1FOAA

Crystal structure of n-acetylglucosaminyltransferase i
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
342
structure length
342
Chain Sequence
AVIPILVIACDRSTVRRCLDKLLHYRPSAELFPIIVSQDCGHEETAQVIASYGSAVTHIRQPDLSNIAVQPDHRKFQGYYKIARHYRWALGQIFHNFNYPAAVVVEDDLEVAPDFFEYFQATYPLLKADPSLWCVSAWNDNGKEQMVDSSKPELLYRTDFFPGLGWLLLAELWAELEPKWPKAFWDDWMRRPEQRKGRACVRPEISRTMTFGRKGVSHGQFFDQHLKFIKLNQQFVPFTQLDLSYLQQEAYDRDFLARVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIVTFLFRGRRVHLAPPQTWDGYDPSWT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ALPHA-1,3-MANNOSYL-GLYCOPROTEIN BETA-1,2-N-ACETYLGLUCOSAMINY
publication title X-ray crystal structure of rabbit N-acetylglucosaminyltransferase I: catalytic mechanism and a new protein superfamily.
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 113
structure length 342
sequence length 342
ec nomenclature ec 2.4.1.101: Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase.
pdb deposition date 2000-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.180.20 Alpha Beta Roll 2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1 N-Acetylglucosaminyltransferase I, Domain 2 1foaA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1foaA01
4CVHA 3U2WA 4D0TA 4D48A 2PGVA 1H5SC 3I0HA 1FXOA 5CQNX 1R7YA 1MP3A 1ZI1A 3DUVA 4P02A 3V0MA 4EEAA 2PGYA 4FRBA 1ZDGA 1TVYA 5C8RA 4P00A 4EVWA 3ZF8A 3V0OA 2X5ZA 4FRPA 2ZU9A 1H3MA 2FYBA 3LW6A 1PZTA 2X65A 1HV9A 1KWSA 1ZJ1A 2CU2A 2XWMA 4FRDA 2XWLA 2OEFA 4G3PA 1S4OA 1I52A 4KRVA 1G93A 1FZWA 2MZBA 4EE5A 2VFZA 4EEOA 1H7EA 1H4DA 1V82A 4Y9XA 1LZ0A 2YQCA 2O1HA 1H5SD 5C1LA 1WT0A 3I0JA 2OI6A 3USRA 1GWWA 4Y62A 2VXMA 4L41C 1ON8A 1G95A 1H5TB 4G87A 1YP2A 3I0LA 2D7RA 1MP4A 2WEEA 4NALA 1ZJ3A 1LVWA 3SXCA 2APCA 4LW3A 3OH4A 2AH9A 3RSBA 3U0XA 4AC3A 2RJ0A 4MNDA 2YC5A 1JYLA 4M2BA 1VZXA 1Z90A 1VGUA 1FO8A 4HO9A 1ZIZA 2XWNA 2P73A 2AECA 1JV1A 1WT1A 4ASJA 5J49A 4DE7A 1W77A 3TZTA 1O23B 1ZI5A 3HL3A 4Y7FA 2Q4JA 1VH1A 1FR8A 3V8ZA 2Y4JA 2AM5A 3IOJA 4KNXA 5CMHA 3CKJA 3DJ4A 1EZIA 1JVGA 2BO4A 2JCKA 4KC2A 2AE7A 1JVDA 1ZHJA 1MC3A 1QGQA 5C49A 5CQLX 5FV9A 1R7UA 2WVKA 4DDZA 3PKQA 4Y7VA 3E25A 4M28A 2AESA 3SX5A 1HM9A 3V0LA 1NWGB 3SXDA 3OGZA 2D7IA 2A8UA 3V91A 2YESA 2RJ9A 3SX8A 1FR9A 2E3DA 5FU0A 1H7TA 1W57A 3T7OA 3ST8A 1FO9A 4KPXA 1XZ6A 1MP5A 2DPWA 2V0HA 4KQLA 1YP4A 3BRKX 2ZU8A 3POLA 4AYLA 4DECA 4E1KA 1G1LA 4K6RA 3CGXA 5C4CA 2RJ4A 1TW5A 1H5TA 5CQOA 3ZLLA 4HO0A 2FYDB 1WSZA 3CKQA 5IDTA 3T7MA 3SXEA 5C4FA 4D11C 4FRQA 2ICXA 1H7QA 4JD0A 1LZIA 3OKRA 5AJPA 3SX3A 4J18A 2RITA 5EIYA 3SXAA 4BMAA 2Y4KA 2V0KA 1OMZA 1INIA 3I0FA 3D8VA 4B5BA 4Y6UA 1NMMB 4B3UA 1ZCUA 3F1YA 3R3IA 3ZGFA 2BO8A 1H4CA 1OQMB 3PKPA 2FYAA 1FOAA 2GGOA 1H7LA 1OMXA 1H5SB 2AGDA 3I0IX 2WVLA 2I5KA 5C4EA 2PX7A 5C47A 1QWJA 3O3PA 4IRQA 5AJOA 5CMIA 1VH3A 1NQIB 2E8BA 2X60A 4FROA 1YP3A 2RIYA 3E26A 1H4EA 1LZ7A 4EEGA 1H5RB 3OH1A 2NXVA 1LL3A 3TQDA 2A8WA 2O1FA 2GGQA 2Y7AA 1G9RA 5CQMX 3OAMA 3D98A 5BXCA 4B42A 3SXBA 5C1GA 1EYRA 4Y7TA 4HO8A 1WVCA 1FG5N 5C1HA 1ZCYA 4NAKA 3PNNA 4GBPA 1ZCTA 5CMGX 1S4NA 3I0GA 1V83A 2VSIA 4FRAA 2RIZA 2V0LA 1G3LA 4HO4A 5CMFX 1NF5B 4FREA 1O0RA 1S4PA 4ECMA 1O7OA 4JISA 5DDVA 2YCMA 5IFYA 4D0ZA 1QGSA 3D5NA 5C36A 1G97A 2BO7A 2AM3A 3RMWA 2AM4A 3ZGGA 5L6SA 1ZCVA 4NANA 5FTVA 3CKVA 4D11A 1E5KA 3DK5A 3IOHA 1JV3A 2YQJA 4MYBA 1H5SA 5EJ1A 3F1CA 1GX4A 3R2WA 4KC1A 3I0EA 3QVBA 4FCUA 3V8YA 5C3BA 1ZJ2A 3USQA 1VZTA 4M2AA 2D0JA 4HO6A 3U2VA 1HJJA 4KPZA 1R82A 4Y6NA 2JCLA 1H5RA 3U0YA 1ZJ0A 2X5SA 5JQQA 4B2XA 5FU8A 5C3DA 4Y7GA 1QG8A 3V0PA 4HO2A 3U2TA 1INJA 3N9WA 5DDTA 1VGWA 4FRMA 3RMVA 3FOQA 1G8OA 4M4KA 1GQ9A 5C4DA 3IOIA 2WVMA 1VICA 1YROB 3OH3A 3SXGA 1ZJOA 5AJNA 1NKHB 3JUJA 5CMJA 2QKXA 1R7XA 2OEGA 3SPTA 3V0NA 4B4GA 3CU0A 4KNRA 2V0JA 4R7PA 1FRWA 1GX0A 1TZFA 1G23A 2VXLA 4C2SA 5CQPA 3K8EA 3EE5A 1GWVA 2RJ1A 4HO5A 1PZYB 2P6WA 3Q80A 3ZLKA 2I7BA 2WAWA 3U2UA 1GQCA 1GA8A 4AAWA 4B4BA 3BCVA 1VM8A 2Z86A 2FY7A 1ON6A 5C48A 5FUHA 2PA4A 4Y63A 1HM8A 3CKOA 1VPAA 3T7NA 3Q4SA 4NAIA 4EE4A 2VSHA 1FXJA 2WGZA 1LZJA 4AYJA 4EEMA 4Y7UA 4KT7A 3Q7UA 4FQWA 1NHEB 1ZI4A 2VD4A 4HO3A 4FRLA 2FYCB 