLPDWNDVDTVWDLNVLYRTNKNSSFRRSSTYALLRENDALIRQYDID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative nucleotide-diphospho-sugar transferase
publication title Crystal structure of putative Nucleotide-diphospho-sugar Transferase (YP_389115.1) from Desulfovibrio desulfuricans G20 at 1.90 A resolution
rcsb
source organism Desulfovibrio desulfuricans subsp. desulfuricans str.
total genus 71
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2008-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09837 DUF2064 Uncharacterized protein conserved in bacteria (DUF2064)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3cgxA00
5C36A 5AJOA 1I52A 1TZFA 3I0CA 3NGWA 1JV1A 5FTVA 4BQHA 1W77A 2YQSA 1EYRA 2Q4JA 3I0DA 1G95A 1HM0A 2VD4A 3PNNA 1VGUA 4FRHA 1S4PA 1R7VA 4KQLA 1JYLA 4JISA 2I5EA 3Q7UA 1G9RA 4ASYA 4AYJA 1FXJA 4EEOA 4AC3A 4FRBA 2JCOA 2QKXA 1H5SD 2D0JA 3I0LA 3V0OA 4ZDQA 3ST8A 1S4OA 2RJ9A 1H3MA 1YROB 3LW6A 4G3SA 3U2WA 4P00A 3OH3A 1G2VA 4G87A 2VSHA 3I0IX 2BO4A 4E1KA 2VS4A 4UEGA 4M28A 1ZDFA 1G97A 3CKJA 1H4DA 3F1CA 3V8YA 1VGWA 3D5NA 1H5SC 1H7TA 5IDTA 3PKPA 4K6RA 4FRMA 4Y6NA 2OI6A 1XHBA 4ARWA 4D48A 3I0FA 1W55A 3V90A 3V0QA 2JCKA 3OKRA 2Y4LA 4NANA 4Y62A 2AECA 3SXAA 1VICA 4HCQA 1LL3A 5I1FA 3R2WA 4FREA 2PGVA 3GUEA 4KRVA 1VH1A 3QVBA 3T7MA 2RJ4A 2X5SA 1XZ6A 3V0MA 3CKOA 2CU2A 4B2XA 2OEFA 3T7OA 4J18A 4KPZA 3E26A 4Y6UA 2Y4JA 2RJ8A 3ZLKA 2RIYA 3SXGA 4B4BA 2VXLA 3BRKX 4D11A 3JUKA 4FCUA 4C2SA 3IOHA 1GWVA 4ECMA 1JYKA 5C3AA 5FV9A 2RJ7A 1H5RB 5C4BA 5CMJA 1YP2A 3ZLLA 2PX7A 1MP5A 1H7QA 2QH5A 3V0PA 2JCJA 1H7HA 1G0RA 1ZI1A 4HO6A 3V8ZA 2X5ZA 3OH4A 4EE3A 1R7XA 2YQHA 4EEMA 3Q4SA 3SXDA 1ON6A 2WEEA 3BCVA 1INJA 2XWNA 4FROA 1ZHJA 3PKQA 2PA4A 3HL3A 4KC4A 3U2VA 2ZU8A 4DE7A 3OH1A 4DECA 1O23B 4HO3A 1WT1A 1ZI5A 2V0JA 3T7NA 1H5TA 2MZBA 3EE5A 1WT3A 3I0GA 2YQJA 2V0HA 3OC9A 1GA8A 3N9WA 5FU8A 3U0YA 1VZUA 2E3DA 1H5SB 1H7FA 4EE4A 5EJZA 4HG6A 3USQA 2YC5A 1VZXA 4FRQA 3OH0A 1VPAA 4Y7TA 1YP3A 2XMHA 1H7LA 1VGZA 3U0XA 2A8WA 3ZGGA 1R7YA 4NAKA 1R80A 1GX4A 4ASJA 2Y7AA 3O3PA 4BMAA 2VS5A 1G23A 3D98A 4HOCA 5DDTA 2VS3A 1GQCA 2OI5A 1E5KA 2UX8A 4KC2A 3USRA 3CKNA 1NKHB 4D0TA 4Y7FA 1SS9A 4Y9XA 3Q80A 2GGQA 1IINA 2JCLA 1EZIA 2ZU9A 1LZJA 2XMEA 5CQNX 1G8OA 5DDVA 3I0HA 1FO9A 2FFVA 4B5BA 1LL0A 2XWLA 1ZCTA 2RJ0A 4HO8A 5CMFX 3V91A 4LW6A 3OH2A 1NF5B 1LL2A 1QWJA 5C8RA 4FCEA 4HO0A 1PZTA 1H4EA 5C3BA 1FR9A 4CJCA 1ZJ3A 1FO8A 3SX3A 2V0IA 1H4CA 1WT0A 4B4GA 1PZYB 1K4VA 1WT2A 5FTSA 3DUVA 2RIZA 2X65A 1ZCVA 4FRPA 1G3LA 2AM3A 1QG8A 5C1HA 2GGOA 5AJPA 4R7PA 4XWIA 1TVYA 1ZJ1A 1ZJ0A 2O1FA 1FWYA 1MC3A 3I0KA 1H7GA 1FZWA 1HV9A 3OAMA 2BO8A 5CQPA 3RSBA 4DDZA 1JVDA 2W0VA 2Y4KA 4Y7GA 3CKQA 1NHEB 3OGZA 5CQLX 1HM9A 1O7OA 3SX8A 1H5RA 3F1YA 2AGDA 1V83A 1W57A 2AM5A 5L6VA 2D7RA 1TW5A 3D8VA 5C1LA 2RITA 5FYEA 4CVHA 4NALA 5JQQA 4JD0A 2YCMA 3U2UA 1ON8A 2WGZA 2AE7A 5FUHA 4Y7VA 1GX0A 2WE9A 4B42A 2P72A 4FRLA 2FYCB 5HS2A 4L41C 1R82A 3SXEA 1R7UA 1MP3A 1HJJA 2YESA 2BO7A 5IFYA 4YS8A 5CMIA 1S4NA 2BO6A 1WSZA 3R3IA 1R81A 1GWWA 2P6WA 4D11C 1V82A 4M4KA 5C1GA 4G3QA 5C4DA 4EEAA 4EEGA 2OI7A 1LVWA 1HM8A 2WVMA 1FGXA 1INIA 1VM8A 2I5KA 2Y4MA 3FWWA 4KNXA 4P02A 3ZGFA 5C4FA 1OMZA 2V0KA 1H5SA 1H7EA 1KWSA 2NXVA 2OEGA 5IDSA 2RJ6A 1LZ0A 1LZIA 2FYDB 2XWMA 2AESA 1FOAA 3V0NA 5EIYA 1OQMB 5CMGX 1QGSA 1FGGA 4AAWA 5C4EA 5C49A 1FR8A 2VXMA 2QGIA 4KT7A 1ZJOA 4Y64A 1ZJ2A 2ICYA 2RJ5A 4HO9A 4B3UA 1O0RA 3SXCA 1NQIB 4MYBA 1WVCA 1YP4A 4M2AA 5C48A 1HJLA 4HO4A 1V84A 1ZI4A 4KPXA 1NMMB 3U2TA 4IRQA 1JVGA 2W0WA 4Y63A 1LZ7A 1NWGB 4NAIA 1JV3A 3U2XA 2FYAA 5FU0A 5CMHA 3IOIA 1R7TA 