1FOAA

Crystal structure of n-acetylglucosaminyltransferase i
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
342
structure length
342
Chain Sequence
AVIPILVIACDRSTVRRCLDKLLHYRPSAELFPIIVSQDCGHEETAQVIASYGSAVTHIRQPDLSNIAVQPDHRKFQGYYKIARHYRWALGQIFHNFNYPAAVVVEDDLEVAPDFFEYFQATYPLLKADPSLWCVSAWNDNGKEQMVDSSKPELLYRTDFFPGLGWLLLAELWAELEPKWPKAFWDDWMRRPEQRKGRACVRPEISRTMTFGRKGVSHGQFFDQHLKFIKLNQQFVPFTQLDLSYLQQEAYDRDFLARVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIVTFLFRGRRVHLAPPQTWDGYDPSWT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-1,3-MANNOSYL-GLYCOPROTEIN BETA-1,2-N-ACETYLGLUCOSAMINY
publication title X-ray crystal structure of rabbit N-acetylglucosaminyltransferase I: catalytic mechanism and a new protein superfamily.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Transferase
total genus 113
structure length 342
sequence length 342
ec nomenclature ec 2.4.1.101: Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase.
pdb deposition date 2000-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.180.20 Alpha Beta Roll 2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1 N-Acetylglucosaminyltransferase I, Domain 2 1foaA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1foaA01
4KPZA 2RJ1A 2OEGA 1H4EA 2RJ9A 2RIYA 4NALA 2RJ5A 3RMVA 3IOJA 1ZCTA 2V0LA 5C4BA 2FYDB 1ZI1A 5EJZA 3ZF8A 2FFUA 1R7TA 1H7QA 2Y6PA 4IRQA 2UX8A 5L6VA 2P6WA 3I0LA 1V82A 1QWJA 2D7IA 4KT7A 4CJBA 5C49A 4D48A 3I0DA 1ON6A 2I7BA 1ZI4A 3U2UA 2FYCB 1JYKA 1TW5A 2BO4A 3CKNA 3LW6A 4FRLA 2PA4A 2Y4JA 4EEOA 5C4EA 1S4PA 3V8ZA 1G1LA 4K6RA 1IIMA 3V0OA 4AAWA 2XMEA 1JYLA 3ST8A 3CKOA 1TZFA 1H5RA 3V0QA 3V91A 2A8UA 5C38A 2BO6A 2RJ0A 1GX4A 1EZIA 4ARWA 4HG6A 4EE3A 1G97A 1JVDA 4BQHA 5FTVA 1PZYB 3CKQA 1YP4A 3ZGGA 1W77A 3ZLKA 4D0ZA 2YC3A 5FYEA 3PKQA 1LZ0A 5IDSA 5CQPA 1FG5N 1S4NA 4FCUA 2O1FA 1S4OA 1V84A 5EIYA 5C1GA 1VGZA 1JVGA 2Z86A 5L6SA 1H3MA 1MP5A 1WT0A 3I0HA 1FO9A 3USRA 4M28A 3SX5A 4P00A 1NKHB 4KXOA 4FCEA 1VH1A 4Y7TA 4B2XA 4Y62A 1QGSA 3RSBA 4L41C 2Y4KA 1OMZA 3FOQA 3CGXA 1YP3A 3I0IX 3Q4SA 4HO3A 3V8YA 3V0PA 1H7HA 4G3PA 3CKJA 2JCJA 4ASJA 1FR8A 3POLA 3OAMA 4B5BA 1MP3A 4KNXA 2YC5A 1V83A 2X65A 3OKRA 2A8WA 3V90A 1GX0A 3GUEA 3I0CA 4EVWA 1YP2A 5JQQA 3BCVA 1R7VA 1K4VA 4HO2A 4G87A 2YQJA 1H5SD 4B4GA 3D98A 2V0HA 1FRWA 2RJ8A 4MNDA 1G3LA 1GQ9A 2V0JA 3Q80A 3SX7A 4FROA 2XWLA 1G93A 1MP4A 4FRBA 4Y7GA 5CMHA 1ZJ0A 1ZDFA 2XWMA 5C3DA 4HO8A 1TVYA 2PGVA 4AYLA 4EE4A 2JCOA 4FRMA 4Y7UA 1H5RB 1O0RA 1R7XA 1W57A 5CMJA 2NXVA 2APCA 3N9WA 2W0VA 1NWGB 1O7QA 2Y4LA 2AM4A 2X5ZA 2I5EA 4KQLA 2W0WA 1G2VA 5C4FA 2FY7A 1PZTA 4EE5A 1FXJA 1ZJ1A 4EEGA 2RITA 5CQNX 4MYBA 4AYJA 1H7EA 1ZJOA 1H7GA 4HCQA 1VZUA 1FOAA 4J18A 1H5SC 3I0FA 4M2AA 4Y63A 1JV3A 4DE7A 5FUHA 1G23A 1H4CA 2WVLA 1G8OA 1R7UA 2P72A 4GBPA 4Y7VA 1VPAA 2YESA 2VSHA 4FQWA 3JUKA 1ZHJA 1H5SA 4KNRA 3O3PA 2YQSA 2D7RA 2RIXA 5I1FA 1LL2A 5DDVA 1QGQA 4FRAA 2YQCA 1VGUA 2VSIA 3USQA 5DDTA 5IDTA 4CVHA 2PGYA 2AE7A 2Z87A 2V0KA 1ZJ3A 1FGGA 3IOIA 5AJOA 1H7TA 5C47A 2OI6A 1JV1A 1NMMB 3T7MA 2V0IA 1LVWA 4HO6A 2AECA 1WSZA 3R3IA 4NAIA 4LW6A 4M4KA 1ZCUA 2Y4MA 2CU2A 1SS9A 4KC4A 3I0EA 5C4CA 2FYAA 2BO7A 4R7PA 4NAKA 1VGTA 4Y64A 2QKXA 1OQMB 1ZJ2A 4B42A 5CQOA 1ZDGA 4JISA 1FO8A 3SX3A 3V0LA 5C3BA 1LL3A 4KC1A 4P02A 2DPWA 3I0JA 5FTSA 3T7NA 3U0YA 5IFYA 3U0XA 3K8DA 2MZBA 3SXEA 1IINA 2WVKA 4XWIA 5J49A 4Y6UA 1LZIA 4E1KA 1HJLA 5C4DA 3E26A 1GWVA 1NHEB 4NANA 3F1CA 5C48A 4D11C 1YROB 1KWSA 1H7LA 2BO8A 2OEFA 3Q7UA 2RJ7A 3SXDA 3SXAA 1LZJA 1G9RA 3D8VA 4FRPA 3K8EA 1HV9A 1Z90A 1ZI5A 1OMXA 4BMAA 1FR9A 4D11A 4B2WA 1H5SB 4KRVA 2Q4JA 1LL0A 3OH4A 3PKPA 1INIA 3T7OA 3KIAA 2AH9A 4AC3A 2VS5A 1H5TA 1R80A 3U2TA 3NGWA 1ZCVA 5BXCA 5C36A 3IOHA 2VS3A 3SXBA 4C2SA 5CQMX 2VXLA 4KC2A 3OGZA 1H7FA 3U2VA 5CQLX 3V0NA 5C8RA 1NQIB 2D0JA 4HO5A 1WT3A 2E3DA 4HOCA 1XHBA 5HS2A 5C3AA 1EYRA 1ZIZA 4ZDQA 4HO4A 4CJ8A 5FV9A 3I0KA 2OI7A 