2Y6PA 5C4BA 2Y4LA 1H7GA 2VS4A 1K4VA 3JUKA 2QGIA 4FCEA 1SS9A 2JCJA 3V0QA 1VGTA 1G0RA 1HM0A 3JTJA 4HG6A 5FTSA 4CJ8A 5I1FA 3FWWA 2XMHA 2UX8A 3V90A 3I0CA 1H7HA 1TW1A 4UEGA 4FRHA 2RJ8A 2YQSA 1WT2A 5C38A 2ICYA 2FFVA 1R81A 2JCOA 4BQHA 2Y4MA 3K8DA 2BO6A 2Z87A 2O1GA 4LW6A 2WE9A 1ZDFA 4KC4A 1LL0A 1FWYA 1V84A 1ZI3A 1VZUA 2VS3A 2YC3A 1FGGA 1O7QA 1ZJPA 1LL2A 4KXOA 4ZDQA 2RIXA 1HJLA 1R80A 2FFUA 2QH5A 2RJ6A 4CJBA 1WT3A 4G3SA 3I0KA 1XHBA 3KIAA 4HOCA 1IINA 2OI5A 5EJZA 2P72A 3NGWA 3U2XA 2ZU7A 3OH2A 4B2WA 5FYEA 1IIMA 2RJ7A 5IDSA 2I5EA 1R7VA 1G2VA 1R7TA 3CKNA 4XWIA 5HS2A 2OI7A 2XMEA 4G3QA 1JYKA 4IRPA 1W55A 2RJ5A 3OC9A 4HCQA 2W0WA 1H7FA 1FGXA 1VGZA 3SX7A 2YQHA 4YS8A 4EE3A 3GUEA 5C3AA 4B4MA 5L6VA 2VS5A 3OH0A 4ASYA 4CJCA 3I0DA 2W0VA 4Y64A 4ARWA 2V0IA
chains in the Genus database with same CATH superfamily
4CVHA 3U2WA 4D0TA 4D48A 2PGVA 1H5SC 3I0HA 1KNFA 3HUHA 1FXOA 5CB9A 5CQNX 1R7YA 2WL9A 1TSJA 1MP3A 1ZI1A 3DUVA 4P02A 3V0MA 4EEAA 2PGYA 4FRBA 1ZDGA 3R6AA 5DHWA 1TVYA 2EI2A 5C8RA 4P00A 4EVWA 3ZF8A 3PKXA 3V0OA 2X5ZA 4FRPA 2ZU9A 1H3MA 2FYBA 3LW6A 4MTRA 1PZTA 2X65A 1HV9A 1KWSA 1ZJ1A 1SQIA 3RRIA 2CU2A 2XWMA 4FRDA 2XWLA 2OEFA 4G3PA 1S4OA 1Q0OA 1I52A 4GHFA 4KRVA 3R4QA 1G93A 1FZWA 2MZBA 4EE5A 2VFZA 4EEOA 1H7EA 1H4DA 1LGTA 1V82A 4Y9XA 5KEFA 1LZ0A 5DRHA 2ZW7A 2YQCA 2O1HA 1H5SD 3KOLA 5C1LA 1WT0A 2QQZA 3I0JA 2OI6A 3USRA 1GWWA 4Y62A 1F1XA 4HC5A 2VXMA 4JH6A 5DFGA 1G95A 1H5TB 2ZHPA 1ON8A 4G87A 4L41C 1YP2A 3I0LA 2D7RA 1MP4A 2WEEA 4NALA 4JH5A 1U6LA 1LVWA 1ZJ3A 4FIXA 3SXCA 2P7QA 5CTOA 2APCA 4LW3A 3OH4A 2AH9A 4MTSA 3RSBA 3U0XA 4Z6MA 1KW6B 4Z6VA 4AC3A 2RJ0A 1JIFA 4MNDA 2YC5A 2EI0A 1JYLA 4M2BA 1VZXA 4OPNA 1Z90A 3W0TA 1VGUA 1FO8A 4HO9A 1ZIZA 2XWNA 2P73A 2AECA 1JV1A 4JH9A 1WT1A 4ASJA 5J49A 4DE7A 1W77A 3TZTA 1O23B 1ZI5A 3HL3A 4Y7FA 2Q4JA 1VH1A 1FR8A 3V8ZA 2Y4JA 2AM5A 1KW9B 4LQBA 3IOJA 4KNXA 5CMHA 4FIYA 1FA5A 1JC4A 3CKJA 3DJ4A 1EZIA 1JVGA 2BO4A 2JCKA 4KC2A 2AE7A 1JVDA 1ZHJA 1MC3A 1QGQA 1QINA 5C49A 5CQLX 5FV9A 1R7UA 2WVKA 4DDZA 1JIEA 3PKQA 4Y7VA 3E25A 4M28A 2AESA 1FA6A 5BWGA 3SX5A 1HM9A 3V0LA 1NWGB 1TFZA 3SXDA 3LM4A 3OGZA 2D7IA 2A8UA 2RK9A 3V91A 1F1VA 2YESA 3ECKA 2RJ9A 3SX8A 3E0RA 1FR9A 2E3DA 4Z6WA 5FU0A 1H7TA 1W57A 3T7OA 3ST8A 1FO9A 4KPXA 1XZ6A 4GYMA 3W0UA 1MP5A 2DPWA 2V0HA 4KQLA 1Q0CA 1YP4A 3BRKX 2ZU8A 1TG5A 3CT8A 3HQ0A 4NVSA 3POLA 4AYLA 4DECA 4E1KA 1G1LA 4K6RA 3CGXA 4NB2A 5C4CA 2RJ4A 1TW5A 1H5TA 3HPYA 5CQOA 3ZLLA 1F1RA 4HO0A 2FYDB 1WSZA 3OJJA 3BZAA 3CKQA 3T7MA 5IDTA 3SXEA 2ZW4A 4Q7CA 5C4FA 4D11C 4FRQA 2ICXA 1BH5A 3ISQA 1H7QA 4JD0A 1LZIA 3OKRA 1ZSWA 3RMUA 5D7ZA 4J18A 5C68A 2RITA 5AJPA 3SX3A 3ZW5A 3OJKA 5EIYA 3SXAA 1FROA 4BMAA 2Y4KA 1SP8A 4MIXA 2V0KA 1OMZA 1INIA 3I0FA 3D8VA 4B5BA 3LHOA 4Y6UA 3SK2A 1NMMB 4B3UA 1ZCUA 3F1YA 3R3IA 3ZGFA 2BO8A 1QIPA 1H4CA 2P7LA 1OQMB 3PKPA 1FA8A 2FYAA 1FOAA 1H7LA 1OMXA 1F1UA 1H5SB 2AGDA 2GGOA 3HNQA 2EHZA 2WVLA 3I0IX 2I5KA 5C4EA 2PX7A 5C47A 4Z6ZA 1QWJA 4O6MA 3O3PA 4NB1A 4IRQA 5AJOA 5CMIA 1VH3A 1NQIB 1KMYA 2E8BA 1CJXA 2X60A 4FROA 1SQDA 1YP3A 2RIYA 3E26A 1H4EA 1LZ7A 4EEGA 1H5RB 3OH1A 1ECSA 1LL3A 2NXVA 3TQDA 2A8WA 2O1FA 2GGQA 2Y7AA 1G9RA 5CQMX 5CJ3A 3OAMA 4N04A 4JD1A 3D98A 1JC5A 5BXCA 4B42A 3ECJA 5C4PA 4JH7A 3SXBA 5C1GA 1EYRA 4Y7TA 4HO8A 1WVCA 3VW9A 1FG5N 5C1HA 1ZCYA 4NAKA 3PNNA 4GBPA 1KNDA 1ZCTA 5CMGX 3FCDA 1S4NA 3OPYB 3I0GA 1V83A 2VSIA 4FRAA 2RIZA 2V0LA 1G3LA 4HO4A 5CMFX 1NF5B 4FREA 5D4FA 1O0RA 1S4PA 1BYLA 1O7OA 1QTOA 3ZGJA 4JISA 5DDVA 4ECMA 2YCMA 2I7RA 3EY8A 5IFYA 5HCWA 4D0ZA 1KW8B 4GHCA 4Z6SA 1QGSA 3D5NA 5C36A 1G97A 2BO7A 2AM3A 3RMWA 2AM4A 4Z6QA 3ZGGA 5L6SA 4GHHA 1ZCVA 4NANA 5FTVA 3CKVA 4D11A 1E5KA 3DK5A 3IOHA 1JV3A 2YQJA 4Z6TA 1LQOA 1EWJA 4MYBA 1H5SA 5EJ1A 3F1CA 1GX4A 3R2WA 1EIRA 1NPBA 4KC1A 3I0EA 3QVBA 4FCUA 3V8YA 5C3BA 1ZJ2A 3USQA 2P7KA 1VZTA 4M2AA 2D0JA 4HO6A 3U2VA 1HJJA 3OXHA 1R82A 4Z6RA 1EILA 4KPZA 4Y6NA 2C21A 2Q48A 1H5RA 2JCLA 3U0YA 4JH2A 1ZJ0A 2X5SA 4KYKA 4B2XA 5JQQA 4Z6NA 5FU8A 5C3DA 4Y7GA 1TWUA 4NAZA 1LQPA 1F9ZA 1QG8A 1MPYA 4MTTA 3V0PA 1NIQB 4PV5A 4HO2A 3U2TA 3L7TA 3RHEA 1INJA 3B59A 2ZYQA 3N9WA 4IAGA 1U69A 5DDTA 2ZW5A 1VGWA 4FRMA 5F6QA 2PJSA 