5C38A 5EJ1A 5L6SA 3RMVA 2DPWA 4G3PA 2I7BA 4GBPA 4KC1A 2Z87A 3SX7A 2O1GA 1QGQA 1G1LA 2ICXA 2VSIA 1GQ9A 3I0JA 3CKVA 5AJNA 1VGTA 2RIXA 3TZTA 2D7IA 3KIAA 3CU0A 5C47A 1Z90A 5C4CA 3SXBA 4M2BA 4AYLA 3K8DA 4CJ8A 2PGYA 3FOQA 2FY7A 4KXOA 1ZI3A 1O7QA 3JTJA 4Y7UA 3POLA 2YQCA 1IIMA 3V0LA 4FQWA 5BXCA 3CGXA 3E25A 4D0ZA 2E8BA 3ZF8A 3RMWA 2A8UA 4HO2A 2FFUA 3DK5A 2X60A 4FRDA 2APCA 4MNDA 2P73A 1FXOA 5C3DA 5CQOA 5J49A 5CQMX 2Z86A 4KNRA 3I0EA 1MP4A 2RJ1A 1FRWA 1VH3A 1FG5N 3K8EA 3TQDA 1VZTA 1OMXA 2O1HA 3DJ4A 4EE5A 1ZCYA 3SX5A 4CJBA 1ZCUA 2WVLA 1TW1A 2Y6PA 4B4MA 4IRPA 2AH9A 4FRAA 2YC3A 4EVWA 2V0LA 2AM4A 1H5TB 4LW3A 1ZDGA 2ZU7A 2VFZA 1ZIZA 1G93A 3SPTA 1ZJPA 2WVKA 3IOJA 3JUJA 4HO5A 4B2WA 2WAWA 2FYBA
chains in the Genus database with same CATH superfamily
5C36A 5AJOA 1I52A 1TZFA 3I0CA 2C0NA 3NGWA 1JV1A 5FTVA 4BQHA 1W77A 2YQSA 1EYRA 2Q4JA 3I0DA 1G95A 1HM0A 2VD4A 3PNNA 1VGUA 4FRHA 1S4PA 1R7VA 4KQLA 1JYLA 4JISA 2I5EA 3Q7UA 1G9RA 4ASYA 4AYJA 1FXJA 4EEOA 4AC3A 4FRBA 2JCOA 2QKXA 1H5SD 2D0JA 3I0LA 3V0OA 4ZDQA 3ST8A 1S4OA 2RJ9A 1H3MA 1YROB 3LW6A 4G3SA 3U2WA 4P00A 3OH3A 1G2VA 4G87A 2VSHA 3I0IX 2BO4A 4E1KA 2VS4A 4UEGA 4M28A 1ZDFA 5D91A 1G97A 3CKJA 1H4DA 3F1CA 3V8YA 1VGWA 3D5NA 1H5SC 1H7TA 2J0BA 5IDTA 3PKPA 4K6RA 4FRMA 4Y6NA 2OI6A 2VK9A 1XHBA 4ARWA 4D48A 3I0FA 1W55A 3V90A 3V0QA 2JCKA 3OKRA 2Y4LA 4NANA 4Y62A 2AECA 3SXAA 1VICA 4HCQA 1LL3A 5I1FA 3R2WA 4FREA 2PGVA 3GUEA 4KRVA 1VH1A 3QVBA 3T7MA 2RJ4A 2X5SA 1XZ6A 3V0MA 3CKOA 2CU2A 4B2XA 2OEFA 3T7OA 4J18A 4KPZA 3E26A 4Y6UA 2Y4JA 2RJ8A 3ZLKA 2RIYA 3SXGA 4B4BA 2VXLA 3BRKX 4D11A 3JUKA 4FCUA 4C2SA 3IOHA 1GWVA 4ECMA 1JYKA 5C3AA 5FV9A 2RJ7A 1H5RB 5C4BA 5CMJA 1YP2A 2J0AA 3ZLLA 2PX7A 1MP5A 1H7QA 2QH5A 3V0PA 2JCJA 1H7HA 1G0RA 1ZI1A 4HO6A 3V8ZA 2X5ZA 3OH4A 4EE3A 1R7XA 2YQHA 4EEMA 3Q4SA 3SXDA 1ON6A 2WEEA 3BCVA 1INJA 2XWNA 4FROA 1ZHJA 3PKQA 2PA4A 3HL3A 4KC4A 3U2VA 2ZU8A 4DE7A 3OH1A 4DECA 1O23B 4HO3A 4FIXA 1WT1A 1ZI5A 2V0JA 3T7NA 1H5TA 2MZBA 3EE5A 1WT3A 3I0GA 2YQJA 2V0HA 3OC9A 1GA8A 3N9WA 5FU8A 3U0YA 1VZUA 2E3DA 1H5SB 1H7FA 4EE4A 5EJZA 4HG6A 3USQA 2YC5A 4O6MA 1VZXA 4FRQA 3OH0A 1VPAA 4Y7TA 1YP3A 2XMHA 1H7LA 1VGZA 3U0XA 2A8WA 3ZGGA 1R7YA 4NAKA 1R80A 1GX4A 4ASJA 2Y7AA 3O3PA 4BMAA 2VS5A 1G23A 3D98A 4HOCA 5DDTA 2VS3A 1GQCA 2OI5A 1E5KA 2UX8A 4KC2A 3USRA 3CKNA 1NKHB 4D0TA 4Y7FA 1SS9A 4Y9XA 3Q80A 2GGQA 1IINA 2JCLA 1EZIA 2ZU9A 1LZJA 2XMEA 5CQNX 1G8OA 5DDVA 3I0HA 1FO9A 2FFVA 4B5BA 1LL0A 2XWLA 1ZCTA 2RJ0A 4HO8A 5CMFX 3V91A 4LW6A 3OH2A 1NF5B 1LL2A 1QWJA 5C8RA 4FCEA 4HO0A 1PZTA 1H4EA 5C3BA 1FR9A 4CJCA 1ZJ3A 1FO8A 3SX3A 2V0IA 1H4CA 1WT0A 4B4GA 1PZYB 1K4VA 1WT2A 5FTSA 3DUVA 2RIZA 2X65A 1ZCVA 4FRPA 1G3LA 2AM3A 1QG8A 5C1HA 2GGOA 5AJPA 4R7PA 4XWIA 1TVYA 1ZJ1A 1ZJ0A 2O1FA 1FWYA 1MC3A 3I0KA 1H7GA 1FZWA 1HV9A 3OAMA 2BO8A 5CQPA 3RSBA 4DDZA 1JVDA 2W0VA 2Y4KA 4Y7GA 3CKQA 1NHEB 3OGZA 5CQLX 1HM9A 1O7OA 3SX8A 1H5RA 3F1YA 2AGDA 1V83A 1W57A 2AM5A 5L6VA 2D7RA 1TW5A 3D8VA 5C1LA 2RITA 5FYEA 4CVHA 4NALA 5JQQA 4JD0A 2YCMA 3U2UA 1ON8A 2WGZA 2AE7A 5FUHA 4Y7VA 1GX0A 2WE9A 4B42A 2P72A 4FRLA 2FYCB 5HS2A 4L41C 1R82A 3SXEA 1R7UA 1MP3A 1HJJA 2YESA 2BO7A 5IFYA 4YS8A 5CMIA 1S4NA 2BO6A 1WSZA 3R3IA 1R81A 1GWWA 2P6WA 4D11C 1V82A 4M4KA 5C1GA 4G3QA 5C4DA 4EEAA 4EEGA 2OI7A 1LVWA 1HM8A 2WVMA 1FGXA 1INIA 1VM8A 2I5KA 2Y4MA 3FWWA 4KNXA 4P02A 3ZGFA 5C4FA 1OMZA 2V0KA 1H5SA 1H7EA 1KWSA 2NXVA 2OEGA 5IDSA 2RJ6A 1LZ0A 4O6NA 1LZIA 2FYDB 2XWMA 2AESA 1FOAA 3V0NA 5EIYA 1OQMB 5CMGX 1QGSA 1FGGA 4AAWA 5C4EA 5C49A 1FR8A 2VXMA 2QGIA 4KT7A 1ZJOA 4Y64A 1ZJ2A 2ICYA 2RJ5A 4HO9A 4B3UA 1O0RA 3SXCA 1NQIB 