1ZCYA 4YS8A 2JCLA 3TZTA 4Y6NA 4D0TA 3F1YA 1W55A 1WVCA 5FU0A 3JTJA 3OH2A 2YCMA 3ZGFA 4ASYA 1VICA 1O7OA 3I0GA 5FU8A 2AM3A 1FWYA 2FYBA 3E25A 5CMIA 2WE9A 4B4BA 1VZTA 4JD0A 3DJ4A 2RJ6A 2WEEA 2O1HA 1QG8A 2ZU7A 1E5KA 4Y9XA 2WVMA 4EEMA 1NF5B 2X60A 1HM0A 1HM9A 2Y7AA 4EEAA 3OH3A 3OH1A 4FRQA 1FGXA 1GA8A 2ICYA 3DUVA 2VXMA 2O1GA 3D5NA 3TQDA 3QVBA 2X5SA 2WAWA 3RMWA 2FFVA 4UEGA 4FRDA 2VS4A 2ICXA 2PX7A 4G3SA 2I5KA 5AJNA 2RIZA 1FZWA 1H5TB 5C1HA 2XMHA 1FXOA 3U2XA 4KPXA 5CMFX 1WT1A 4ECMA 3DK5A 2P73A 1MC3A 4HO9A 1VM8A 1WT2A 1ZI3A 2AGDA 5EJ1A 3SXCA 3SX8A 1R81A 2ZU8A 1HM8A 1TW1A 3CU0A 1HJJA 1INJA 3SPTA 2VD4A 3HL3A 4B4MA 1G95A 2GGQA 2QGIA 5C1LA 1O23B 4B3UA 3PNNA 1GWWA 4G3QA 2E8BA 3R2WA 3OC9A 4IRPA 1VZXA 1XZ6A 2XWNA 4LW3A 1ZJPA 3OH0A 4M2BA 4Y7FA 2AESA 2VFZA 5CMGX 1VH3A 4FREA 2GGOA 4FRHA 3SXGA 5AJPA 2OI5A 1ON8A 4CJCA 4HO0A 3EE5A 4DECA 1G0RA 1R7YA 2QH5A 1I52A 2ZU9A 3BRKX 1R82A 2RJ4A 2WGZA 3U2WA 1LZ7A 3ZLLA 2AM5A 1H4DA 1GQCA 2YQHA 4DDZA 2JCKA 3CKVA 3V0MA 3JUJA 3FWWA 1VGWA
chains in the Genus database with same CATH superfamily
4NAZA 4KYHA 4Z6NA 4KPZA 2RJ1A 2OEGA 1H4EA 4Z6WA 2RJ9A 2RIYA 2ZW5A 4NALA 3OUMA 4FIXA 2RJ5A 3RMVA 3IOJA 1ZCTA 2V0LA 5C4BA 3R4QA 2FYDB 1ZI1A 5EJZA 3ZF8A 3HPYA 2FFUA 1R7TA 1H7QA 2Y6PA 4IRQA 4NB1A 2UX8A 5L6VA 2P6WA 3I0LA 1V82A 1QWJA 2D7IA 4KT7A 4CJBA 5C49A 4D48A 3I0DA 1T47A 1ON6A 2I7BA 1ZI4A 3U2UA 2FYCB 1JYKA 1TW5A 2BO4A 3CKNA 3W0UA 3LW6A 4JD1A 4FRLA 2PA4A 4QB5A 2Y4JA 4EEOA 5C4EA 3ZI1A 1S4PA 3V8ZA 1G1LA 4K6RA 1IIMA 2J0BA 3V0OA 4IR0A 4AAWA 2XMEA 4GHHA 3FCDA 1JYLA 3ST8A 3CKOA 3OAJA 1TZFA 3VW9A 1H5RA 1NNRA 2A8UA 3V0QA 3V91A 2BO6A 2P7KA 5C38A 4Z6ZA 2RJ0A 1GX4A 1EZIA 1KW6B 4ARWA 4HG6A 1XY7A 4EE3A 1FA6A 4MTTA 5CJ3A 5DFGA 1G97A 1JVDA 4Z6PA 4BQHA 3OA4A 4LQBA 5FTVA 2A4WA 2QQZA 1PZYB 3CKQA 1SS4A 1YP4A 3EY7A 3ZGGA 2ZI8A 1W77A 3ZLKA 4D0ZA 1JIFA 2YC3A 5FYEA 3PKQA 1LZ0A 5IDSA 5KEFA 2Q48A 5CQPA 1FG5N 1S4NA 4FCUA 3ECJA 1F1UA 3BQXA 2O1FA 1S4OA 1V84A 5EIYA 1Q0OA 5C1GA 1VGZA 1JVGA 2Z86A 5L6SA 1H3MA 1ZSWA 1MP5A 2P25A 1WT0A 2P7LA 3I0HA 1FA7A 1FO9A 3PKXA 4G6XA 3USRA 4M28A 3SX5A 4P00A 1SP9A 1NKHB 4FCEA 4KXOA 1VH1A 4Y7TA 4B2XA 4Y62A 2ZW6A 1QGSA 3RSBA 4L41C 1F9ZA 2WL3A 1LQPA 4KYKA 2EI1A 2Y4KA 1OMZA 4Q7CA 4FIYA 2RJBA 3CGXA 3FOQA 4X2AA 1YP3A 3I0IX 3Q4SA 4HO3A 3V8YA 3V0PA 1H7HA 4G3PA 3CKJA 2JCJA 4ASJA 1FR8A 3POLA 3OAMA 4B5BA 1MP3A 4KNXA 1TG5A 3HNQA 2YC5A 2RK0A 1V83A 2X65A 3OKRA 2A8WA 3V90A 1GX0A 3GUEA 3I0CA 4EVWA 1YP2A 5JQQA 3HUHA 1JC4A 3BCVA 1R7VA 1K4VA 4HO2A 4G87A 2YQJA 1H5SD 4B4GA 3D98A 2V0HA 1FRWA 4JH6A 2RJ8A 4MNDA 1G3LA 1GQ9A 1XRKA 2V0JA 3GM5A 4JH2A 3Q80A 3SX7A 4FROA 2XWLA 1G93A 1MP4A 4FRBA 4Y7GA 5CMHA 4GHGA 1ZJ0A 1MPYA 1ZDFA 2XWMA 5C3DA 4PV5A 4HO8A 1TVYA 2PGVA 4AYLA 4EE4A 2JCOA 3LM4A 1KMYA 4FRMA 1EWJA 4Z6RA 1EILA 3E5DA 4Y7UA 1H5RB 1O0RA 1R7XA 1W57A 5CMJA 1KLLA 2IG9A 2NXVA 2APCA 3N9WA 2W0VA 1NWGB 1O7QA 2Y4LA 2AM4A 1HANA 2I5EA 2X5ZA 2W0WA 4KQLA 1G2VA 5C4FA 2FY7A 4Z6LA 1PZTA 4EE5A 1FXJA 2R5VA 1ZJ1A 4EEGA 2RITA 5CQNX 4MYBA 4AYJA 5C68A 1H7EA 1ZJOA 2ZW7A 1H7GA 4JH3A 4HCQA 1BH5A 1VZUA 1FOAA 2IGAA 1H5SC 1SP8A 3I0FA 4J18A 4M2AA 4Y63A 1JV3A 4DE7A 3ZW5A 1QTOA 2EI2A 1G23A 1H4CA 2WVLA 5FUHA 1G8OA 1R7UA 2P72A 4GBPA 4Y7VA 1KNFA 4GYMA 1VPAA 2YESA 2VSHA 4FQWA 3JUKA 1ZHJA 1H5SA 4KNRA 3O3PA 2YQSA 1U69A 2D7RA 2RIXA 5I1FA 1LL2A 5DDVA 3EY8A 4Z6SA 1QGQA 5F6QA 3KOLA 4FRAA 2YQCA 3L20A 1QINA 1VGUA 2VSIA 3USQA 5DDTA 5IDTA 4CVHA 2VK9A 2PGYA 2AE7A 1K4NA 2Z87A 2V0KA 3HDPA 1ZJ3A 1BYLA 1FGGA 3IOIA 5AJOA 2I7RA 3OPYB 4MTSA 1H7TA 5C47A 3RHEA 3IUZA 5BWGA 2OI6A 1FA5A 2RBBA 1F1XA 1JV1A 1NMMB 5CTOA 3T7MA 2V0IA 1LVWA 4HO6A 2AECA 1KNDA 3HQ0A 1WSZA 3R3IA 4NAIA 4LW6A 3VB0A 4M4KA 3SK2A 1ZCUA 2Y4MA 2CU2A 1SS9A 2EI0A 1LGTA 4KC4A 4GHEA 3I0EA 5C4CA 3PKVA 2FYAA 1ECSA 2BO7A 3W0TA 4R7PA 4NB0A 4NAKA 1VGTA 4Y64A 2QKXA 1OQMB 1ZJ2A 4B42A 5CQOA 2P7QA 3E0RA 1ZDGA 4JISA 2C21A 4Z6UA 3LHOA 1FO8A 3SX3A 3PKWA 3V0LA 5C3BA 