3RMVA 3FOQA 1G8OA 4M4KA 2P7PA 4X2AA 1GQ9A 3OPYA 2ZI8A 5C4DA 3IOIA 2QH0A 2QNTA 2WVMA 1VICA 1YROB 3GHJA 3OH3A 3SXGA 3OJNA 1ZJOA 5AJNA 1NKHB 4MYMA 3GM5A 3JUJA 4NAYA 5CMJA 2QKXA 1R7XA 4GHEA 2OEGA 3SPTA 3V0NA 2RK0A 4B4GA 3CU0A 4KNRA 2V0JA 4R7PA 1FRWA 1GX0A 1TZFA 1G23A 2VXLA 4C2SA 1T47A 3OULA 5CQPA 1DHYA 1XY7A 3K8EA 3EE5A 4Z6PA 1GWVA 2RJ1A 1FA7A 3OJTA 4HO5A 5D91A 3G12A 1PZYB 2WL3A 2P6WA 5BWHA 3HDPA 3Q80A 3ZLKA 2I7BA 3IUZA 2WAWA 3U2UA 1GQCA 1GA8A 3L20A 4AAWA 3BCVA 1VM8A 2Z86A 2R5VA 4B4BA 2C0NA 1HANA 1ON6A 2FY7A 5C48A 5FUHA 4G6XA 4IR0A 2PA4A 1HM8A 3CKOA 3PKWA 1VPAA 4Y63A 3T7NA 2EI1A 4MTQA 3Q4SA 4NAIA 4EE4A 2R6UA 2VSHA 4JH8A 3OA4A 1FXJA 2WGZA 1LZJA 4AYJA 4EEMA 4JH1A 4Y7UA 1XRKA 4KT7A 2J0AA 3OAJA 3Q7UA 4GHGA 1R9CA 4FQWA 1NHEB 1ZI4A 2VD4A 4HO3A 1KMZA 3P8AA 4FRLA 2FYCB 2Y6PA 5C4BA 2Y4LA 1KLLA 3EY7A 1H7GA 2VS4A 1K4VA 4JH3A 3JUKA 2QGIA 4FCEA 4Z6OA 1SS9A 3E5DA 2JCJA 4PAVA 3V0QA 1SS4A 4Z6UA 1VGTA 1G0RA 4O6NA 1HM0A 3JTJA 4HG6A 5FTSA 4CJ8A 1EIQA 5I1FA 3FWWA 2XMHA 2UX8A 3V90A 3I0CA 2ZW6A 1H7HA 1TW1A 4KYHA 4UEGA 1K4NA 4FRHA 3HPVA 2RJ8A 2YQSA 2RJBA 3OUMA 1WT2A 5C38A 4Z6LA 2ICYA 2FFVA 1R81A 2JCOA 4BQHA 2Y4MA 4QB5A 2IG9A 3K8DA 3PKVA 2VK9A 2BO6A 2IGAA 2Z87A 1LKDA 2O1GA 2P7MA 1KWBB 4LW6A 2WE9A 5D92A 1ZDFA 4KC4A 1LL0A 4NB0A 1FWYA 1V84A 1ZI3A 1VZUA 2VS3A 2YC3A 1FGGA 2ZA0A 2J0BA 1O7QA 1XQAA 1LL2A 1ZJPA 4KXOA 1LQKA 4ZDQA 2RIXA 1HJLA 1R80A 2FFUA 2QH5A 2RJ6A 4CJBA 1WT3A 2EI3A 4G3SA 3I0KA 1XHBA 1MH6A 2P7OA 3KIAA 4HOCA 1IINA 2OI5A 5EJZA 2P72A 3NGWA 3U2XA 4JH4A 3BQXA 2ZU7A 3OH2A 4B2WA 2RBBA 5FYEA 1IIMA 2RJ7A 5IDSA 2I5EA 4HUZA 1R7VA 2P25A 1G2VA 1R7TA 3CKNA 1NKIA 3ZI1A 4XWIA 5HS2A 2OI7A 2XMEA 1KWCB 2A4WA 4G3QA 1JYKA 4IRPA 1NNRA 3VB0A 1W55A 2RJ5A 3OC9A 4HCQA 2W0WA 1H7FA 1FGXA 1VGZA 4Z04A 2YQHA 3SX7A 4GHDA 1SP9A 4YS8A 5EC3A 1KW3B 4EE3A 2A4XA 3GUEA 5C3AA 4B4MA 5C6XA 5L6VA 2VS5A 3OH0A 4ASYA 4CJCA 3I0DA 2W0VA 4Y64A 4ARWA 4RT5A 2V0IA
chains in the Genus database with same CATH topology
4CVHA 3U2WA 4D0TA 4D48A 2PGVA 1H5SC 3I0HA 1FXOA 5CQNX 1R7YA 1MP3A 1ZI1A 3DUVA 4P02A 3V0MA 4EEAA 2PGYA 4FRBA 1ZDGA 1TVYA 5C8RA 4P00A 4EVWA 3ZF8A 3V0OA 2X5ZA 4FRPA 2ZU9A 1H3MA 2FYBA 3LW6A 1PZTA 2X65A 1HV9A 1KWSA 1ZJ1A 2CU2A 2XWMA 4FRDA 2XWLA 2OEFA 4G3PA 1S4OA 1I52A 4KRVA 1G93A 1FZWA 2MZBA 4EE5A 2VFZA 4EEOA 1H7EA 1H4DA 1V82A 4Y9XA 1LZ0A 2YQCA 2O1HA 1H5SD 5C1LA 1WT0A 3I0JA 2OI6A 3USRA 1GWWA 4Y62A 2VXMA 4L41C 1ON8A 1G95A 1H5TB 4G87A 1YP2A 3I0LA 2D7RA 1MP4A 2WEEA 4NALA 1ZJ3A 1LVWA 4FIXA 3SXCA 2APCA 4LW3A 3OH4A 2AH9A 3RSBA 3U0XA 4AC3A 2RJ0A 4MNDA 2YC5A 1JYLA 4M2BA 1VZXA 1Z90A 1VGUA 1FO8A 4HO9A 1ZIZA 2XWNA 2P73A 2AECA 1JV1A 1WT1A 4ASJA 5J49A 4DE7A 1W77A 3TZTA 1O23B 1ZI5A 3HL3A 4Y7FA 2Q4JA 1VH1A 1FR8A 3V8ZA 2Y4JA 2AM5A 3IOJA 4KNXA 5CMHA 4FIYA 3CKJA 3DJ4A 1EZIA 1JVGA 2BO4A 2JCKA 4KC2A 2AE7A 1JVDA 1ZHJA 1MC3A 1QGQA 5C49A 5CQLX 5FV9A 1R7UA 2WVKA 4DDZA 3PKQA 4Y7VA 3E25A 4M28A 2AESA 3SX5A 1HM9A 3V0LA 1NWGB 3SXDA 3OGZA 2D7IA 2A8UA 3V91A 2YESA 2RJ9A 3SX8A 1FR9A 2E3DA 5FU0A 1H7TA 1W57A 3T7OA 3ST8A 1FO9A 4KPXA 1XZ6A 1MP5A 2DPWA 2V0HA 4KQLA 1YP4A 3BRKX 2ZU8A 3POLA 4AYLA 4DECA 4E1KA 1G1LA 4K6RA 3CGXA 5C4CA 2RJ4A 1TW5A 1H5TA 5CQOA 3ZLLA 4HO0A 2FYDB 1WSZA 3CKQA 5IDTA 3T7MA 3SXEA 5C4FA 4Q7CA 4D11C 4FRQA 2ICXA 1H7QA 4JD0A 1LZIA 3OKRA 5AJPA 3SX3A 4J18A 2RITA 5EIYA 3SXAA 4BMAA 2Y4KA 4MIXA 2V0KA 1OMZA 1INIA 3I0FA 3D8VA 4B5BA 4Y6UA 1NMMB 4B3UA 1ZCUA 3F1YA 3R3IA 3ZGFA 2BO8A 1H4CA 1OQMB 3PKPA 2FYAA 1FOAA 2GGOA 1H7LA 1OMXA 1H5SB 2AGDA 3I0IX 2WVLA 2I5KA 5C4EA 2PX7A 5C47A 1QWJA 4O6MA 3O3PA 4IRQA 5AJOA 5CMIA 1VH3A 1NQIB 2E8BA 2X60A 4FROA 1YP3A 2RIYA 3E26A 1H4EA 1LZ7A 4EEGA 1H5RB 3OH1A 2NXVA 1LL3A 3TQDA 2A8WA 2O1FA 2GGQA 2Y7AA 1G9RA 5CQMX 3OAMA 3D98A 5BXCA 4B42A 3SXBA 5C1GA 1EYRA 4Y7TA 4HO8A 1WVCA 1FG5N 5C1HA 1ZCYA 4NAKA 3PNNA 4GBPA 1ZCTA 5CMGX 1S4NA 3I0GA 1V83A 2VSIA 4FRAA 2RIZA 2V0LA 1G3LA 4HO4A 5CMFX 1NF5B 4FREA 1O0RA 1S4PA 4ECMA 1O7OA 4JISA 5DDVA 2YCMA 5IFYA 4D0ZA 1QGSA 3D5NA 5C36A 1G97A 2BO7A 2AM3A 3RMWA 2AM4A 3ZGGA 5L6SA 1ZCVA 4NANA 5FTVA 3CKVA 4D11A 1E5KA 3DK5A 3IOHA 1JV3A 2YQJA 4MYBA 1H5SA 5EJ1A 3F1CA 1GX4A 3R2WA 4KC1A 