5D92A 4MYBA 1WVCA 1YP4A 4M2AA 5C48A 1HJLA 4HO4A 1V84A 1ZI4A 4KPXA 1NMMB 3U2TA 4IRQA 1JVGA 2W0WA 4Y63A 1LZ7A 1NWGB 4NAIA 1JV3A 3U2XA 2FYAA 5FU0A 5CMHA 3IOIA 1R7TA 5C38A 5EJ1A 5L6SA 3RMVA 2DPWA 4G3PA 2I7BA 4GBPA 4KC1A 2Z87A 3SX7A 2O1GA 1QGQA 1G1LA 2ICXA 4Q7CA 2VSIA 1GQ9A 3I0JA 3CKVA 5AJNA 1VGTA 2RIXA 3TZTA 2D7IA 3KIAA 3CU0A 5C47A 1Z90A 5C4CA 3SXBA 4M2BA 4AYLA 3K8DA 4CJ8A 2PGYA 3FOQA 2FY7A 4KXOA 1ZI3A 1O7QA 3JTJA 4Y7UA 3POLA 2YQCA 1IIMA 3V0LA 4FQWA 5BXCA 3CGXA 3E25A 4D0ZA 2E8BA 3ZF8A 3RMWA 2A8UA 4HO2A 2FFUA 3DK5A 2X60A 4FRDA 2APCA 4MNDA 2P73A 1FXOA 5C3DA 5CQOA 5J49A 5CQMX 2Z86A 4KNRA 3I0EA 1MP4A 4FIYA 2RJ1A 1FRWA 1VH3A 1FG5N 3K8EA 3TQDA 1VZTA 1OMXA 2O1HA 3DJ4A 4EE5A 1ZCYA 3SX5A 4CJBA 1ZCUA 2WVLA 1TW1A 2Y6PA 4B4MA 4IRPA 2AH9A 4FRAA 2YC3A 4EVWA 2V0LA 2AM4A 1H5TB 4LW3A 1ZDGA 2ZU7A 2VFZA 1ZIZA 4MIXA 1G93A 3SPTA 1ZJPA 2WVKA 3IOJA 3JUJA 4HO5A 4B2WA 2WAWA 2FYBA
chains in the Genus database with same CATH topology
5C36A 5AJOA 1I52A 1TZFA 3I0CA 2C0NA 3NGWA 1JV1A 5FTVA 4BQHA 1W77A 2YQSA 1EYRA 2Q4JA 3I0DA 1G95A 1HM0A 2VD4A 3PNNA 1VGUA 4FRHA 1S4PA 1R7VA 4KQLA 1JYLA 4JISA 2I5EA 3Q7UA 1G9RA 4ASYA 4AYJA 1FXJA 4EEOA 4AC3A 4FRBA 2JCOA 2QKXA 1H5SD 2D0JA 3I0LA 3V0OA 4ZDQA 3ST8A 1S4OA 2RJ9A 1H3MA 1YROB 3LW6A 4G3SA 3U2WA 4P00A 3OH3A 1G2VA 4G87A 2VSHA 3I0IX 2BO4A 4E1KA 2VS4A 4UEGA 4M28A 1ZDFA 5D91A 1G97A 3CKJA 1H4DA 3F1CA 3V8YA 1VGWA 3D5NA 1H5SC 1H7TA 2J0BA 5IDTA 3PKPA 4K6RA 4FRMA 4Y6NA 2OI6A 2VK9A 1XHBA 4ARWA 4D48A 3I0FA 1W55A 3V90A 3V0QA 2JCKA 3OKRA 2Y4LA 4NANA 4Y62A 2AECA 3SXAA 1VICA 4HCQA 1LL3A 5I1FA 3R2WA 4FREA 2PGVA 3GUEA 4KRVA 1VH1A 3QVBA 3T7MA 2RJ4A 2X5SA 1XZ6A 3V0MA 3CKOA 2CU2A 4B2XA 2OEFA 3T7OA 4J18A 4KPZA 3E26A 4Y6UA 2Y4JA 2RJ8A 3ZLKA 2RIYA 3SXGA 4B4BA 2VXLA 3BRKX 4D11A 3JUKA 4FCUA 4C2SA 3IOHA 1GWVA 4ECMA 1JYKA 5C3AA 5FV9A 2RJ7A 1H5RB 5C4BA 5CMJA 1YP2A 2J0AA 3ZLLA 2PX7A 1MP5A 1H7QA 2QH5A 3V0PA 2JCJA 1H7HA 1G0RA 1ZI1A 4HO6A 3V8ZA 2X5ZA 3OH4A 4EE3A 1R7XA 2YQHA 4EEMA 3Q4SA 3SXDA 1ON6A 2WEEA 3BCVA 1INJA 2XWNA 4FROA 1ZHJA 3PKQA 2PA4A 3HL3A 4KC4A 3U2VA 2ZU8A 4DE7A 3OH1A 4DECA 1O23B 4HO3A 4FIXA 1WT1A 1ZI5A 2V0JA 3T7NA 1H5TA 2MZBA 3EE5A 1WT3A 3I0GA 2YQJA 2V0HA 3OC9A 1GA8A 3N9WA 5FU8A 3U0YA 1VZUA 2E3DA 1H5SB 1H7FA 4EE4A 5EJZA 4HG6A 3USQA 2YC5A 4O6MA 1VZXA 4FRQA 3OH0A 1VPAA 4Y7TA 1YP3A 2XMHA 1H7LA 1VGZA 3U0XA 2A8WA 3ZGGA 1R7YA 4NAKA 1R80A 1GX4A 4ASJA 2Y7AA 3O3PA 4BMAA 2VS5A 1G23A 3D98A 4HOCA 5DDTA 2VS3A 1GQCA 2OI5A 1E5KA 2UX8A 4KC2A 3USRA 3CKNA 1NKHB 4D0TA 4Y7FA 1SS9A 4Y9XA 3Q80A 2GGQA 1IINA 2JCLA 1EZIA 2ZU9A 1LZJA 2XMEA 5CQNX 1G8OA 5DDVA 3I0HA 1FO9A 2FFVA 4B5BA 1LL0A 2XWLA 1ZCTA 2RJ0A 4HO8A 5CMFX 3V91A 4LW6A 3OH2A 1NF5B 1LL2A 1QWJA 5C8RA 4FCEA 4HO0A 1PZTA 1H4EA 5C3BA 1FR9A 4CJCA 1ZJ3A 1FO8A 3SX3A 2V0IA 1H4CA 1WT0A 4B4GA 1PZYB 1K4VA 1WT2A 5FTSA 3DUVA 2RIZA 2X65A 1ZCVA 4FRPA 1G3LA 2AM3A 1QG8A 5C1HA 2GGOA 5AJPA 4R7PA 4XWIA 1TVYA 1ZJ1A 1ZJ0A 2O1FA 1FWYA 1MC3A 3I0KA 1H7GA 1FZWA 1HV9A 3OAMA 2BO8A 5CQPA 3RSBA 4DDZA 1JVDA 2W0VA 2Y4KA 4Y7GA 3CKQA 1NHEB 3OGZA 5CQLX 1HM9A 1O7OA 3SX8A 1H5RA 3F1YA 2AGDA 1V83A 1W57A 2AM5A 5L6VA 2D7RA 1TW5A 3D8VA 5C1LA 2RITA 5FYEA 4CVHA 4NALA 5JQQA 4JD0A 2YCMA 3U2UA 1ON8A 2WGZA 2AE7A 5FUHA 4Y7VA 1GX0A 2WE9A 4B42A 2P72A 4FRLA 2FYCB 5HS2A 4L41C 1R82A 3SXEA 1R7UA 1MP3A 1HJJA 2YESA 2BO7A 5IFYA 4YS8A 5CMIA 1S4NA 2BO6A 1WSZA 3R3IA 1R81A 1GWWA 2P6WA 4D11C 1V82A 4M4KA 5C1GA 4G3QA 5C4DA 4EEAA 4EEGA 2OI7A 1LVWA 1HM8A 2WVMA 1FGXA 1INIA 1VM8A 2I5KA 2Y4MA 3FWWA 4KNXA 4P02A 3ZGFA 5C4FA 1OMZA 2V0KA 1H5SA 1H7EA 1KWSA 2NXVA 2OEGA 5IDSA 2RJ6A 1LZ0A 