1LL3A 1JIEA 4KC1A 4P02A 2ZHPA 2DPWA 2EHZA 3I0JA 5CB9A 5FTSA 3T7NA 3U0YA 5IFYA 3U0XA 3GHJA 3K8DA 2MZBA 3L7TA 3SXEA 2P7PA 1IINA 2WVKA 4XWIA 5D92A 5J49A 4Y6UA 1LZIA 1SQIA 4E1KA 3OJKA 1HJLA 3E26A 5C4DA 1GWVA 1NHEB 4NANA 3F1CA 5C48A 3OXHA 4MTQA 4D11C 1YROB 1KWSA 1H7LA 2BO8A 2OEFA 3Q7UA 2RJ7A 5D4FA 5D91A 3SXDA 3SXAA 1LQKA 1LZJA 3OJNA 1G9RA 3D8VA 4FRPA 3K8EA 1HV9A 1Z90A 1ZI5A 1OMXA 4O6NA 4BMAA 1XQAA 1FR9A 4D11A 4B2WA 4NB2A 1H5SB 2Q4JA 4KRVA 1LL0A 4Z6OA 3OH4A 3PKPA 1INIA 5BWHA 3T7OA 3KIAA 2AH9A 4AC3A 4JH8A 3B59A 4IAGA 1H5TA 1R80A 2VS5A 3U2TA 2A4XA 5C6XA 3NGWA 1ZCVA 5BXCA 1EIQA 5C36A 3IOHA 2J0AA 2VS3A 1NPBA 3SXBA 1TWUA 4C2SA 5CQMX 2VXLA 2R6UA 3OGZA 1H7FA 4KC2A 3U2VA 5CQLX 3V0NA 5C8RA 1NQIB 1SQDA 2ZYQA 2C0NA 2D0JA 4HO5A 4NVSA 1WT3A 2E3DA 4HOCA 4HUZA 1XHBA 5HS2A 1TSJA 4MIXA 4Z6MA 3R6AA 5C3AA 4GHDA 3CT8A 4Z6TA 1TFZA 1EYRA 4MYMA 1NKIA 1ZIZA 4ZDQA 4HO4A 4CJ8A 5FV9A 3I0KA 4HC5A 2OI7A 5HCWA 1ZCYA 4YS8A 2JCLA 3TZTA 1KWCB 4Y6NA 4D0TA 3F1YA 1QIPA 1U6LA 1W55A 1WVCA 5FU0A 3JTJA 3OH2A 2YCMA 4GHCA 3ZGFA 4ASYA 1VICA 1O7OA 1FA8A 3I0GA 5FU8A 2AM3A 1FWYA 3BZAA 2FYBA 3E25A 5CMIA 2WE9A 4B4BA 1VZTA 4JD0A 3DJ4A 2RJ6A 2WEEA 3OJTA 1CJXA 2O1HA 1QG8A 4Z04A 2ZU7A 1E5KA 4Y9XA 2WVMA 4EEMA 1NF5B 2X60A 1HM0A 1HM9A 2Y7AA 1KMZA 4NAYA 4EEAA 3OH3A 3OH1A 4FRQA 1FGXA 1GA8A 1KW9B 2ICYA 3DUVA 2VXMA 2O1GA 3ECKA 2P7MA 1NIQB 4MTRA 3D5NA 1FROA 3TQDA 3ISQA 1LKDA 3OULA 3HPVA 3QVBA 1R9CA 2X5SA 2WAWA 3G12A 3RMWA 4JH4A 2FFVA 4UEGA 4FRDA 4PAVA 2VS4A 2ICXA 2PX7A 4G3SA 2I5KA 5AJNA 3P8AA 2RIZA 1KW8B 1FZWA 4RT5A 1H5TB 5C1HA 2XMHA 1FXOA 1JC5A 3U2XA 4KPXA 5CMFX 1WT1A 4ECMA 3DK5A 1KW3B 2P73A 1MC3A 4HO9A 1VM8A 5C4PA 1WT2A 2ZW4A 4Z6QA 2P7OA 2RK9A 1ZI3A 2AGDA 5EJ1A 3SXCA 3SX8A 1R81A 2ZU8A 1HM8A 1F1VA 1TW1A 3CU0A 1HJJA 1INJA 3SPTA 1DHYA 2VD4A 3HL3A 5D7ZA 4B4MA 5DRHA 1G95A 4OPNA 4N04A 2GGQA 2QGIA 5C1LA 4GHFA 1O23B 3PNNA 4B3UA 1F1RA 3OPYA 2QNTA 3OJJA 4JH1A 5DHWA 1GWWA 2E8BA 3R2WA 4G3QA 1LQOA 3OC9A 4IRPA 1VZXA 1XZ6A 1MH6A 2XWNA 4LW3A 2EI3A 1ZJPA 4Z6VA 3OH0A 4M2BA 4JH7A 4Y7FA 2AESA 2VFZA 5CMGX 4JH5A 1EIRA 1VH3A 4FREA 3ZGJA 2GGOA 4FRHA 5EC3A 3SXGA 5AJPA 2OI5A 2WL9A 1ON8A 3RRIA 4HO0A 4O6MA 4CJCA 3EE5A 4DECA 2QH0A 1G0RA 1R7YA 2PJSA 2QH5A 1I52A 2ZU9A 3BRKX 1R82A 1Q0CA 4JH9A 3RMUA 2ZA0A 2RJ4A 2WGZA 3U2WA 1LZ7A 3ZLLA 2AM5A 1H4DA 1GQCA 2YQHA 4DDZA 1KWBB 2JCKA 3CKVA 3V0MA 3JUJA 3FWWA 1VGWA
chains in the Genus database with same CATH topology
4KPZA 2RJ1A 2OEGA 1H4EA 2RJ9A 2RIYA 4NALA 4FIXA 2RJ5A 3RMVA 3IOJA 1ZCTA 2V0LA 5C4BA 2FYDB 1ZI1A 5EJZA 3ZF8A 2FFUA 1R7TA 1H7QA 2Y6PA 4IRQA 2UX8A 5L6VA 2P6WA 3I0LA 1V82A 1QWJA 2D7IA 4KT7A 4CJBA 5C49A 4D48A 3I0DA 1ON6A 2I7BA 1ZI4A 3U2UA 2FYCB 1JYKA 1TW5A 2BO4A 3CKNA 3LW6A 4FRLA 2PA4A 2Y4JA 4EEOA 5C4EA 1S4PA 3V8ZA 1G1LA 4K6RA 1IIMA 2J0BA 3V0OA 4AAWA 2XMEA 1JYLA 3ST8A 3CKOA 1TZFA 1H5RA 3V0QA 3V91A 2A8UA 5C38A 2BO6A 2RJ0A 1GX4A 1EZIA 4ARWA 4HG6A 4EE3A 1G97A 1JVDA 4BQHA 5FTVA 1PZYB 3CKQA 1YP4A 3ZGGA 1W77A 3ZLKA 4D0ZA 2YC3A 5FYEA 3PKQA 1LZ0A 5IDSA 5CQPA 1FG5N 1S4NA 4FCUA 2O1FA 1S4OA 1V84A 5EIYA 5C1GA 1VGZA 1JVGA 2Z86A 5L6SA 1H3MA 1MP5A 1WT0A 3I0HA 1FO9A 3USRA 4M28A 3SX5A 4P00A 1NKHB 4KXOA 4FCEA 1VH1A 4Y7TA 4B2XA 4Y62A 1QGSA 3RSBA 4L41C 2Y4KA 1OMZA 4Q7CA 4FIYA 3FOQA 3CGXA 1YP3A 3I0IX 3Q4SA 4HO3A 3V8YA 3V0PA 1H7HA 4G3PA 3CKJA 2JCJA 4ASJA 1FR8A 3POLA 3OAMA 4B5BA 1MP3A 4KNXA 2YC5A 1V83A 2X65A 3OKRA 2A8WA 3V90A 1GX0A 3GUEA 3I0CA 4EVWA 1YP2A 5JQQA 3BCVA 1R7VA 1K4VA 4HO2A 4G87A 2YQJA 1H5SD 4B4GA 3D98A 2V0HA 1FRWA 2RJ8A 4MNDA 1G3LA 1GQ9A 2V0JA 3Q80A 3SX7A 4FROA 2XWLA 1G93A 1MP4A 4FRBA 4Y7GA 5CMHA 1ZJ0A 1ZDFA 2XWMA 5C3DA 4HO8A 1TVYA 2PGVA 4AYLA 4EE4A 2JCOA 4FRMA 4Y7UA 1H5RB 1O0RA 1R7XA 1W57A 5CMJA 2NXVA 2APCA 3N9WA 2W0VA 1NWGB 1O7QA 2Y4LA 2AM4A 2X5ZA 2I5EA 4KQLA 2W0WA 1G2VA 5C4FA 2FY7A 1PZTA 4EE5A 1FXJA 1ZJ1A 4EEGA 2RITA 5CQNX 4MYBA 4AYJA 1H7EA 1ZJOA 1H7GA 4HCQA 1VZUA 1FOAA 4J18A 1H5SC 3I0FA 