3I0EA 3QVBA 4FCUA 3V8YA 5C3BA 1ZJ2A 3USQA 1VZTA 4M2AA 2D0JA 4HO6A 3U2VA 1HJJA 4KPZA 1R82A 4Y6NA 2JCLA 1H5RA 3U0YA 1ZJ0A 2X5SA 5JQQA 4B2XA 5FU8A 5C3DA 4Y7GA 1QG8A 3V0PA 4HO2A 3U2TA 1INJA 3N9WA 5DDTA 1VGWA 4FRMA 3RMVA 3FOQA 1G8OA 4M4KA 1GQ9A 5C4DA 3IOIA 2WVMA 1VICA 1YROB 3OH3A 3SXGA 1ZJOA 5AJNA 1NKHB 3JUJA 5CMJA 2QKXA 1R7XA 2OEGA 3SPTA 3V0NA 4B4GA 3CU0A 4KNRA 2V0JA 4R7PA 1FRWA 1GX0A 1TZFA 1G23A 2VXLA 4C2SA 5CQPA 3K8EA 3EE5A 1GWVA 2RJ1A 4HO5A 5D91A 1PZYB 2P6WA 3Q80A 3ZLKA 2I7BA 2WAWA 3U2UA 1GQCA 1GA8A 4AAWA 4B4BA 3BCVA 1VM8A 2Z86A 2C0NA 2FY7A 1ON6A 5C48A 5FUHA 2PA4A 4Y63A 1HM8A 3CKOA 1VPAA 3T7NA 3Q4SA 4NAIA 4EE4A 2VSHA 1FXJA 2WGZA 1LZJA 4AYJA 4EEMA 4Y7UA 4KT7A 2J0AA 3Q7UA 4FQWA 1NHEB 1ZI4A 2VD4A 4HO3A 4FRLA 2FYCB 2Y6PA 5C4BA 2Y4LA 1H7GA 2VS4A 1K4VA 3JUKA 2QGIA 4FCEA 1SS9A 2JCJA 3V0QA 1VGTA 1G0RA 4O6NA 1HM0A 3JTJA 4HG6A 5FTSA 4CJ8A 5I1FA 3FWWA 2XMHA 2UX8A 3V90A 3I0CA 1H7HA 1TW1A 4UEGA 4FRHA 2RJ8A 2YQSA 1WT2A 5C38A 2ICYA 2FFVA 1R81A 2JCOA 4BQHA 2Y4MA 3K8DA 2VK9A 2BO6A 2Z87A 2O1GA 4LW6A 2WE9A 5D92A 1ZDFA 4KC4A 1LL0A 1FWYA 1V84A 1ZI3A 1VZUA 2VS3A 2YC3A 1FGGA 2J0BA 1O7QA 1ZJPA 1LL2A 4KXOA 4ZDQA 2RIXA 1HJLA 1R80A 2FFUA 2QH5A 2RJ6A 4CJBA 1WT3A 4G3SA 3I0KA 1XHBA 3KIAA 4HOCA 1IINA 2OI5A 5EJZA 2P72A 3NGWA 3U2XA 2ZU7A 3OH2A 4B2WA 5FYEA 1IIMA 2RJ7A 5IDSA 2I5EA 1R7VA 1G2VA 1R7TA 3CKNA 4XWIA 5HS2A 2OI7A 2XMEA 4G3QA 1JYKA 4IRPA 1W55A 2RJ5A 3OC9A 4HCQA 2W0WA 1H7FA 1FGXA 1VGZA 3SX7A 2YQHA 4YS8A 4EE3A 3GUEA 5C3AA 4B4MA 5L6VA 2VS5A 3OH0A 4ASYA 4CJCA 3I0DA 2W0VA 4Y64A 4ARWA 2V0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CVH A;  3U2W A;  4D0T A;  4D48 A;  2PGV A;  1H5S C;  3I0H A;  1FXO A;  5CQN X;  1R7Y A;  1MP3 A;  1ZI1 A;  3DUV A;  4P02 A;  3V0M A;  4EEA A;  2PGY A;  4FRB A;  1ZDG A;  1TVY A;  5C8R A;  4P00 A;  4EVW A;  3ZF8 A;  3V0O A;  2X5Z A;  4FRP A;  2ZU9 A;  1H3M A;  2FYB A;  3LW6 A;  1PZT A;  2X65 A;  1HV9 A;  1KWS A;  1ZJ1 A;  2CU2 A;  2XWM A;  4FRD A;  2XWL A;  2OEF A;  4G3P A;  1S4O A;  1I52 A;  4KRV A;  1G93 A;  1FZW A;  2MZB A;  4EE5 A;  2VFZ A;  4EEO A;  1H7E A;  1H4D A;  1V82 A;  4Y9X A;  1LZ0 A;  2YQC A;  2O1H A;  1H5S D;  5C1L A;  1WT0 A;  3I0J A;  2OI6 A;  3USR A;  1GWW A;  4Y62 A;  2VXM A;  4L41 C;  1ON8 A;  1G95 A;  1H5T B;  4G87 A;  1YP2 A;  3I0L A;  2D7R A;  1MP4 A;  2WEE A;  4NAL A;  1ZJ3 A;  1LVW A;  3SXC A;  2APC A;  4LW3 A;  3OH4 A;  2AH9 A;  3RSB A;  3U0X A;  4AC3 A;  2RJ0 A;  4MND A;  2YC5 A;  1JYL A;  4M2B A;  1VZX A;  1Z90 A;  1VGU A;  1FO8 A;  4HO9 A;  1ZIZ A;  2XWN A;  2P73 A;  2AEC A;  1JV1 A;  1WT1 A;  4ASJ A;  5J49 A;  4DE7 A;  1W77 A;  3TZT A;  1O23 B;  1ZI5 A;  3HL3 A;  4Y7F A;  2Q4J A;  1VH1 A;  1FR8 A;  3V8Z A;  2Y4J A;  2AM5 A;  3IOJ A;  4KNX A;  5CMH A;  3CKJ A;  3DJ4 A;  1EZI A;  1JVG A;  2BO4 A;  2JCK A;  4KC2 A;  2AE7 A;  1JVD A;  1ZHJ A;  1MC3 A;  1QGQ A;  5C49 A;  5CQL X;  5FV9 A;  1R7U A;  2WVK A;  4DDZ A;  3PKQ A;  4Y7V A;  3E25 A;  4M28 A;  2AES A;  3SX5 A;  1HM9 A;  3V0L A;  1NWG B;  3SXD A;  3OGZ A;  2D7I A;  2A8U A;  3V91 A;  2YES A;  2RJ9 A;  3SX8 A;  1FR9 A;  2E3D A;  5FU0 A;  1H7T A;  1W57 A;  3T7O A;  3ST8 A;  1FO9 A;  4KPX A;  1XZ6 A;  1MP5 A;  2DPW A;  2V0H A;  4KQL A;  1YP4 A;  3BRK X;  2ZU8 A;  3POL A;  4AYL A;  4DEC A;  4E1K A;  1G1L A;  4K6R A;  3CGX A;  5C4C A;  2RJ4 A;  1TW5 A;  1H5T A;  5CQO A;  3ZLL A;  4HO0 A;  2FYD B;  1WSZ A;  3CKQ A;  5IDT A;  3T7M A;  3SXE A;  5C4F A;  4D11 C;  4FRQ A;  2ICX A;  1H7Q A;  4JD0 A;  1LZI A;  3OKR A;  5AJP A;  3SX3 A;  4J18 A;  2RIT A;  5EIY A;  3SXA A;  4BMA A;  2Y4K A;  2V0K A;  1OMZ A;  1INI A;  3I0F A;  3D8V A;  4B5B A;  4Y6U A;  1NMM B;  4B3U A;  1ZCU A;  3F1Y A;  3R3I A;  3ZGF A;  2BO8 A;  1H4C A;  1OQM B;  3PKP A;  2FYA A;  1FOA A;  2GGO A;  1H7L A;  1OMX A;  1H5S B;  2AGD A;  3I0I X;  2WVL A;  2I5K A;  5C4E A;  2PX7 A;  5C47 A;  1QWJ A;  3O3P A;  4IRQ A;  5AJO A;  5CMI A;  1VH3 A;  1NQI B;  2E8B A;  2X60 A;  4FRO A;  1YP3 A;  2RIY A;  3E26 A;  1H4E A;  1LZ7 A;  4EEG A;  1H5R B;  3OH1 A;  2NXV A;  1LL3 A;  3TQD A;  2A8W A;  2O1F A;  2GGQ A;  2Y7A A;  1G9R A;  5CQM X;  3OAM A;  3D98 A;  5BXC A;  4B42 A;  3SXB A;  5C1G A;  1EYR A;  4Y7T A;  4HO8 A;  1WVC A;  1FG5 N;  5C1H A;  1ZCY A;  4NAK A;  3PNN A;  4GBP A;  1ZCT A;  5CMG X;  1S4N A;  3I0G A;  1V83 A;  2VSI A;  4FRA A;  2RIZ A;  2V0L A;  1G3L A;  4HO4 A;  5CMF X;  1NF5 B;  4FRE A;  1O0R A;  1S4P A;  4ECM A;  1O7O A;  4JIS A;  5DDV A;  2YCM A;  5IFY A;  4D0Z A;  1QGS A;  3D5N A;  5C36 A;  1G97 A;  2BO7 A;  2AM3 A;  3RMW A;  2AM4 A;  3ZGG A;  5L6S A;  1ZCV A;  4NAN A;  5FTV A;  3CKV A;  4D11 A;  1E5K A;  3DK5 A;  3IOH A;  1JV3 A;  2YQJ A;  4MYB A;  1H5S A;  5EJ1 A;  3F1C A;  1GX4 A;  3R2W A;  4KC1 A;  3I0E A;  3QVB A;  4FCU A;  3V8Y A;  5C3B A;  1ZJ2 A;  3USQ A;  1VZT A;  4M2A A;  2D0J A;  4HO6 A;  3U2V A;  1HJJ A;  4KPZ A;  1R82 A;  4Y6N A;  2JCL A;  1H5R A;  3U0Y A;  1ZJ0 A;  2X5S A;  5JQQ A;  4B2X A;  5FU8 A;  5C3D A;  4Y7G A;  1QG8 A;  3V0P A;  4HO2 A;  3U2T A;  1INJ A;  3N9W A;  5DDT A;  1VGW A;  4FRM A;  3RMV A;  3FOQ A;  1G8O A;  4M4K A;  1GQ9 A;  5C4D A;  3IOI A;  2WVM A;  1VIC A;  1YRO B;  3OH3 A;  3SXG A;  1ZJO A;  5AJN A;  1NKH B;  3JUJ A;  5CMJ A;  2QKX A;  1R7X A;  2OEG A;  3SPT A;  3V0N A;  4B4G A;  3CU0 A;  4KNR A;  2V0J A;  4R7P A;  1FRW A;  1GX0 A;  1TZF A;  1G23 A;  2VXL A;  4C2S A;  5CQP A;  3K8E A;  3EE5 A;  1GWV A;  2RJ1 A;  4HO5 A;  1PZY B;  2P6W A;  3Q80 A;  3ZLK A;  2I7B A;  2WAW A;  3U2U A;  1GQC A;  1GA8 A;  4AAW A;  4B4B A;  3BCV A;  1VM8 A;  2Z86 A;  2FY7 A;  1ON6 A;  5C48 A;  5FUH A;  2PA4 A;  4Y63 A;  1HM8 A;  3CKO A;  1VPA A;  3T7N A;  3Q4S A;  4NAI A;  4EE4 A;  2VSH A;  1FXJ A;  2WGZ A;  1LZJ A;  4AYJ A;  4EEM A;  4Y7U A;  4KT7 A;  3Q7U A;  4FQW A;  1NHE B;  1ZI4 A;  2VD4 A;  4HO3 A;  4FRL A;  2FYC B;  2Y6P A;  5C4B A;  2Y4L A;  1H7G A;  2VS4 A;  1K4V A;  3JUK A;  2QGI A;  4FCE A;  1SS9 A;  2JCJ A;  3V0Q A;  1VGT A;  1G0R A;  1HM0 A;  3JTJ A;  4HG6 A;  5FTS A;  4CJ8 A;  5I1F A;  3FWW A;  2XMH A;  2UX8 A;  3V90 A;  3I0C A;  1H7H A;  1TW1 A;  4UEG A;  4FRH A;  2RJ8 A;  2YQS A;  1WT2 A;  5C38 A;  2ICY A;  2FFV A;  1R81 A;  2JCO A;  4BQH A;  2Y4M A;  3K8D A;  2BO6 A;  2Z87 A;  2O1G A;  4LW6 A;  2WE9 A;  1ZDF A;  4KC4 A;  1LL0 A;  1FWY A;  1V84 A;  1ZI3 A;  1VZU A;  2VS3 A;  2YC3 A;  1FGG A;  1O7Q A;  1ZJP A;  1LL2 A;  4KXO A;  4ZDQ A;  2RIX A;  1HJL A;  1R80 A;  2FFU A;  2QH5 A;  2RJ6 A;  4CJB A;  1WT3 A;  4G3S A;  3I0K A;  1XHB A;  3KIA A;  4HOC A;  1IIN A;  2OI5 A;  5EJZ A;  2P72 A;  3NGW A;  3U2X A;  2ZU7 A;  3OH2 A;  4B2W A;  5FYE A;  1IIM A;  2RJ7 A;  5IDS A;  2I5E A;  1R7V A;  1G2V A;  1R7T A;  3CKN A;  4XWI A;  5HS2 A;  2OI7 A;  2XME A;  4G3Q A;  1JYK A;  4IRP A;  1W55 A;  2RJ5 A;  3OC9 A;  4HCQ A;  2W0W A;  1H7F A;  1FGX A;  1VGZ A;  3SX7 A;  2YQH A;  4YS8 A;  4EE3 A;  3GUE A;  5C3A A;  4B4M A;  5L6V A;  2VS5 A;  3OH0 A;  4ASY A;  4CJC A;  3I0D A;  2W0V A;  4Y64 A;  4ARW A;  2V0I A; 
#chains in the Genus database with same CATH topology
 4CVH A;  3U2W A;  4D0T A;  4D48 A;  2PGV A;  1H5S C;  3I0H A;  1KNF A;  3HUH A;  1FXO A;  5CB9 A;  5CQN X;  1R7Y A;  2WL9 A;  1TSJ A;  1MP3 A;  1ZI1 A;  3DUV A;  4P02 A;  3V0M A;  4EEA A;  2PGY A;  4FRB A;  1ZDG A;  3R6A A;  5DHW A;  1TVY A;  2EI2 A;  5C8R A;  4P00 A;  4EVW A;  3ZF8 A;  3PKX A;  3V0O A;  2X5Z A;  4FRP A;  2ZU9 A;  1H3M A;  2FYB A;  3LW6 A;  4MTR A;  1PZT A;  2X65 A;  1HV9 A;  1KWS A;  1ZJ1 A;  1SQI A;  3RRI A;  2CU2 A;  2XWM A;  4FRD A;  2XWL A;  2OEF A;  4G3P A;  1S4O A;  1Q0O A;  1I52 A;  4GHF A;  4KRV A;  3R4Q A;  1G93 A;  1FZW A;  2MZB A;  4EE5 A;  2VFZ A;  4EEO A;  1H7E A;  1H4D A;  1LGT A;  1V82 A;  4Y9X A;  5KEF A;  1LZ0 A;  5DRH A;  2ZW7 A;  2YQC A;  2O1H A;  1H5S D;  3KOL A;  5C1L A;  1WT0 A;  2QQZ A;  3I0J A;  2OI6 A;  3USR A;  1GWW A;  4Y62 A;  1F1X A;  4HC5 A;  2VXM A;  4JH6 A;  5DFG A;  1G95 A;  1H5T B;  2ZHP A;  1ON8 A;  4G87 A;  4L41 C;  1YP2 A;  3I0L A;  2D7R A;  1MP4 A;  2WEE A;  4NAL A;  4JH5 A;  1U6L A;  1LVW A;  1ZJ3 A;  4FIX A;  3SXC A;  2P7Q A;  5CTO A;  2APC A;  4LW3 A;  3OH4 A;  2AH9 A;  4MTS A;  3RSB A;  