4O6NA 1LZIA 2FYDB 2XWMA 2AESA 1FOAA 3V0NA 5EIYA 1OQMB 5CMGX 1QGSA 1FGGA 4AAWA 5C4EA 5C49A 1FR8A 2VXMA 2QGIA 4KT7A 1ZJOA 4Y64A 1ZJ2A 2ICYA 2RJ5A 4HO9A 4B3UA 1O0RA 3SXCA 1NQIB 5D92A 4MYBA 1WVCA 1YP4A 4M2AA 5C48A 1HJLA 4HO4A 1V84A 1ZI4A 4KPXA 1NMMB 3U2TA 4IRQA 1JVGA 2W0WA 4Y63A 1LZ7A 1NWGB 4NAIA 1JV3A 3U2XA 2FYAA 5FU0A 5CMHA 3IOIA 1R7TA 5C38A 5EJ1A 5L6SA 3RMVA 2DPWA 4G3PA 2I7BA 4GBPA 4KC1A 2Z87A 3SX7A 2O1GA 1QGQA 1G1LA 2ICXA 4Q7CA 2VSIA 1GQ9A 3I0JA 3CKVA 5AJNA 1VGTA 2RIXA 3TZTA 2D7IA 3KIAA 3CU0A 5C47A 1Z90A 5C4CA 3SXBA 4M2BA 4AYLA 3K8DA 4CJ8A 2PGYA 3FOQA 2FY7A 4KXOA 1ZI3A 1O7QA 3JTJA 4Y7UA 3POLA 2YQCA 1IIMA 3V0LA 4FQWA 5BXCA 3CGXA 3E25A 4D0ZA 2E8BA 3ZF8A 3RMWA 2A8UA 4HO2A 2FFUA 3DK5A 2X60A 4FRDA 2APCA 4MNDA 2P73A 1FXOA 5C3DA 5CQOA 5J49A 5CQMX 2Z86A 4KNRA 3I0EA 1MP4A 4FIYA 2RJ1A 1FRWA 1VH3A 1FG5N 3K8EA 3TQDA 1VZTA 1OMXA 2O1HA 3DJ4A 4EE5A 1ZCYA 3SX5A 4CJBA 1ZCUA 2WVLA 1TW1A 2Y6PA 4B4MA 4IRPA 2AH9A 4FRAA 2YC3A 4EVWA 2V0LA 2AM4A 1H5TB 4LW3A 1ZDGA 2ZU7A 2VFZA 1ZIZA 4MIXA 1G93A 3SPTA 1ZJPA 2WVKA 3IOJA 3JUJA 4HO5A 4B2WA 2WAWA 2FYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C36 A;  5AJO A;  1I52 A;  1TZF A;  3I0C A;  3NGW A;  1JV1 A;  5FTV A;  4BQH A;  1W77 A;  2YQS A;  1EYR A;  2Q4J A;  3I0D A;  1G95 A;  1HM0 A;  2VD4 A;  3PNN A;  1VGU A;  4FRH A;  1S4P A;  1R7V A;  4KQL A;  1JYL A;  4JIS A;  2I5E A;  3Q7U A;  1G9R A;  4ASY A;  4AYJ A;  1FXJ A;  4EEO A;  4AC3 A;  4FRB A;  2JCO A;  2QKX A;  1H5S D;  2D0J A;  3I0L A;  3V0O A;  4ZDQ A;  3ST8 A;  1S4O A;  2RJ9 A;  1H3M A;  1YRO B;  3LW6 A;  4G3S A;  3U2W A;  4P00 A;  3OH3 A;  1G2V A;  4G87 A;  2VSH A;  3I0I X;  2BO4 A;  4E1K A;  2VS4 A;  4UEG A;  4M28 A;  1ZDF A;  1G97 A;  3CKJ A;  1H4D A;  3F1C A;  3V8Y A;  1VGW A;  3D5N A;  1H5S C;  1H7T A;  5IDT A;  3PKP A;  4K6R A;  4FRM A;  4Y6N A;  2OI6 A;  1XHB A;  4ARW A;  4D48 A;  3I0F A;  1W55 A;  3V90 A;  3V0Q A;  2JCK A;  3OKR A;  2Y4L A;  4NAN A;  4Y62 A;  2AEC A;  3SXA A;  1VIC A;  4HCQ A;  1LL3 A;  5I1F A;  3R2W A;  4FRE A;  2PGV A;  3GUE A;  4KRV A;  1VH1 A;  3QVB A;  3T7M A;  2RJ4 A;  2X5S A;  1XZ6 A;  3V0M A;  3CKO A;  2CU2 A;  4B2X A;  2OEF A;  3T7O A;  4J18 A;  4KPZ A;  3E26 A;  4Y6U A;  2Y4J A;  2RJ8 A;  3ZLK A;  2RIY A;  3SXG A;  4B4B A;  2VXL A;  3BRK X;  4D11 A;  3JUK A;  4FCU A;  4C2S A;  3IOH A;  1GWV A;  4ECM A;  1JYK A;  5C3A A;  5FV9 A;  2RJ7 A;  1H5R B;  5C4B A;  5CMJ A;  1YP2 A;  3ZLL A;  2PX7 A;  1MP5 A;  1H7Q A;  2QH5 A;  3V0P A;  2JCJ A;  1H7H A;  1G0R A;  1ZI1 A;  4HO6 A;  3V8Z A;  2X5Z A;  3OH4 A;  4EE3 A;  1R7X A;  2YQH A;  4EEM A;  3Q4S A;  3SXD A;  1ON6 A;  2WEE A;  3BCV A;  1INJ A;  2XWN A;  4FRO A;  1ZHJ A;  3PKQ A;  2PA4 A;  3HL3 A;  4KC4 A;  3U2V A;  2ZU8 A;  4DE7 A;  3OH1 A;  4DEC A;  1O23 B;  4HO3 A;  1WT1 A;  1ZI5 A;  2V0J A;  3T7N A;  1H5T A;  2MZB A;  3EE5 A;  1WT3 A;  3I0G A;  2YQJ A;  2V0H A;  3OC9 A;  1GA8 A;  3N9W A;  5FU8 A;  3U0Y A;  1VZU A;  2E3D A;  1H5S B;  1H7F A;  4EE4 A;  5EJZ A;  4HG6 A;  3USQ A;  2YC5 A;  1VZX A;  4FRQ A;  3OH0 A;  1VPA A;  4Y7T A;  1YP3 A;  2XMH A;  1H7L A;  1VGZ A;  3U0X A;  2A8W A;  3ZGG A;  1R7Y A;  4NAK A;  1R80 A;  1GX4 A;  4ASJ A;  2Y7A A;  3O3P A;  4BMA A;  2VS5 A;  1G23 A;  3D98 A;  4HOC A;  5DDT A;  2VS3 A;  1GQC A;  2OI5 A;  1E5K A;  2UX8 A;  4KC2 A;  3USR A;  3CKN A;  1NKH B;  4D0T A;  4Y7F A;  1SS9 A;  4Y9X A;  3Q80 A;  2GGQ A;  1IIN A;  2JCL A;  1EZI A;  2ZU9 A;  1LZJ A;  2XME A;  5CQN X;  1G8O A;  5DDV A;  3I0H A;  1FO9 A;  2FFV A;  4B5B A;  1LL0 A;  2XWL A;  1ZCT A;  2RJ0 A;  4HO8 A;  5CMF X;  3V91 A;  4LW6 A;  3OH2 A;  1NF5 B;  1LL2 A;  1QWJ A;  5C8R A;  4FCE A;  4HO0 A;  1PZT A;  1H4E A;  5C3B A;  1FR9 A;  4CJC A;  1ZJ3 A;  1FO8 A;  3SX3 A;  2V0I A;  1H4C A;  1WT0 A;  4B4G A;  1PZY B;  1K4V A;  1WT2 A;  5FTS A;  3DUV A;  2RIZ A;  2X65 A;  1ZCV A;  4FRP A;  1G3L A;  2AM3 A;  1QG8 A;  5C1H A;  2GGO A;  5AJP A;  4R7P A;  4XWI A;  1TVY A;  1ZJ1 A;  1ZJ0 A;  2O1F A;  1FWY A;  1MC3 A;  3I0K A;  1H7G A;  1FZW A;  1HV9 A;  3OAM A;  2BO8 A;  5CQP A;  3RSB A;  4DDZ A;  1JVD A;  2W0V A;  2Y4K A;  4Y7G A;  3CKQ A;  1NHE B;  3OGZ A;  5CQL X;  1HM9 A;  1O7O A;  3SX8 A;  1H5R A;  3F1Y A;  2AGD A;  1V83 A;  1W57 A;  2AM5 A;  5L6V A;  2D7R A;  1TW5 A;  3D8V A;  5C1L A;  2RIT A;  5FYE A;  4CVH A;  4NAL A;  5JQQ A;  4JD0 A;  2YCM A;  3U2U A;  1ON8 A;  2WGZ A;  2AE7 A;  5FUH A;  4Y7V A;  1GX0 A;  2WE9 A;  4B42 A;  2P72 A;  4FRL A;  2FYC B;  5HS2 A;  4L41 C;  1R82 A;  3SXE A;  1R7U A;  1MP3 A;  1HJJ A;  2YES A;  2BO7 A;  5IFY A;  4YS8 A;  5CMI A;  1S4N A;  2BO6 A;  1WSZ A;  3R3I A;  1R81 A;  1GWW A;  2P6W A;  4D11 C;  1V82 A;  4M4K A;  5C1G A;  4G3Q A;  5C4D A;  4EEA A;  4EEG A;  2OI7 A;  1LVW A;  1HM8 A;  2WVM A;  1FGX A;  1INI A;  1VM8 A;  2I5K A;  2Y4M A;  3FWW A;  4KNX A;  4P02 A;  3ZGF A;  5C4F A;  1OMZ A;  2V0K A;  1H5S A;  1H7E A;  1KWS A;  2NXV A;  2OEG A;  5IDS A;  2RJ6 A;  1LZ0 A;  1LZI A;  2FYD B;  2XWM A;  2AES A;  1FOA A;  3V0N A;  5EIY A;  1OQM B;  5CMG X;  1QGS A;  1FGG A;  4AAW A;  5C4E A;  5C49 A;  1FR8 A;  2VXM A;  2QGI A;  4KT7 A;  1ZJO A;  4Y64 A;  1ZJ2 A;  2ICY A;  2RJ5 A;  4HO9 A;  4B3U A;  1O0R A;  3SXC A;  1NQI B;  4MYB A;  1WVC A;  1YP4 A;  4M2A A;  5C48 A;  1HJL A;  4HO4 A;  1V84 A;  1ZI4 A;  4KPX A;  1NMM B;  3U2T A;  4IRQ A;  1JVG A;  2W0W A;  4Y63 A;  1LZ7 A;  1NWG B;  4NAI A;  1JV3 A;  3U2X A;  2FYA A;  5FU0 A;  5CMH A;  3IOI A;  1R7T A;  5C38 A;  5EJ1 A;  5L6S A;  3RMV A;  2DPW A;  4G3P A;  2I7B A;  4GBP A;  4KC1 A;  2Z87 A;  3SX7 A;  2O1G A;  1QGQ A;  1G1L A;  2ICX A;  2VSI A;  1GQ9 A;  3I0J A;  3CKV A;  5AJN A;  1VGT A;  2RIX A;  3TZT A;  2D7I A;  3KIA A;  3CU0 A;  5C47 A;  1Z90 A;  5C4C A;  3SXB A;  4M2B A;  4AYL A;  3K8D A;  4CJ8 A;  2PGY A;  3FOQ A;  2FY7 A;  4KXO A;  1ZI3 A;  1O7Q A;  3JTJ A;  4Y7U A;  3POL A;  2YQC A;  1IIM A;  3V0L A;  4FQW A;  5BXC A;  3CGX A;  3E25 A;  4D0Z A;  2E8B A;  3ZF8 A;  3RMW A;  2A8U A;  4HO2 A;  2FFU A;  3DK5 A;  2X60 A;  4FRD A;  2APC A;  4MND A;  2P73 A;  1FXO A;  5C3D A;  5CQO A;  5J49 A;  5CQM X;  2Z86 A;  4KNR A;  3I0E A;  1MP4 A;  2RJ1 A;  1FRW A;  1VH3 A;  1FG5 N;  3K8E A;  3TQD A;  1VZT A;  1OMX A;  2O1H A;  3DJ4 A;  4EE5 A;  1ZCY A;  3SX5 A;  4CJB A;  1ZCU A;  2WVL A;  1TW1 A;  2Y6P A;  4B4M A;  4IRP A;  2AH9 A;  4FRA A;  2YC3 A;  4EVW A;  2V0L A;  2AM4 A;  1H5T B;  4LW3 A;  1ZDG A;  2ZU7 A;  2VFZ A;  1ZIZ A;  1G93 A;  3SPT A;  1ZJP A;  2WVK A;  3IOJ A;  3JUJ A;  4HO5 A;  4B2W A;  2WAW A;  2FYB A; 
#chains in the Genus database with same CATH topology