4M2AA 4Y63A 1JV3A 4DE7A 5FUHA 1G23A 1H4CA 2WVLA 1G8OA 1R7UA 2P72A 4GBPA 4Y7VA 1VPAA 2YESA 2VSHA 4FQWA 3JUKA 1ZHJA 1H5SA 4KNRA 3O3PA 2YQSA 2D7RA 2RIXA 5I1FA 1LL2A 5DDVA 1QGQA 4FRAA 2YQCA 1VGUA 2VSIA 3USQA 5DDTA 5IDTA 4CVHA 2VK9A 2PGYA 2AE7A 2Z87A 2V0KA 1ZJ3A 1FGGA 3IOIA 5AJOA 1H7TA 5C47A 2OI6A 1JV1A 1NMMB 3T7MA 2V0IA 1LVWA 4HO6A 2AECA 1WSZA 3R3IA 4NAIA 4LW6A 4M4KA 1ZCUA 2Y4MA 2CU2A 1SS9A 4KC4A 3I0EA 5C4CA 2FYAA 2BO7A 4R7PA 4NAKA 1VGTA 4Y64A 2QKXA 1OQMB 1ZJ2A 4B42A 5CQOA 1ZDGA 4JISA 1FO8A 3SX3A 3V0LA 5C3BA 1LL3A 4KC1A 4P02A 2DPWA 3I0JA 5FTSA 3T7NA 3U0YA 5IFYA 3U0XA 3K8DA 2MZBA 3SXEA 1IINA 2WVKA 4XWIA 5D92A 5J49A 4Y6UA 1LZIA 4E1KA 1HJLA 5C4DA 3E26A 1GWVA 1NHEB 4NANA 3F1CA 5C48A 4D11C 1YROB 1KWSA 1H7LA 2BO8A 2OEFA 3Q7UA 2RJ7A 5D91A 3SXDA 3SXAA 1LZJA 1G9RA 3D8VA 4FRPA 3K8EA 1HV9A 1Z90A 1ZI5A 1OMXA 4O6NA 4BMAA 1FR9A 4D11A 4B2WA 1H5SB 4KRVA 2Q4JA 1LL0A 3OH4A 3PKPA 1INIA 3T7OA 3KIAA 2AH9A 4AC3A 2VS5A 1H5TA 1R80A 3U2TA 3NGWA 1ZCVA 5BXCA 5C36A 3IOHA 2J0AA 2VS3A 3SXBA 4C2SA 5CQMX 2VXLA 4KC2A 3OGZA 1H7FA 3U2VA 5CQLX 3V0NA 5C8RA 1NQIB 2C0NA 2D0JA 4HO5A 1WT3A 2E3DA 4HOCA 1XHBA 5HS2A 4MIXA 5C3AA 1EYRA 1ZIZA 4ZDQA 4HO4A 4CJ8A 5FV9A 3I0KA 2OI7A 1ZCYA 4YS8A 2JCLA 3TZTA 4Y6NA 4D0TA 3F1YA 1W55A 1WVCA 5FU0A 3JTJA 3OH2A 2YCMA 3ZGFA 4ASYA 1VICA 1O7OA 3I0GA 5FU8A 2AM3A 1FWYA 2FYBA 3E25A 5CMIA 2WE9A 4B4BA 1VZTA 4JD0A 3DJ4A 2RJ6A 2WEEA 2O1HA 1QG8A 2ZU7A 1E5KA 4Y9XA 2WVMA 4EEMA 1NF5B 2X60A 1HM0A 1HM9A 2Y7AA 4EEAA 3OH3A 3OH1A 4FRQA 1FGXA 1GA8A 2ICYA 3DUVA 2VXMA 2O1GA 3D5NA 3TQDA 3QVBA 2X5SA 2WAWA 3RMWA 2FFVA 4UEGA 4FRDA 2VS4A 2ICXA 2PX7A 4G3SA 2I5KA 5AJNA 2RIZA 1FZWA 1H5TB 5C1HA 2XMHA 1FXOA 3U2XA 4KPXA 5CMFX 1WT1A 4ECMA 3DK5A 2P73A 1MC3A 4HO9A 1VM8A 1WT2A 1ZI3A 2AGDA 5EJ1A 3SXCA 3SX8A 1R81A 2ZU8A 1HM8A 1TW1A 3CU0A 1HJJA 1INJA 3SPTA 2VD4A 3HL3A 4B4MA 1G95A 2GGQA 2QGIA 5C1LA 1O23B 4B3UA 3PNNA 1GWWA 4G3QA 2E8BA 3R2WA 3OC9A 4IRPA 1VZXA 1XZ6A 2XWNA 4LW3A 1ZJPA 3OH0A 4M2BA 4Y7FA 2AESA 2VFZA 5CMGX 1VH3A 4FREA 2GGOA 4FRHA 3SXGA 5AJPA 2OI5A 1ON8A 4CJCA 4HO0A 4O6MA 3EE5A 4DECA 1G0RA 1R7YA 2QH5A 1I52A 2ZU9A 3BRKX 1R82A 2RJ4A 2WGZA 3U2WA 1LZ7A 3ZLLA 2AM5A 1H4DA 1GQCA 2YQHA 4DDZA 2JCKA 3CKVA 3V0MA 3JUJA 3FWWA 1VGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KPZ A;  2RJ1 A;  2OEG A;  1H4E A;  2RJ9 A;  2RIY A;  4NAL A;  2RJ5 A;  3RMV A;  3IOJ A;  1ZCT A;  2V0L A;  5C4B A;  2FYD B;  1ZI1 A;  5EJZ A;  3ZF8 A;  2FFU A;  1R7T A;  1H7Q A;  2Y6P A;  4IRQ A;  2UX8 A;  5L6V A;  2P6W A;  3I0L A;  1V82 A;  1QWJ A;  2D7I A;  4KT7 A;  4CJB A;  5C49 A;  4D48 A;  3I0D A;  1ON6 A;  2I7B A;  1ZI4 A;  3U2U A;  2FYC B;  1JYK A;  1TW5 A;  2BO4 A;  3CKN A;  3LW6 A;  4FRL A;  2PA4 A;  2Y4J A;  4EEO A;  5C4E A;  1S4P A;  3V8Z A;  1G1L A;  4K6R A;  1IIM A;  3V0O A;  4AAW A;  2XME A;  1JYL A;  3ST8 A;  3CKO A;  1TZF A;  1H5R A;  3V0Q A;  3V91 A;  2A8U A;  5C38 A;  2BO6 A;  2RJ0 A;  1GX4 A;  1EZI A;  4ARW A;  4HG6 A;  4EE3 A;  1G97 A;  1JVD A;  4BQH A;  5FTV A;  1PZY B;  3CKQ A;  1YP4 A;  3ZGG A;  1W77 A;  3ZLK A;  4D0Z A;  2YC3 A;  5FYE A;  3PKQ A;  1LZ0 A;  5IDS A;  5CQP A;  1FG5 N;  1S4N A;  4FCU A;  2O1F A;  1S4O A;  1V84 A;  5EIY A;  5C1G A;  1VGZ A;  1JVG A;  2Z86 A;  5L6S A;  1H3M A;  1MP5 A;  1WT0 A;  3I0H A;  1FO9 A;  3USR A;  4M28 A;  3SX5 A;  4P00 A;  1NKH B;  4KXO A;  4FCE A;  1VH1 A;  4Y7T A;  4B2X A;  4Y62 A;  1QGS A;  3RSB A;  4L41 C;  2Y4K A;  1OMZ A;  3FOQ A;  3CGX A;  1YP3 A;  3I0I X;  3Q4S A;  4HO3 A;  3V8Y A;  3V0P A;  1H7H A;  4G3P A;  3CKJ A;  2JCJ A;  4ASJ A;  1FR8 A;  3POL A;  3OAM A;  4B5B A;  1MP3 A;  4KNX A;  2YC5 A;  1V83 A;  2X65 A;  3OKR A;  2A8W A;  3V90 A;  1GX0 A;  3GUE A;  3I0C A;  4EVW A;  1YP2 A;  5JQQ A;  3BCV A;  1R7V A;  1K4V A;  4HO2 A;  4G87 A;  2YQJ A;  1H5S D;  4B4G A;  3D98 A;  2V0H A;  1FRW A;  2RJ8 A;  4MND A;  1G3L A;  1GQ9 A;  2V0J A;  3Q80 A;  