3U0X A;  4Z6M A;  1KW6 B;  4Z6V A;  4AC3 A;  2RJ0 A;  1JIF A;  4MND A;  2YC5 A;  2EI0 A;  1JYL A;  4M2B A;  1VZX A;  4OPN A;  1Z90 A;  3W0T A;  1VGU A;  1FO8 A;  4HO9 A;  1ZIZ A;  2XWN A;  2P73 A;  2AEC A;  1JV1 A;  4JH9 A;  1WT1 A;  4ASJ A;  5J49 A;  4DE7 A;  1W77 A;  3TZT A;  1O23 B;  1ZI5 A;  3HL3 A;  4Y7F A;  2Q4J A;  1VH1 A;  1FR8 A;  3V8Z A;  2Y4J A;  2AM5 A;  1KW9 B;  4LQB A;  3IOJ A;  4KNX A;  5CMH A;  4FIY A;  1FA5 A;  1JC4 A;  3CKJ A;  3DJ4 A;  1EZI A;  1JVG A;  2BO4 A;  2JCK A;  4KC2 A;  2AE7 A;  1JVD A;  1ZHJ A;  1MC3 A;  1QGQ A;  1QIN A;  5C49 A;  5CQL X;  5FV9 A;  1R7U A;  2WVK A;  4DDZ A;  1JIE A;  3PKQ A;  4Y7V A;  3E25 A;  4M28 A;  2AES A;  1FA6 A;  5BWG A;  3SX5 A;  1HM9 A;  3V0L A;  1NWG B;  1TFZ A;  3SXD A;  3LM4 A;  3OGZ A;  2D7I A;  2A8U A;  2RK9 A;  3V91 A;  1F1V A;  2YES A;  3ECK A;  2RJ9 A;  3SX8 A;  3E0R A;  1FR9 A;  2E3D A;  4Z6W A;  5FU0 A;  1H7T A;  1W57 A;  3T7O A;  3ST8 A;  1FO9 A;  4KPX A;  1XZ6 A;  4GYM A;  3W0U A;  1MP5 A;  2DPW A;  2V0H A;  4KQL A;  1Q0C A;  1YP4 A;  3BRK X;  2ZU8 A;  1TG5 A;  3CT8 A;  3HQ0 A;  4NVS A;  3POL A;  4AYL A;  4DEC A;  4E1K A;  1G1L A;  4K6R A;  3CGX A;  4NB2 A;  5C4C A;  2RJ4 A;  1TW5 A;  1H5T A;  3HPY A;  5CQO A;  3ZLL A;  1F1R A;  4HO0 A;  2FYD B;  1WSZ A;  3OJJ A;  3BZA A;  3CKQ A;  3T7M A;  5IDT A;  3SXE A;  2ZW4 A;  4Q7C A;  5C4F A;  4D11 C;  4FRQ A;  2ICX A;  1BH5 A;  3ISQ A;  1H7Q A;  4JD0 A;  1LZI A;  3OKR A;  1ZSW A;  3RMU A;  5D7Z A;  4J18 A;  5C68 A;  2RIT A;  5AJP A;  3SX3 A;  3ZW5 A;  3OJK A;  5EIY A;  3SXA A;  1FRO A;  4BMA A;  2Y4K A;  1SP8 A;  4MIX A;  2V0K A;  1OMZ A;  1INI A;  3I0F A;  3D8V A;  4B5B A;  3LHO A;  4Y6U A;  3SK2 A;  1NMM B;  4B3U A;  1ZCU A;  3F1Y A;  3R3I A;  3ZGF A;  2BO8 A;  1QIP A;  1H4C A;  2P7L A;  1OQM B;  3PKP A;  1FA8 A;  2FYA A;  1FOA A;  1H7L A;  1OMX A;  1F1U A;  1H5S B;  2AGD A;  2GGO A;  3HNQ A;  2EHZ A;  2WVL A;  3I0I X;  2I5K A;  5C4E A;  2PX7 A;  5C47 A;  4Z6Z A;  1QWJ A;  4O6M A;  3O3P A;  4NB1 A;  4IRQ A;  5AJO A;  5CMI A;  1VH3 A;  1NQI B;  1KMY A;  2E8B A;  1CJX A;  2X60 A;  4FRO A;  1SQD A;  1YP3 A;  2RIY A;  3E26 A;  1H4E A;  1LZ7 A;  4EEG A;  1H5R B;  3OH1 A;  1ECS A;  1LL3 A;  2NXV A;  3TQD A;  2A8W A;  2O1F A;  2GGQ A;  2Y7A A;  1G9R A;  5CQM X;  5CJ3 A;  3OAM A;  4N04 A;  4JD1 A;  3D98 A;  1JC5 A;  5BXC A;  4B42 A;  3ECJ A;  5C4P A;  4JH7 A;  3SXB A;  5C1G A;  1EYR A;  4Y7T A;  4HO8 A;  1WVC A;  3VW9 A;  1FG5 N;  5C1H A;  1ZCY A;  4NAK A;  3PNN A;  4GBP A;  1KND A;  1ZCT A;  5CMG X;  3FCD A;  1S4N A;  3OPY B;  3I0G A;  1V83 A;  2VSI A;  4FRA A;  2RIZ A;  2V0L A;  1G3L A;  4HO4 A;  5CMF X;  1NF5 B;  4FRE A;  5D4F A;  1O0R A;  1S4P A;  1BYL A;  1O7O A;  1QTO A;  3ZGJ A;  4JIS A;  5DDV A;  4ECM A;  2YCM A;  2I7R A;  3EY8 A;  5IFY A;  5HCW A;  4D0Z A;  1KW8 B;  4GHC A;  4Z6S A;  1QGS A;  3D5N A;  5C36 A;  1G97 A;  2BO7 A;  2AM3 A;  3RMW A;  2AM4 A;  4Z6Q A;  3ZGG A;  5L6S A;  4GHH A;  1ZCV A;  4NAN A;  5FTV A;  3CKV A;  4D11 A;  1E5K A;  3DK5 A;  3IOH A;  1JV3 A;  2YQJ A;  4Z6T A;  1LQO A;  1EWJ A;  4MYB A;  1H5S A;  5EJ1 A;  3F1C A;  1GX4 A;  3R2W A;  1EIR A;  1NPB A;  4KC1 A;  3I0E A;  3QVB A;  4FCU A;  3V8Y A;  5C3B A;  1ZJ2 A;  3USQ A;  2P7K A;  1VZT A;  4M2A A;  2D0J A;  4HO6 A;  3U2V A;  1HJJ A;  3OXH A;  1R82 A;  4Z6R A;  1EIL A;  4KPZ A;  4Y6N A;  2C21 A;  2Q48 A;  1H5R A;  2JCL A;  3U0Y A;  4JH2 A;  1ZJ0 A;  2X5S A;  4KYK A;  4B2X A;  5JQQ A;  4Z6N A;  5FU8 A;  5C3D A;  4Y7G A;  1TWU A;  4NAZ A;  1LQP A;  1F9Z A;  1QG8 A;  1MPY A;  4MTT A;  3V0P A;  1NIQ B;  4PV5 A;  4HO2 A;  3U2T A;  3L7T A;  3RHE A;  1INJ A;  3B59 A;  2ZYQ A;  3N9W A;  4IAG A;  1U69 A;  5DDT A;  2ZW5 A;  1VGW A;  4FRM A;  5F6Q A;  2PJS A;  3RMV A;  3FOQ A;  1G8O A;  4M4K A;  2P7P A;  4X2A A;  1GQ9 A;  3OPY A;  2ZI8 A;  5C4D A;  3IOI A;  2QH0 A;  2QNT A;  2WVM A;  1VIC A;  1YRO B;  3GHJ A;  3OH3 A;  3SXG A;  3OJN A;  1ZJO A;  5AJN A;  1NKH B;  4MYM A;  3GM5 A;  3JUJ A;  4NAY A;  5CMJ A;  2QKX A;  1R7X A;  4GHE A;  2OEG A;  3SPT A;  3V0N