 5C36 A;  5AJO A;  1I52 A;  1TZF A;  3I0C A;  2C0N A;  3NGW A;  1JV1 A;  5FTV A;  4BQH A;  1W77 A;  2YQS A;  1EYR A;  2Q4J A;  3I0D A;  1G95 A;  1HM0 A;  2VD4 A;  3PNN A;  1VGU A;  4FRH A;  1S4P A;  1R7V A;  4KQL A;  1JYL A;  4JIS A;  2I5E A;  3Q7U A;  1G9R A;  4ASY A;  4AYJ A;  1FXJ A;  4EEO A;  4AC3 A;  4FRB A;  2JCO A;  2QKX A;  1H5S D;  2D0J A;  3I0L A;  3V0O A;  4ZDQ A;  3ST8 A;  1S4O A;  2RJ9 A;  1H3M A;  1YRO B;  3LW6 A;  4G3S A;  3U2W A;  4P00 A;  3OH3 A;  1G2V A;  4G87 A;  2VSH A;  3I0I X;  2BO4 A;  4E1K A;  2VS4 A;  4UEG A;  4M28 A;  1ZDF A;  5D91 A;  1G97 A;  3CKJ A;  1H4D A;  3F1C A;  3V8Y A;  1VGW A;  3D5N A;  1H5S C;  1H7T A;  2J0B A;  5IDT A;  3PKP A;  4K6R A;  4FRM A;  4Y6N A;  2OI6 A;  2VK9 A;  1XHB A;  4ARW A;  4D48 A;  3I0F A;  1W55 A;  3V90 A;  3V0Q A;  2JCK A;  3OKR A;  2Y4L A;  4NAN A;  4Y62 A;  2AEC A;  3SXA A;  1VIC A;  4HCQ A;  1LL3 A;  5I1F A;  3R2W A;  4FRE A;  2PGV A;  3GUE A;  4KRV A;  1VH1 A;  3QVB A;  3T7M A;  2RJ4 A;  2X5S A;  1XZ6 A;  3V0M A;  3CKO A;  2CU2 A;  4B2X A;  2OEF A;  3T7O A;  4J18 A;  4KPZ A;  3E26 A;  4Y6U A;  2Y4J A;  2RJ8 A;  3ZLK A;  2RIY A;  3SXG A;  4B4B A;  2VXL A;  3BRK X;  4D11 A;  3JUK A;  4FCU A;  4C2S A;  3IOH A;  1GWV A;  4ECM A;  1JYK A;  5C3A A;  5FV9 A;  2RJ7 A;  1H5R B;  5C4B A;  5CMJ A;  1YP2 A;  2J0A A;  3ZLL A;  2PX7 A;  1MP5 A;  1H7Q A;  2QH5 A;  3V0P A;  2JCJ A;  1H7H A;  1G0R A;  1ZI1 A;  4HO6 A;  3V8Z A;  2X5Z A;  3OH4 A;  4EE3 A;  1R7X A;  2YQH A;  4EEM A;  3Q4S A;  3SXD A;  1ON6 A;  2WEE A;  3BCV A;  1INJ A;  2XWN A;  4FRO A;  1ZHJ A;  3PKQ A;  2PA4 A;  3HL3 A;  4KC4 A;  3U2V A;  2ZU8 A;  4DE7 A;  3OH1 A;  4DEC A;  1O23 B;  4HO3 A;  4FIX A;  1WT1 A;  1ZI5 A;  2V0J A;  3T7N A;  1H5T A;  2MZB A;  3EE5 A;  1WT3 A;  3I0G A;  2YQJ A;  2V0H A;  3OC9 A;  1GA8 A;  3N9W A;  5FU8 A;  3U0Y A;  1VZU A;  2E3D A;  1H5S B;  1H7F A;  4EE4 A;  5EJZ A;  4HG6 A;  3USQ A;  2YC5 A;  4O6M A;  1VZX A;  4FRQ A;  3OH0 A;  1VPA A;  4Y7T A;  1YP3 A;  2XMH A;  1H7L A;  1VGZ A;  3U0X A;  2A8W A;  3ZGG A;  1R7Y A;  4NAK A;  1R80 A;  1GX4 A;  4ASJ A;  2Y7A A;  3O3P A;  4BMA A;  2VS5 A;  1G23 A;  3D98 A;  4HOC A;  5DDT A;  2VS3 A;  1GQC A;  2OI5 A;  1E5K A;  2UX8 A;  4KC2 A;  3USR A;  3CKN A;  1NKH B;  4D0T A;  4Y7F A;  1SS9 A;  4Y9X A;  3Q80 A;  2GGQ A;  1IIN A;  2JCL A;  1EZI A;  2ZU9 A;  1LZJ A;  2XME A;  5CQN X;  1G8O A;  5DDV A;  3I0H A;  1FO9 A;  2FFV A;  4B5B A;  1LL0 A;  2XWL A;  1ZCT A;  2RJ0 A;  4HO8 A;  5CMF X;  3V91 A;  4LW6 A;  3OH2 A;  1NF5 B;  1LL2 A;  1QWJ A;  5C8R A;  4FCE A;  4HO0 A;  1PZT A;  1H4E A;  5C3B A;  1FR9 A;  4CJC A;  1ZJ3 A;  1FO8 A;  3SX3 A;  2V0I A;  1H4C A;  1WT0 A;  4B4G A;  1PZY B;  1K4V A;  1WT2 A;  5FTS A;  3DUV A;  2RIZ A;  2X65 A;  1ZCV A;  4FRP A;  1G3L A;  2AM3 A;  1QG8 A;  5C1H A;  2GGO A;  5AJP A;  4R7P A;  4XWI A;  1TVY A;  1ZJ1 A;  1ZJ0 A;  2O1F A;  1FWY A;  1MC3 A;  3I0K A;  1H7G A;  1FZW A;  1HV9 A;  3OAM A;  2BO8 A;  5CQP A;  3RSB A;  4DDZ A;  1JVD A;  2W0V A;  2Y4K A;  4Y7G A;  3CKQ A;  1NHE B;  3OGZ A;  5CQL X;  1HM9 A;  1O7O A;  3SX8 A;  1H5R A;  3F1Y A;  2AGD A;  1V83 A;  1W57 A;  2AM5 A;  5L6V A;  2D7R A;  1TW5 A;  3D8V A;  5C1L A;  2RIT A;  5FYE A;  4CVH A;  4NAL A;  5JQQ A;  4JD0 A;  2YCM A;  3U2U A;  1ON8 A;  2WGZ A;  2AE7 A;  5FUH A;  4Y7V A;  1GX0 A;  2WE9 A;  4B42 A;  2P72 A;  4FRL A;  2FYC B;  5HS2 A;  4L41 C;  1R82 A;  3SXE A;  1R7U A;  1MP3 A;  1HJJ A;  2YES A;  2BO7 A;  5IFY A;  4YS8 A;  5CMI A;  1S4N A;  2BO6 A;  1WSZ A;  3R3I A;  1R81 A;  1GWW A;  2P6W A;  4D11 C;  1V82 A;  4M4K A;  5C1G A;  4G3Q A;  5C4D A;  4EEA A;  4EEG A;  2OI7 A;  1LVW A;  1HM8 A;  2WVM A;  1FGX A;  1INI A;  1VM8 A;  2I5K A;  2Y4M A;  3FWW A;  4KNX A;  4P02 A;  3ZGF A;  5C4F A;  1OMZ A;  2V0K A;  1H5S A;  1H7E A;  1KWS A;  2NXV A;  2OEG A;  5IDS A;  2RJ6 A;  1LZ0 A;  4O6N A;  1LZI A;  2FYD B;  2XWM A;  2AES A;  1FOA A;  3V0N A;  5EIY A;  1OQM B;  5CMG X;  1QGS A;  1FGG A;  4AAW A;  5C4E A;  5C49 A;  1FR8 A;  2VXM A;  