3SX7 A;  4FRO A;  2XWL A;  1G93 A;  1MP4 A;  4FRB A;  4Y7G A;  5CMH A;  1ZJ0 A;  1ZDF A;  2XWM A;  5C3D A;  4HO8 A;  1TVY A;  2PGV A;  4AYL A;  4EE4 A;  2JCO A;  4FRM A;  4Y7U A;  1H5R B;  1O0R A;  1R7X A;  1W57 A;  5CMJ A;  2NXV A;  2APC A;  3N9W A;  2W0V A;  1NWG B;  1O7Q A;  2Y4L A;  2AM4 A;  2X5Z A;  2I5E A;  4KQL A;  2W0W A;  1G2V A;  5C4F A;  2FY7 A;  1PZT A;  4EE5 A;  1FXJ A;  1ZJ1 A;  4EEG A;  2RIT A;  5CQN X;  4MYB A;  4AYJ A;  1H7E A;  1ZJO A;  1H7G A;  4HCQ A;  1VZU A;  1FOA A;  4J18 A;  1H5S C;  3I0F A;  4M2A A;  4Y63 A;  1JV3 A;  4DE7 A;  5FUH A;  1G23 A;  1H4C A;  2WVL A;  1G8O A;  1R7U A;  2P72 A;  4GBP A;  4Y7V A;  1VPA A;  2YES A;  2VSH A;  4FQW A;  3JUK A;  1ZHJ A;  1H5S A;  4KNR A;  3O3P A;  2YQS A;  2D7R A;  2RIX A;  5I1F A;  1LL2 A;  5DDV A;  1QGQ A;  4FRA A;  2YQC A;  1VGU A;  2VSI A;  3USQ A;  5DDT A;  5IDT A;  4CVH A;  2PGY A;  2AE7 A;  2Z87 A;  2V0K A;  1ZJ3 A;  1FGG A;  3IOI A;  5AJO A;  1H7T A;  5C47 A;  2OI6 A;  1JV1 A;  1NMM B;  3T7M A;  2V0I A;  1LVW A;  4HO6 A;  2AEC A;  1WSZ A;  3R3I A;  4NAI A;  4LW6 A;  4M4K A;  1ZCU A;  2Y4M A;  2CU2 A;  1SS9 A;  4KC4 A;  3I0E A;  5C4C A;  2FYA A;  2BO7 A;  4R7P A;  4NAK A;  1VGT A;  4Y64 A;  2QKX A;  1OQM B;  1ZJ2 A;  4B42 A;  5CQO A;  1ZDG A;  4JIS A;  1FO8 A;  3SX3 A;  3V0L A;  5C3B A;  1LL3 A;  4KC1 A;  4P02 A;  2DPW A;  3I0J A;  5FTS A;  3T7N A;  3U0Y A;  5IFY A;  3U0X A;  3K8D A;  2MZB A;  3SXE A;  1IIN A;  2WVK A;  4XWI A;  5J49 A;  4Y6U A;  1LZI A;  4E1K A;  1HJL A;  5C4D A;  3E26 A;  1GWV A;  1NHE B;  4NAN A;  3F1C A;  5C48 A;  4D11 C;  1YRO B;  1KWS A;  1H7L A;  2BO8 A;  2OEF A;  3Q7U A;  2RJ7 A;  3SXD A;  3SXA A;  1LZJ A;  1G9R A;  3D8V A;  4FRP A;  3K8E A;  1HV9 A;  1Z90 A;  1ZI5 A;  1OMX A;  4BMA A;  1FR9 A;  4D11 A;  4B2W A;  1H5S B;  4KRV A;  2Q4J A;  1LL0 A;  3OH4 A;  3PKP A;  1INI A;  3T7O A;  3KIA A;  2AH9 A;  4AC3 A;  2VS5 A;  1H5T A;  1R80 A;  3U2T A;  3NGW A;  1ZCV A;  5BXC A;  5C36 A;  3IOH A;  2VS3 A;  3SXB A;  4C2S A;  5CQM X;  2VXL A;  4KC2 A;  3OGZ A;  1H7F A;  3U2V A;  5CQL X;  3V0N A;  5C8R A;  1NQI B;  2D0J A;  4HO5 A;  1WT3 A;  2E3D A;  4HOC A;  1XHB A;  5HS2 A;  5C3A A;  1EYR A;  1ZIZ A;  4ZDQ A;  4HO4 A;  4CJ8 A;  5FV9 A;  3I0K A;  2OI7 A;  1ZCY A;  4YS8 A;  2JCL A;  3TZT A;  4Y6N A;  4D0T A;  3F1Y A;  1W55 A;  1WVC A;  5FU0 A;  3JTJ A;  3OH2 A;  2YCM A;  3ZGF A;  4ASY A;  1VIC A;  1O7O A;  3I0G A;  5FU8 A;  2AM3 A;  1FWY A;  2FYB A;  3E25 A;  5CMI A;  2WE9 A;  4B4B A;  1VZT A;  4JD0 A;  3DJ4 A;  2RJ6 A;  2WEE A;  2O1H A;  1QG8 A;  2ZU7 A;  1E5K A;  4Y9X A;  2WVM A;  4EEM A;  1NF5 B;  2X60 A;  1HM0 A;  1HM9 A;  2Y7A A;  4EEA A;  3OH3 A;  3OH1 A;  4FRQ A;  1FGX A;  1GA8 A;  2ICY A;  3DUV A;  2VXM A;  2O1G A;  3D5N A;  3TQD A;  3QVB A;  2X5S A;  2WAW A;  3RMW A;  2FFV A;  4UEG A;  4FRD A;  2VS4 A;  2ICX A;  2PX7 A;  4G3S A;  2I5K A;  5AJN A;  2RIZ A;  1FZW A;  1H5T B;  5C1H A;  2XMH A;  1FXO A;  3U2X A;  4KPX A;  5CMF X;  1WT1 A;  4ECM A;  3DK5 A;  2P73 A;  1MC3 A;  4HO9 A;  1VM8 A;  1WT2 A;  1ZI3 A;  2AGD A;  5EJ1 A;  3SXC A;  3SX8 A;  1R81 A;  2ZU8 A;  1HM8 A;  1TW1 A;  3CU0 A;  1HJJ A;  1INJ A;  3SPT A;  2VD4 A;  3HL3 A;  4B4M A;  1G95 A;  2GGQ A;  2QGI A;  5C1L A;  1O23 B;  4B3U A;  3PNN A;  1GWW A;  4G3Q A;  2E8B A;  3R2W A;  3OC9 A;  4IRP A;  1VZX A;  1XZ6 A;  2XWN A;  4LW3 A;  1ZJP A;  3OH0 A;  4M2B A;  4Y7F A;  2AES A;  2VFZ A;  5CMG X;  1VH3 A;  4FRE A;  2GGO A;  4FRH A;  3SXG A;  5AJP A;  2OI5 A;  1ON8 A;  4CJC A;  4HO0 A;  3EE5 A;  4DEC A;  1G0R A;  1R7Y A;  2QH5 A;  1I52 A;  2ZU9 A;  3BRK X;  1R82 A;  2RJ4 A;  2WGZ A;  3U2W A;  1LZ7 A;  3ZLL A;  2AM5 A;  1H4D A;  1GQC A;  2YQH A;  4DDZ A;  2JCK A;  3CKV A;  3V0M A;  3JUJ A;  3FWW A;  1VGW A; 
#chains in the Genus database with same CATH topology