A;  2RK0 A;  4B4G A;  3CU0 A;  4KNR A;  2V0J A;  4R7P A;  1FRW A;  1GX0 A;  1TZF A;  1G23 A;  2VXL A;  4C2S A;  1T47 A;  3OUL A;  5CQP A;  1DHY A;  1XY7 A;  3K8E A;  3EE5 A;  4Z6P A;  1GWV A;  2RJ1 A;  1FA7 A;  3OJT A;  4HO5 A;  5D91 A;  3G12 A;  1PZY B;  2WL3 A;  2P6W A;  5BWH A;  3HDP A;  3Q80 A;  3ZLK A;  2I7B A;  3IUZ A;  2WAW A;  3U2U A;  1GQC A;  1GA8 A;  3L20 A;  4AAW A;  3BCV A;  1VM8 A;  2Z86 A;  2R5V A;  4B4B A;  2C0N A;  1HAN A;  1ON6 A;  2FY7 A;  5C48 A;  5FUH A;  4G6X A;  4IR0 A;  2PA4 A;  1HM8 A;  3CKO A;  3PKW A;  1VPA A;  4Y63 A;  3T7N A;  2EI1 A;  4MTQ A;  3Q4S A;  4NAI A;  4EE4 A;  2R6U A;  2VSH A;  4JH8 A;  3OA4 A;  1FXJ A;  2WGZ A;  1LZJ A;  4AYJ A;  4EEM A;  4JH1 A;  4Y7U A;  1XRK A;  4KT7 A;  2J0A A;  3OAJ A;  3Q7U A;  4GHG A;  1R9C A;  4FQW A;  1NHE B;  1ZI4 A;  2VD4 A;  4HO3 A;  1KMZ A;  3P8A A;  4FRL A;  2FYC B;  2Y6P A;  5C4B A;  2Y4L A;  1KLL A;  3EY7 A;  1H7G A;  2VS4 A;  1K4V A;  4JH3 A;  3JUK A;  2QGI A;  4FCE A;  4Z6O A;  1SS9 A;  3E5D A;  2JCJ A;  4PAV A;  3V0Q A;  1SS4 A;  4Z6U A;  1VGT A;  1G0R A;  4O6N A;  1HM0 A;  3JTJ A;  4HG6 A;  5FTS A;  4CJ8 A;  1EIQ A;  5I1F A;  3FWW A;  2XMH A;  2UX8 A;  3V90 A;  3I0C A;  2ZW6 A;  1H7H A;  1TW1 A;  4KYH A;  4UEG A;  1K4N A;  4FRH A;  3HPV A;  2RJ8 A;  2YQS A;  2RJB A;  3OUM A;  1WT2 A;  5C38 A;  4Z6L A;  2ICY A;  2FFV A;  1R81 A;  2JCO A;  4BQH A;  2Y4M A;  4QB5 A;  2IG9 A;  3K8D A;  3PKV A;  2VK9 A;  2BO6 A;  2IGA A;  2Z87 A;  1LKD A;  2O1G A;  2P7M A;  1KWB B;  4LW6 A;  2WE9 A;  5D92 A;  1ZDF A;  4KC4 A;  1LL0 A;  4NB0 A;  1FWY A;  1V84 A;  1ZI3 A;  1VZU A;  2VS3 A;  2YC3 A;  1FGG A;  2ZA0 A;  2J0B A;  1O7Q A;  1XQA A;  1LL2 A;  1ZJP A;  4KXO A;  1LQK A;  4ZDQ A;  2RIX A;  1HJL A;  1R80 A;  2FFU A;  2QH5 A;  2RJ6 A;  4CJB A;  1WT3 A;  2EI3 A;  4G3S A;  3I0K A;  1XHB A;  1MH6 A;  2P7O A;  3KIA A;  4HOC A;  1IIN A;  2OI5 A;  5EJZ A;  2P72 A;  3NGW A;  3U2X A;  4JH4 A;  3BQX A;  2ZU7 A;  3OH2 A;  4B2W A;  2RBB A;  5FYE A;  1IIM A;  2RJ7 A;  5IDS A;  2I5E A;  4HUZ A;  1R7V A;  2P25 A;  1G2V A;  1R7T A;  3CKN A;  1NKI A;  3ZI1 A;  4XWI A;  5HS2 A;  2OI7 A;  2XME A;  1KWC B;  2A4W A;  4G3Q A;  1JYK A;  4IRP A;  1NNR A;  3VB0 A;  1W55 A;  2RJ5 A;  3OC9 A;  4HCQ A;  2W0W A;  1H7F A;  1FGX A;  1VGZ A;  4Z04 A;  2YQH A;  3SX7 A;  4GHD A;  1SP9 A;  4YS8 A;  5EC3 A;  1KW3 B;  4EE3 A;  2A4X A;  3GUE A;  5C3A A;  4B4M A;  5C6X A;  5L6V A;  2VS5 A;  3OH0 A;  4ASY A;  4CJC A;  3I0D A;  2W0V A;  4Y64 A;  4ARW A;  4RT5 A;  2V0I A; 
#chains in the Genus database with same CATH homology
 4CVH A;  3U2W A;  4D0T A;  4D48 A;  2PGV A;  1H5S C;  3I0H A;  1FXO A;  5CQN X;  1R7Y A;  1MP3 A;  1ZI1 A;  3DUV A;  4P02 A;  3V0M A;  4EEA A;  2PGY A;  4FRB A;  1ZDG A;  1TVY A;  5C8R A;  4P00 A;  4EVW A;  3ZF8 A;  3V0O A;  2X5Z A;  4FRP A;  2ZU9 A;  1H3M A;  2FYB A;  3LW6 A;  1PZT A;  2X65 A;  1HV9 A;  1KWS A;  1ZJ1 A;  2CU2 A;  2XWM A;  4FRD A;  2XWL A;  2OEF A;  4G3P A;  1S4O A;  1I52 A;  4KRV A;  1G93 A;  1FZW A;  2MZB A;  4EE5 A;  2VFZ A;  4EEO A;  1H7E A;  1H4D A;  1V82 A;  4Y9X A;  1LZ0 A;  2YQC A;  2O1H A;  1H5S D;  5C1L A;  1WT0 A;  3I0J A;  2OI6 A;  3USR A;  1GWW A;  4Y62 A;  2VXM A;  4L41 C;  1ON8 A;  1G95 A;  1H5T B;  4G87 A;  1YP2 A;  3I0L A;  2D7R A;  1MP4 A;  2WEE A;  4NAL A;  1ZJ3 A;  1LVW A;  4FIX A;  3SXC A;  2APC A;  4LW3 A;  3OH4 A;  2AH9 A;  3RSB A;  3U0X A;  4AC3 A;  2RJ0 A;  4MND A;  2YC5 A;  1JYL A;  4M2B A;  1VZX A;  1Z90 A;  1VGU A;  1FO8 A;  4HO9 A;  1ZIZ A;  2XWN A;  2P73 A;  2AEC A;  1JV1 A;  1WT1 A;  4ASJ A;  5J49 A;  4DE7 A;  1W77 A;  3TZT A;  1O23 B;  1ZI5 A;  3HL3 A;  4Y7F A;  2Q4J A;  1VH1 A;  1FR8 A;  3V8Z A;  2Y4J A;  2AM5 A;  3IOJ A;  4KNX A;  5CMH A;  4FIY A;  3CKJ A;  3DJ4 A;  1EZI A;  1JVG A;  2BO4 A;  2JCK A;  4KC2 A;  2AE7 A;  1JVD A;  1ZHJ A;  1MC3 A;  1QGQ A;  5C49 A;  5CQL X;  5FV9 A;  1R7U A;  2WVK A;  4DDZ A;  3PKQ A;  4Y7V A;  3E25 A;  4M28 A;  2AES A;  3SX5 A;  1HM9 A;  3V0L A;  1NWG B;  3SXD A;  3OGZ A;  2D7I A;  2A8U A;  3V91 A;  2YES A;  