2QGI A;  4KT7 A;  1ZJO A;  4Y64 A;  1ZJ2 A;  2ICY A;  2RJ5 A;  4HO9 A;  4B3U A;  1O0R A;  3SXC A;  1NQI B;  5D92 A;  4MYB A;  1WVC A;  1YP4 A;  4M2A A;  5C48 A;  1HJL A;  4HO4 A;  1V84 A;  1ZI4 A;  4KPX A;  1NMM B;  3U2T A;  4IRQ A;  1JVG A;  2W0W A;  4Y63 A;  1LZ7 A;  1NWG B;  4NAI A;  1JV3 A;  3U2X A;  2FYA A;  5FU0 A;  5CMH A;  3IOI A;  1R7T A;  5C38 A;  5EJ1 A;  5L6S A;  3RMV A;  2DPW A;  4G3P A;  2I7B A;  4GBP A;  4KC1 A;  2Z87 A;  3SX7 A;  2O1G A;  1QGQ A;  1G1L A;  2ICX A;  4Q7C A;  2VSI A;  1GQ9 A;  3I0J A;  3CKV A;  5AJN A;  1VGT A;  2RIX A;  3TZT A;  2D7I A;  3KIA A;  3CU0 A;  5C47 A;  1Z90 A;  5C4C A;  3SXB A;  4M2B A;  4AYL A;  3K8D A;  4CJ8 A;  2PGY A;  3FOQ A;  2FY7 A;  4KXO A;  1ZI3 A;  1O7Q A;  3JTJ A;  4Y7U A;  3POL A;  2YQC A;  1IIM A;  3V0L A;  4FQW A;  5BXC A;  3CGX A;  3E25 A;  4D0Z A;  2E8B A;  3ZF8 A;  3RMW A;  2A8U A;  4HO2 A;  2FFU A;  3DK5 A;  2X60 A;  4FRD A;  2APC A;  4MND A;  2P73 A;  1FXO A;  5C3D A;  5CQO A;  5J49 A;  5CQM X;  2Z86 A;  4KNR A;  3I0E A;  1MP4 A;  4FIY A;  2RJ1 A;  1FRW A;  1VH3 A;  1FG5 N;  3K8E A;  3TQD A;  1VZT A;  1OMX A;  2O1H A;  3DJ4 A;  4EE5 A;  1ZCY A;  3SX5 A;  4CJB A;  1ZCU A;  2WVL A;  1TW1 A;  2Y6P A;  4B4M A;  4IRP A;  2AH9 A;  4FRA A;  2YC3 A;  4EVW A;  2V0L A;  2AM4 A;  1H5T B;  4LW3 A;  1ZDG A;  2ZU7 A;  2VFZ A;  1ZIZ A;  4MIX A;  1G93 A;  3SPT A;  1ZJP A;  2WVK A;  3IOJ A;  3JUJ A;  4HO5 A;  4B2W A;  2WAW A;  2FYB A; 
#chains in the Genus database with same CATH homology
 5C36 A;  5AJO A;  1I52 A;  1TZF A;  3I0C A;  2C0N A;  3NGW A;  1JV1 A;  5FTV A;  4BQH A;  1W77 A;  2YQS A;  1EYR A;  2Q4J A;  3I0D A;  1G95 A;  1HM0 A;  2VD4 A;  3PNN A;  1VGU A;  4FRH A;  1S4P A;  1R7V A;  4KQL A;  1JYL A;  4JIS A;  2I5E A;  3Q7U A;  1G9R A;  4ASY A;  4AYJ A;  1FXJ A;  4EEO A;  4AC3 A;  4FRB A;  2JCO A;  2QKX A;  1H5S D;  2D0J A;  3I0L A;  3V0O A;  4ZDQ A;  3ST8 A;  1S4O A;  2RJ9 A;  1H3M A;  1YRO B;  3LW6 A;  4G3S A;  3U2W A;  4P00 A;  3OH3 A;  1G2V A;  4G87 A;  2VSH A;  3I0I X;  2BO4 A;  4E1K A;  2VS4 A;  4UEG A;  4M28 A;  1ZDF A;  5D91 A;  1G97 A;  3CKJ A;  1H4D A;  3F1C A;  3V8Y A;  1VGW A;  3D5N A;  1H5S C;  1H7T A;  2J0B A;  5IDT A;  3PKP A;  4K6R A;  4FRM A;  4Y6N A;  2OI6 A;  2VK9 A;  1XHB A;  4ARW A;  4D48 A;  3I0F A;  1W55 A;  3V90 A;  3V0Q A;  2JCK A;  3OKR A;  2Y4L A;  4NAN A;  4Y62 A;  2AEC A;  3SXA A;  1VIC A;  4HCQ A;  1LL3 A;  5I1F A;  3R2W A;  4FRE A;  2PGV A;  3GUE A;  4KRV A;  1VH1 A;  3QVB A;  3T7M A;  2RJ4 A;  2X5S A;  1XZ6 A;  3V0M A;  3CKO A;  2CU2 A;  4B2X A;  2OEF A;  3T7O A;  4J18 A;  4KPZ A;  3E26 A;  4Y6U A;  2Y4J A;  2RJ8 A;  3ZLK A;  2RIY A;  3SXG A;  4B4B A;  2VXL A;  3BRK X;  4D11 A;  3JUK A;  4FCU A;  4C2S A;  3IOH A;  1GWV A;  4ECM A;  1JYK A;  5C3A A;  5FV9 A;  2RJ7 A;  1H5R B;  5C4B A;  5CMJ A;  1YP2 A;  2J0A A;  3ZLL A;  2PX7 A;  1MP5 A;  1H7Q A;  2QH5 A;  3V0P A;  2JCJ A;  1H7H A;  1G0R A;  1ZI1 A;  4HO6 A;  3V8Z A;  2X5Z A;  3OH4 A;  4EE3 A;  1R7X A;  2YQH A;  4EEM A;  3Q4S A;  3SXD A;  1ON6 A;  2WEE A;  3BCV A;  1INJ A;  2XWN A;  4FRO A;  1ZHJ A;  3PKQ A;  2PA4 A;  3HL3 A;  4KC4 A;  3U2V A;  2ZU8 A;  4DE7 A;  3OH1 A;  4DEC A;  1O23 B;  4HO3 A;  4FIX A;  1WT1 A;  1ZI5 A;  2V0J A;  3T7N A;  1H5T A;  2MZB A;  3EE5 A;  1WT3 A;  3I0G A;  2YQJ A;  2V0H A;  3OC9 A;  1GA8 A;  3N9W A;  5FU8 A;  3U0Y A;  1VZU A;  2E3D A;  1H5S B;  1H7F A;  4EE4 A;  5EJZ A;  4HG6 A;  3USQ A;  2YC5 A;  4O6M A;  1VZX A;  4FRQ A;  3OH0 A;  1VPA A;  4Y7T A;  1YP3 A;  