 4NAZ A;  4KYH A;  4Z6N A;  4KPZ A;  2RJ1 A;  2OEG A;  1H4E A;  4Z6W A;  2RJ9 A;  2RIY A;  2ZW5 A;  4NAL A;  3OUM A;  4FIX A;  2RJ5 A;  3RMV A;  3IOJ A;  1ZCT A;  2V0L A;  5C4B A;  3R4Q A;  2FYD B;  1ZI1 A;  5EJZ A;  3ZF8 A;  3HPY A;  2FFU A;  1R7T A;  1H7Q A;  2Y6P A;  4IRQ A;  4NB1 A;  2UX8 A;  5L6V A;  2P6W A;  3I0L A;  1V82 A;  1QWJ A;  2D7I A;  4KT7 A;  4CJB A;  5C49 A;  4D48 A;  3I0D A;  1T47 A;  1ON6 A;  2I7B A;  1ZI4 A;  3U2U A;  2FYC B;  1JYK A;  1TW5 A;  2BO4 A;  3CKN A;  3W0U A;  3LW6 A;  4JD1 A;  4FRL A;  2PA4 A;  4QB5 A;  2Y4J A;  4EEO A;  5C4E A;  3ZI1 A;  1S4P A;  3V8Z A;  1G1L A;  4K6R A;  1IIM A;  2J0B A;  3V0O A;  4IR0 A;  4AAW A;  2XME A;  4GHH A;  3FCD A;  1JYL A;  3ST8 A;  3CKO A;  3OAJ A;  1TZF A;  3VW9 A;  1H5R A;  1NNR A;  2A8U A;  3V0Q A;  3V91 A;  2BO6 A;  2P7K A;  5C38 A;  4Z6Z A;  2RJ0 A;  1GX4 A;  1EZI A;  1KW6 B;  4ARW A;  4HG6 A;  1XY7 A;  4EE3 A;  1FA6 A;  4MTT A;  5CJ3 A;  5DFG A;  1G97 A;  1JVD A;  4Z6P A;  4BQH A;  3OA4 A;  4LQB A;  5FTV A;  2A4W A;  2QQZ A;  1PZY B;  3CKQ A;  1SS4 A;  1YP4 A;  3EY7 A;  3ZGG A;  2ZI8 A;  1W77 A;  3ZLK A;  4D0Z A;  1JIF A;  2YC3 A;  5FYE A;  3PKQ A;  1LZ0 A;  5IDS A;  5KEF A;  2Q48 A;  5CQP A;  1FG5 N;  1S4N A;  4FCU A;  3ECJ A;  1F1U A;  3BQX A;  2O1F A;  1S4O A;  1V84 A;  5EIY A;  1Q0O A;  5C1G A;  1VGZ A;  1JVG A;  2Z86 A;  5L6S A;  1H3M A;  1ZSW A;  1MP5 A;  2P25 A;  1WT0 A;  2P7L A;  3I0H A;  1FA7 A;  1FO9 A;  3PKX A;  4G6X A;  3USR A;  4M28 A;  3SX5 A;  4P00 A;  1SP9 A;  1NKH B;  4FCE A;  4KXO A;  1VH1 A;  4Y7T A;  4B2X A;  4Y62 A;  2ZW6 A;  1QGS A;  3RSB A;  4L41 C;  1F9Z A;  2WL3 A;  1LQP A;  4KYK A;  2EI1 A;  2Y4K A;  1OMZ A;  4Q7C A;  4FIY A;  2RJB A;  3CGX A;  3FOQ A;  4X2A A;  1YP3 A;  3I0I X;  3Q4S A;  4HO3 A;  3V8Y A;  3V0P A;  1H7H A;  4G3P A;  3CKJ A;  2JCJ A;  4ASJ A;  1FR8 A;  3POL A;  3OAM A;  4B5B A;  1MP3 A;  4KNX A;  1TG5 A;  3HNQ A;  2YC5 A;  2RK0 A;  1V83 A;  2X65 A;  3OKR A;  2A8W A;  3V90 A;  1GX0 A;  3GUE A;  3I0C A;  4EVW A;  1YP2 A;  5JQQ A;  3HUH A;  1JC4 A;  3BCV A;  1R7V A;  1K4V A;  4HO2 A;  4G87 A;  2YQJ A;  1H5S D;  4B4G A;  3D98 A;  2V0H A;  1FRW A;  4JH6 A;  2RJ8 A;  4MND A;  1G3L A;  1GQ9 A;  1XRK A;  2V0J A;  3GM5 A;  4JH2 A;  3Q80 A;  3SX7 A;  4FRO A;  2XWL A;  1G93 A;  1MP4 A;  4FRB A;  4Y7G A;  5CMH A;  4GHG A;  1ZJ0 A;  1MPY A;  1ZDF A;  2XWM A;  5C3D A;  4PV5 A;  4HO8 A;  1TVY A;  2PGV A;  4AYL A;  4EE4 A;  2JCO A;  3LM4 A;  1KMY A;  4FRM A;  1EWJ A;  4Z6R A;  1EIL A;  3E5D A;  4Y7U A;  1H5R B;  1O0R A;  1R7X A;  1W57 A;  5CMJ A;  1KLL A;  2IG9 A;  2NXV A;  2APC A;  3N9W A;  2W0V A;  1NWG B;  1O7Q A;  2Y4L A;  2AM4 A;  1HAN A;  2I5E A;  2X5Z A;  2W0W A;  4KQL A;  1G2V A;  5C4F A;  2FY7 A;  4Z6L A;  1PZT A;  4EE5 A;  1FXJ A;  2R5V A;  1ZJ1 A;  4EEG A;  2RIT A;  5CQN X;  4MYB A;  4AYJ A;  5C68 A;  1H7E A;  1ZJO A;  2ZW7 A;  1H7G A;  4JH3 A;  4HCQ A;  1BH5 A;  1VZU A;  1FOA A;  2IGA A;  1H5S C;  1SP8 A;  3I0F A;  4J18 A;  4M2A A;  4Y63 A;  1JV3 A;  4DE7 A;  3ZW5 A;  1QTO A;  2EI2 A;  1G23 A;  1H4C A;  2WVL A;  5FUH A;  1G8O A;  1R7U A;  2P72 A;  4GBP A;  4Y7V A;  1KNF A;  4GYM A;  1VPA A;  2YES A;  2VSH A;  4FQW A;  3JUK A;  1ZHJ A;  1H5S A;  4KNR A;  3O3P A;  2YQS A;  1U69 A;  2D7R A;  2RIX A;  5I1F A;  1LL2 A;  5DDV A;  3EY8 A;  4Z6S A;  1QGQ A;  5F6Q A;  3KOL A;  4FRA A;  2YQC A;  3L20 A;  1QIN A;  1VGU A;  2VSI A;  3USQ A;  5DDT A;  5IDT A;  4CVH A;  2VK9 A;  2PGY A;  2AE7 A;  1K4N A;  2Z87 A;  2V0K A;  3HDP A;  1ZJ3 A;  1BYL A;  1FGG A;  3IOI A;  5AJO A;  2I7R A;  3OPY B;  4MTS A;  1H7T A;  5C47 A;  3RHE A;  3IUZ A;  5BWG A;  2OI6 A;  1FA5 A;  2RBB A;  1F1X A;  1JV1 A;  1NMM B;  5CTO A;  3T7M A;  2V0I A;  1LVW A;  4HO6 A;  2AEC A;  1KND A;  3HQ0 A;  1WSZ A;  3R3I A;  4NAI A;  4LW6 A;  3VB0 A;  4M4K A;  3SK2 A;  1ZCU A;  2Y4M A;  2CU2 A;  1SS9 