2RJ9 A;  3SX8 A;  1FR9 A;  2E3D A;  5FU0 A;  1H7T A;  1W57 A;  3T7O A;  3ST8 A;  1FO9 A;  4KPX A;  1XZ6 A;  1MP5 A;  2DPW A;  2V0H A;  4KQL A;  1YP4 A;  3BRK X;  2ZU8 A;  3POL A;  4AYL A;  4DEC A;  4E1K A;  1G1L A;  4K6R A;  3CGX A;  5C4C A;  2RJ4 A;  1TW5 A;  1H5T A;  5CQO A;  3ZLL A;  4HO0 A;  2FYD B;  1WSZ A;  3CKQ A;  5IDT A;  3T7M A;  3SXE A;  5C4F A;  4Q7C A;  4D11 C;  4FRQ A;  2ICX A;  1H7Q A;  4JD0 A;  1LZI A;  3OKR A;  5AJP A;  3SX3 A;  4J18 A;  2RIT A;  5EIY A;  3SXA A;  4BMA A;  2Y4K A;  4MIX A;  2V0K A;  1OMZ A;  1INI A;  3I0F A;  3D8V A;  4B5B A;  4Y6U A;  1NMM B;  4B3U A;  1ZCU A;  3F1Y A;  3R3I A;  3ZGF A;  2BO8 A;  1H4C A;  1OQM B;  3PKP A;  2FYA A;  1FOA A;  2GGO A;  1H7L A;  1OMX A;  1H5S B;  2AGD A;  3I0I X;  2WVL A;  2I5K A;  5C4E A;  2PX7 A;  5C47 A;  1QWJ A;  4O6M A;  3O3P A;  4IRQ A;  5AJO A;  5CMI A;  1VH3 A;  1NQI B;  2E8B A;  2X60 A;  4FRO A;  1YP3 A;  2RIY A;  3E26 A;  1H4E A;  1LZ7 A;  4EEG A;  1H5R B;  3OH1 A;  2NXV A;  1LL3 A;  3TQD A;  2A8W A;  2O1F A;  2GGQ A;  2Y7A A;  1G9R A;  5CQM X;  3OAM A;  3D98 A;  5BXC A;  4B42 A;  3SXB A;  5C1G A;  1EYR A;  4Y7T A;  4HO8 A;  1WVC A;  1FG5 N;  5C1H A;  1ZCY A;  4NAK A;  3PNN A;  4GBP A;  1ZCT A;  5CMG X;  1S4N A;  3I0G A;  1V83 A;  2VSI A;  4FRA A;  2RIZ A;  2V0L A;  1G3L A;  4HO4 A;  5CMF X;  1NF5 B;  4FRE A;  1O0R A;  1S4P A;  4ECM A;  1O7O A;  4JIS A;  5DDV A;  2YCM A;  5IFY A;  4D0Z A;  1QGS A;  3D5N A;  5C36 A;  1G97 A;  2BO7 A;  2AM3 A;  3RMW A;  2AM4 A;  3ZGG A;  5L6S A;  1ZCV A;  4NAN A;  5FTV A;  3CKV A;  4D11 A;  1E5K A;  3DK5 A;  3IOH A;  1JV3 A;  2YQJ A;  4MYB A;  1H5S A;  5EJ1 A;  3F1C A;  1GX4 A;  3R2W A;  4KC1 A;  3I0E A;  3QVB A;  4FCU A;  3V8Y A;  5C3B A;  1ZJ2 A;  3USQ A;  1VZT A;  4M2A A;  2D0J A;  4HO6 A;  3U2V A;  1HJJ A;  4KPZ A;  1R82 A;  4Y6N A;  2JCL A;  1H5R A;  3U0Y A;  1ZJ0 A;  2X5S A;  5JQQ A;  4B2X A;  5FU8 A;  5C3D A;  4Y7G A;  1QG8 A;  3V0P A;  4HO2 A;  3U2T A;  1INJ A;  3N9W A;  5DDT A;  1VGW A;  4FRM A;  3RMV A;  3FOQ A;  1G8O A;  4M4K A;  1GQ9 A;  5C4D A;  3IOI A;  2WVM A;  1VIC A;  1YRO B;  3OH3 A;  3SXG A;  1ZJO A;  5AJN A;  1NKH B;  3JUJ A;  5CMJ A;  2QKX A;  1R7X A;  2OEG A;  3SPT A;  3V0N A;  4B4G A;  3CU0 A;  4KNR A;  2V0J A;  4R7P A;  1FRW A;  1GX0 A;  1TZF A;  1G23 A;  2VXL A;  4C2S A;  5CQP A;  3K8E A;  3EE5 A;  1GWV A;  2RJ1 A;  4HO5 A;  5D91 A;  1PZY B;  2P6W A;  3Q80 A;  3ZLK A;  2I7B A;  2WAW A;  3U2U A;  1GQC A;  1GA8 A;  4AAW A;  4B4B A;  3BCV A;  1VM8 A;  2Z86 A;  2C0N A;  2FY7 A;  1ON6 A;  5C48 A;  5FUH A;  2PA4 A;  4Y63 A;  1HM8 A;  3CKO A;  1VPA A;  3T7N A;  3Q4S A;  4NAI A;  4EE4 A;  2VSH A;  1FXJ A;  2WGZ A;  1LZJ A;  4AYJ A;  4EEM A;  4Y7U A;  4KT7 A;  2J0A A;  3Q7U A;  4FQW A;  1NHE B;  1ZI4 A;  2VD4 A;  4HO3 A;  4FRL A;  2FYC B;  2Y6P A;  5C4B A;  2Y4L A;  1H7G A;  2VS4 A;  1K4V A;  3JUK A;  2QGI A;  4FCE A;  1SS9 A;  2JCJ A;  3V0Q A;  1VGT A;  1G0R A;  4O6N A;  1HM0 A;  3JTJ A;  4HG6 A;  5FTS A;  4CJ8 A;  5I1F A;  3FWW A;  2XMH A;  2UX8 A;  3V90 A;  3I0C A;  1H7H A;  1TW1 A;  4UEG A;  4FRH A;  2RJ8 A;  2YQS A;  1WT2 A;  5C38 A;  2ICY A;  2FFV A;  1R81 A;  2JCO A;  4BQH A;  2Y4M A;  3K8D A;  2VK9 A;  2BO6 A;  2Z87 A;  2O1G A;  4LW6 A;  2WE9 A;  5D92 A;  1ZDF A;  4KC4 A;  1LL0 A;  1FWY A;  1V84 A;  1ZI3 A;  1VZU A;  2VS3 A;  2YC3 A;  1FGG A;  2J0B A;  1O7Q A;  1ZJP A;  1LL2 A;  4KXO A;  4ZDQ A;  2RIX A;  1HJL A;  1R80 A;  2FFU A;  2QH5 A;  2RJ6 A;  4CJB A;  1WT3 A;  4G3S A;  3I0K A;  1XHB A;  3KIA A;  4HOC A;  1IIN A;  2OI5 A;  5EJZ A;  2P72 A;  3NGW A;  3U2X A;  2ZU7 A;  3OH2 A;  4B2W A;  5FYE A;  1IIM A;  2RJ7 A;  5IDS A;  2I5E A;  1R7V A;  1G2V A;  1R7T A;  3CKN A;  4XWI A;  5HS2 A;  2OI7 A;  2XME A;  4G3Q A;  1JYK A;  4IRP A;  1W55 A;  2RJ5 A;  3OC9 A;  4HCQ A;  2W0W A;  1H7F A;  1FGX A;  1VGZ A;  3SX7 A;  2YQH A;  4YS8 A;  4EE3 A;  3GUE A;  5C3A A;  4B4M A;  5L6V A;  2VS5 A;  3OH0 A;  4ASY A;  4CJC A;  3I0D A;  2W0V A;  4Y64 A;  4ARW A;  2V0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...