2XMH A;  1H7L A;  1VGZ A;  3U0X A;  2A8W A;  3ZGG A;  1R7Y A;  4NAK A;  1R80 A;  1GX4 A;  4ASJ A;  2Y7A A;  3O3P A;  4BMA A;  2VS5 A;  1G23 A;  3D98 A;  4HOC A;  5DDT A;  2VS3 A;  1GQC A;  2OI5 A;  1E5K A;  2UX8 A;  4KC2 A;  3USR A;  3CKN A;  1NKH B;  4D0T A;  4Y7F A;  1SS9 A;  4Y9X A;  3Q80 A;  2GGQ A;  1IIN A;  2JCL A;  1EZI A;  2ZU9 A;  1LZJ A;  2XME A;  5CQN X;  1G8O A;  5DDV A;  3I0H A;  1FO9 A;  2FFV A;  4B5B A;  1LL0 A;  2XWL A;  1ZCT A;  2RJ0 A;  4HO8 A;  5CMF X;  3V91 A;  4LW6 A;  3OH2 A;  1NF5 B;  1LL2 A;  1QWJ A;  5C8R A;  4FCE A;  4HO0 A;  1PZT A;  1H4E A;  5C3B A;  1FR9 A;  4CJC A;  1ZJ3 A;  1FO8 A;  3SX3 A;  2V0I A;  1H4C A;  1WT0 A;  4B4G A;  1PZY B;  1K4V A;  1WT2 A;  5FTS A;  3DUV A;  2RIZ A;  2X65 A;  1ZCV A;  4FRP A;  1G3L A;  2AM3 A;  1QG8 A;  5C1H A;  2GGO A;  5AJP A;  4R7P A;  4XWI A;  1TVY A;  1ZJ1 A;  1ZJ0 A;  2O1F A;  1FWY A;  1MC3 A;  3I0K A;  1H7G A;  1FZW A;  1HV9 A;  3OAM A;  2BO8 A;  5CQP A;  3RSB A;  4DDZ A;  1JVD A;  2W0V A;  2Y4K A;  4Y7G A;  3CKQ A;  1NHE B;  3OGZ A;  5CQL X;  1HM9 A;  1O7O A;  3SX8 A;  1H5R A;  3F1Y A;  2AGD A;  1V83 A;  1W57 A;  2AM5 A;  5L6V A;  2D7R A;  1TW5 A;  3D8V A;  5C1L A;  2RIT A;  5FYE A;  4CVH A;  4NAL A;  5JQQ A;  4JD0 A;  2YCM A;  3U2U A;  1ON8 A;  2WGZ A;  2AE7 A;  5FUH A;  4Y7V A;  1GX0 A;  2WE9 A;  4B42 A;  2P72 A;  4FRL A;  2FYC B;  5HS2 A;  4L41 C;  1R82 A;  3SXE A;  1R7U A;  1MP3 A;  1HJJ A;  2YES A;  2BO7 A;  5IFY A;  4YS8 A;  5CMI A;  1S4N A;  2BO6 A;  1WSZ A;  3R3I A;  1R81 A;  1GWW A;  2P6W A;  4D11 C;  1V82 A;  4M4K A;  5C1G A;  4G3Q A;  5C4D A;  4EEA A;  4EEG A;  2OI7 A;  1LVW A;  1HM8 A;  2WVM A;  1FGX A;  1INI A;  1VM8 A;  2I5K A;  2Y4M A;  3FWW A;  4KNX A;  4P02 A;  3ZGF A;  5C4F A;  1OMZ A;  2V0K A;  1H5S A;  1H7E A;  1KWS A;  2NXV A;  2OEG A;  5IDS A;  2RJ6 A;  1LZ0 A;  4O6N A;  1LZI A;  2FYD B;  2XWM A;  2AES A;  1FOA A;  3V0N A;  5EIY A;  1OQM B;  5CMG X;  1QGS A;  1FGG A;  4AAW A;  5C4E A;  5C49 A;  1FR8 A;  2VXM A;  2QGI A;  4KT7 A;  1ZJO A;  4Y64 A;  1ZJ2 A;  2ICY A;  2RJ5 A;  4HO9 A;  4B3U A;  1O0R A;  3SXC A;  1NQI B;  5D92 A;  4MYB A;  1WVC A;  1YP4 A;  4M2A A;  5C48 A;  1HJL A;  4HO4 A;  1V84 A;  1ZI4 A;  4KPX A;  1NMM B;  3U2T A;  4IRQ A;  1JVG A;  2W0W A;  4Y63 A;  1LZ7 A;  1NWG B;  4NAI A;  1JV3 A;  3U2X A;  2FYA A;  5FU0 A;  5CMH A;  3IOI A;  1R7T A;  5C38 A;  5EJ1 A;  5L6S A;  3RMV A;  2DPW A;  4G3P A;  2I7B A;  4GBP A;  4KC1 A;  2Z87 A;  3SX7 A;  2O1G A;  1QGQ A;  1G1L A;  2ICX A;  4Q7C A;  2VSI A;  1GQ9 A;  3I0J A;  3CKV A;  5AJN A;  1VGT A;  2RIX A;  3TZT A;  2D7I A;  3KIA A;  3CU0 A;  5C47 A;  1Z90 A;  5C4C A;  3SXB A;  4M2B A;  4AYL A;  3K8D A;  4CJ8 A;  2PGY A;  3FOQ A;  2FY7 A;  4KXO A;  1ZI3 A;  1O7Q A;  3JTJ A;  4Y7U A;  3POL A;  2YQC A;  1IIM A;  3V0L A;  4FQW A;  5BXC A;  3CGX A;  3E25 A;  4D0Z A;  2E8B A;  3ZF8 A;  3RMW A;  2A8U A;  4HO2 A;  2FFU A;  3DK5 A;  2X60 A;  4FRD A;  2APC A;  4MND A;  2P73 A;  1FXO A;  5C3D A;  5CQO A;  5J49 A;  5CQM X;  2Z86 A;  4KNR A;  3I0E A;  1MP4 A;  4FIY A;  2RJ1 A;  1FRW A;  1VH3 A;  1FG5 N;  3K8E A;  3TQD A;  1VZT A;  1OMX A;  2O1H A;  3DJ4 A;  4EE5 A;  1ZCY A;  3SX5 A;  4CJB A;  1ZCU A;  2WVL A;  1TW1 A;  2Y6P A;  4B4M A;  4IRP A;  2AH9 A;  4FRA A;  2YC3 A;  4EVW A;  2V0L A;  2AM4 A;  1H5T B;  4LW3 A;  1ZDG A;  2ZU7 A;  2VFZ A;  1ZIZ A;  4MIX A;  1G93 A;  3SPT A;  1ZJP A;  2WVK A;  3IOJ A;  3JUJ A;  4HO5 A;  4B2W A;  2WAW A;  2FYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...