A;  2EI0 A;  1LGT A;  4KC4 A;  4GHE A;  3I0E A;  5C4C A;  3PKV A;  2FYA A;  1ECS A;  2BO7 A;  3W0T A;  4R7P A;  4NB0 A;  4NAK A;  1VGT A;  4Y64 A;  2QKX A;  1OQM B;  1ZJ2 A;  4B42 A;  5CQO A;  2P7Q A;  3E0R A;  1ZDG A;  4JIS A;  2C21 A;  4Z6U A;  3LHO A;  1FO8 A;  3SX3 A;  3PKW A;  3V0L A;  5C3B A;  1LL3 A;  1JIE A;  4KC1 A;  4P02 A;  2ZHP A;  2DPW A;  2EHZ A;  3I0J A;  5CB9 A;  5FTS A;  3T7N A;  3U0Y A;  5IFY A;  3U0X A;  3GHJ A;  3K8D A;  2MZB A;  3L7T A;  3SXE A;  2P7P A;  1IIN A;  2WVK A;  4XWI A;  5D92 A;  5J49 A;  4Y6U A;  1LZI A;  1SQI A;  4E1K A;  3OJK A;  1HJL A;  3E26 A;  5C4D A;  1GWV A;  1NHE B;  4NAN A;  3F1C A;  5C48 A;  3OXH A;  4MTQ A;  4D11 C;  1YRO B;  1KWS A;  1H7L A;  2BO8 A;  2OEF A;  3Q7U A;  2RJ7 A;  5D4F A;  5D91 A;  3SXD A;  3SXA A;  1LQK A;  1LZJ A;  3OJN A;  1G9R A;  3D8V A;  4FRP A;  3K8E A;  1HV9 A;  1Z90 A;  1ZI5 A;  1OMX A;  4O6N A;  4BMA A;  1XQA A;  1FR9 A;  4D11 A;  4B2W A;  4NB2 A;  1H5S B;  2Q4J A;  4KRV A;  1LL0 A;  4Z6O A;  3OH4 A;  3PKP A;  1INI A;  5BWH A;  3T7O A;  3KIA A;  2AH9 A;  4AC3 A;  4JH8 A;  3B59 A;  4IAG A;  1H5T A;  1R80 A;  2VS5 A;  3U2T A;  2A4X A;  5C6X A;  3NGW A;  1ZCV A;  5BXC A;  1EIQ A;  5C36 A;  3IOH A;  2J0A A;  2VS3 A;  1NPB A;  3SXB A;  1TWU A;  4C2S A;  5CQM X;  2VXL A;  2R6U A;  3OGZ A;  1H7F A;  4KC2 A;  3U2V A;  5CQL X;  3V0N A;  5C8R A;  1NQI B;  1SQD A;  2ZYQ A;  2C0N A;  2D0J A;  4HO5 A;  4NVS A;  1WT3 A;  2E3D A;  4HOC A;  4HUZ A;  1XHB A;  5HS2 A;  1TSJ A;  4MIX A;  4Z6M A;  3R6A A;  5C3A A;  4GHD A;  3CT8 A;  4Z6T A;  1TFZ A;  1EYR A;  4MYM A;  1NKI A;  1ZIZ A;  4ZDQ A;  4HO4 A;  4CJ8 A;  5FV9 A;  3I0K A;  4HC5 A;  2OI7 A;  5HCW A;  1ZCY A;  4YS8 A;  2JCL A;  3TZT A;  1KWC B;  4Y6N A;  4D0T A;  3F1Y A;  1QIP A;  1U6L A;  1W55 A;  1WVC A;  5FU0 A;  3JTJ A;  3OH2 A;  2YCM A;  4GHC A;  3ZGF A;  4ASY A;  1VIC A;  1O7O A;  1FA8 A;  3I0G A;  5FU8 A;  2AM3 A;  1FWY A;  3BZA A;  2FYB A;  3E25 A;  5CMI A;  2WE9 A;  4B4B A;  1VZT A;  4JD0 A;  3DJ4 A;  2RJ6 A;  2WEE A;  3OJT A;  1CJX A;  2O1H A;  1QG8 A;  4Z04 A;  2ZU7 A;  1E5K A;  4Y9X A;  2WVM A;  4EEM A;  1NF5 B;  2X60 A;  1HM0 A;  1HM9 A;  2Y7A A;  1KMZ A;  4NAY A;  4EEA A;  3OH3 A;  3OH1 A;  4FRQ A;  1FGX A;  1GA8 A;  1KW9 B;  2ICY A;  3DUV A;  2VXM A;  2O1G A;  3ECK A;  2P7M A;  1NIQ B;  4MTR A;  3D5N A;  1FRO A;  3TQD A;  3ISQ A;  1LKD A;  3OUL A;  3HPV A;  3QVB A;  1R9C A;  2X5S A;  2WAW A;  3G12 A;  3RMW A;  4JH4 A;  2FFV A;  4UEG A;  4FRD A;  4PAV A;  2VS4 A;  2ICX A;  2PX7 A;  4G3S A;  2I5K A;  5AJN A;  3P8A A;  2RIZ A;  1KW8 B;  1FZW A;  4RT5 A;  1H5T B;  5C1H A;  2XMH A;  1FXO A;  1JC5 A;  3U2X A;  4KPX A;  5CMF X;  1WT1 A;  4ECM A;  3DK5 A;  1KW3 B;  2P73 A;  1MC3 A;  4HO9 A;  1VM8 A;  5C4P A;  1WT2 A;  2ZW4 A;  4Z6Q A;  2P7O A;  2RK9 A;  1ZI3 A;  2AGD A;  5EJ1 A;  3SXC A;  3SX8 A;  1R81 A;  2ZU8 A;  1HM8 A;  1F1V A;  1TW1 A;  3CU0 A;  1HJJ A;  1INJ A;  3SPT A;  1DHY A;  2VD4 A;  3HL3 A;  5D7Z A;  4B4M A;  5DRH A;  1G95 A;  4OPN A;  4N04 A;  2GGQ A;  2QGI A;  5C1L A;  4GHF A;  1O23 B;  3PNN A;  4B3U A;  1F1R A;  3OPY A;  2QNT A;  3OJJ A;  4JH1 A;  5DHW A;  1GWW A;  2E8B A;  3R2W A;  4G3Q A;  1LQO A;  3OC9 A;  4IRP A;  1VZX A;  1XZ6 A;  1MH6 A;  2XWN A;  4LW3 A;  2EI3 A;  1ZJP A;  4Z6V A;  3OH0 A;  4M2B A;  4JH7 A;  4Y7F A;  2AES A;  2VFZ A;  5CMG X;  4JH5 A;  1EIR A;  1VH3 A;  4FRE A;  3ZGJ A;  2GGO A;  4FRH A;  5EC3 A;  3SXG A;  5AJP A;  2OI5 A;  2WL9 A;  1ON8 A;  3RRI A;  4HO0 A;  4O6M A;  4CJC A;  3EE5 A;  4DEC A;  2QH0 A;  1G0R A;  1R7Y A;  2PJS A;  2QH5 A;  1I52 A;  2ZU9 A;  3BRK X;  1R82 A;  1Q0C A;  4JH9 A;  3RMU A;  2ZA0 A;  2RJ4 A;  2WGZ A;  3U2W A;  1LZ7 A;  3ZLL A;  2AM5 A;  1H4D A;  1GQC A;  2YQH A;  4DDZ A;  1KWB B;  2JCK A;  3CKV A;  3V0M A;  3JUJ A;  3FWW A;  1VGW A; 
#chains in the Genus database with same CATH homology
 4KPZ A;  2RJ1 A;  2OEG A;  1H4E A;  2RJ9 A;  2RIY A;  4NAL A;  4FIX A;  2RJ5 A;  3RMV A;  3IOJ A;  1ZCT A;  2V0L A;  5C4B A;  2FYD B;  1ZI1 A;  5EJZ A;  3ZF8 A;  2FFU A;  1R7T A;  1H7Q A;  2Y6P A;  4IRQ A;  2UX8 A;  5L6V A;  2P6W A;  3I0L A;  1V82 A;  1QWJ A;  2D7I A;  4KT7 A;  4CJB A;  5C49 A;  4D48 A;  3I0D A;  1ON6 A;  2I7B A;  1ZI4 A;  3U2U A;  2FYC B;  1JYK A;  1TW5 A;  2BO4 A;  3CKN A;  3LW6 A;  4FRL A;  2PA4 A;  2Y4J A;  4EEO A;  5C4E A;  1S4P A;  3V8Z A;  1G1L A;  4K6R A;  1IIM A;  2J0B A;  3V0O A;  4AAW A;  2XME A;  1JYL A;  3ST8 A;  3CKO A;  1TZF A;  1H5R A;  3V0Q A;  3V91 A;  2A8U A;  5C38 A;  2BO6 A;  2RJ0 A;  1GX4 A;  1EZI A;  4ARW A;  4HG6 A;  4EE3 A;  1G97 A;  1JVD A;  4BQH A;  5FTV A;  1PZY B;  3CKQ A;  1YP4 A;  3ZGG A;  1W77 A;  3ZLK A;  4D0Z A;  2YC3 A;  5FYE A;  3PKQ A;  1LZ0 A;  5IDS A;  5CQP A;  1FG5 N;  1S4N A;  4FCU A;  2O1F A;  1S4O A;  1V84 A;  5EIY A;  5C1G A;  1VGZ A;  1JVG A;  2Z86 A;  5L6S A;  1H3M A;  1MP5 A;  1WT0 A;  3I0H A;  1FO9 A;  3USR A;  4M28 A;  3SX5 A;  4P00 A;  1NKH B;  4KXO A;  4FCE A;  1VH1 A;  4Y7T A;  4B2X A;  4Y62 A;  1QGS A;  3RSB A;  4L41 C;  2Y4K A;  1OMZ A;  4Q7C A;  4FIY A;  3FOQ A;  3CGX A;  1YP3 A;  3I0I X;  3Q4S A;  4HO3 A;  3V8Y A;  3V0P A;  1H7H A;  4G3P A;  3CKJ A;  2JCJ A;  4ASJ A;  1FR8 A;  3POL A;  3OAM A;  4B5B A;  1MP3 A;  4KNX A;  2YC5 A;  1V83 A;  2X65 A;  3OKR A;  2A8W A;  3V90 A;  1GX0 A;  3GUE A;  3I0C A;  4EVW A;  1YP2 A;  5JQQ A;  3BCV A;  1R7V A;  1K4V A;  4HO2 A;  4G87 A;  2YQJ A;  1H5S D;  4B4G A;  3D98 A;  2V0H A;  1FRW A;  2RJ8 A;  4MND A;  1G3L A;  1GQ9 A;  2V0J A;  3Q80 A;  3SX7 A;  4FRO A;  2XWL A;  1G93 A;  1MP4 A;  4FRB A;  4Y7G A;  5CMH A;  1ZJ0 A;  1ZDF A;  2XWM A;  5C3D A;  4HO8 A;  1TVY A;  2PGV A;  4AYL A;  4EE4 A;  2JCO A;  4FRM A;  4Y7U A;  1H5R B;  1O0R A;  1R7X A;  1W57 A;  5CMJ A;  2NXV A;  2APC A;  3N9W A;  2W0V A;  1NWG B;  1O7Q A;  2Y4L A;  2AM4 A;  2X5Z A;  2I5E A;  4KQL A;  2W0W A;  1G2V A;  5C4F A;  2FY7 A;  1PZT A;  4EE5 A;  1FXJ A;  1ZJ1 A;  4EEG A;  2RIT A;  5CQN X;  4MYB A;  4AYJ A;  1H7E A;  1ZJO A;  1H7G A;  4HCQ A;  1VZU A;  1FOA A;  4J18 A;  1H5S C;  3I0F A;  4M2A A;  4Y63 A;  1JV3 A;  4DE7 A;  5FUH A;  1G23 A;  1H4C A;  2WVL A;  1G8O A;  1R7U A;  2P72 A;  4GBP A;  4Y7V A;  1VPA A;  2YES A;  2VSH A;  4FQW A;  3JUK A;  1ZHJ A;  1H5S A;  4KNR A;  3O3P A;  2YQS A;  2D7R A;  2RIX A;  5I1F A;  1LL2 A;  5DDV A;  1QGQ A;  4FRA A;  2YQC A;  1VGU A;  2VSI A;  3USQ A;  5DDT A;  5IDT A;  4CVH A;  2VK9 A;  2PGY A;  2AE7 A;  2Z87 A;  2V0K A;  1ZJ3 A;  1FGG A;  3IOI A;  5AJO A;  1H7T A;  5C47 A;  2OI6 A;  1JV1 A;  1NMM B;  3T7M A;  2V0I A;  1LVW A;  4HO6 A;  2AEC A;  1WSZ A;  3R3I A;  4NAI A;  4LW6 A;  4M4K A;  1ZCU A;  2Y4M A;  2CU2 A;  1SS9 A;  4KC4 A;  3I0E A;  5C4C A;  2FYA A;  2BO7 A;  4R7P A;  4NAK A;  1VGT A;  4Y64 A;  2QKX A;  1OQM B;  1ZJ2 A;  4B42 A;  5CQO A;  1ZDG A;  4JIS A;  1FO8 A;  3SX3 A;  3V0L A;  5C3B A;  1LL3 A;  4KC1 A;  4P02 A;  2DPW A;  3I0J A;  5FTS A;  3T7N A;  3U0Y A;  5IFY A;  3U0X A;  3K8D A;  2MZB A;  3SXE A;  1IIN A;  2WVK A;  4XWI A;  5D92 A;  5J49 A;  4Y6U A;  1LZI A;  4E1K A;  1HJL A;  5C4D A;  3E26 A;  1GWV A;  1NHE B;  4NAN A;  3F1C A;  5C48 A;  4D11 C;  1YRO B;  1KWS A;  1H7L A;  2BO8 A;  2OEF A;  3Q7U A;  2RJ7 A;  5D91 A;  3SXD A;  3SXA A;  1LZJ A;  1G9R A;  3D8V A;  4FRP A;  3K8E A;  1HV9 A;  1Z90 A;  1ZI5 A;  1OMX A;  4O6N A;  4BMA A;  1FR9 A;  4D11 A;  4B2W A;  1H5S B;  4KRV A;  2Q4J A;  1LL0 A;  3OH4 A;  3PKP A;  1INI A;  3T7O A;  3KIA A;  2AH9 A;  4AC3 A;  2VS5 A;  1H5T A;  1R80 A;  3U2T A;  3NGW A;  1ZCV A;  5BXC A;  5C36 A;  3IOH A;  2J0A A;  2VS3 A;  3SXB A;  4C2S A;  5CQM X;  2VXL A;  4KC2 A;  3OGZ A;  1H7F A;  3U2V A;  5CQL X;  3V0N A;  5C8R A;  1NQI B;  2C0N A;  2D0J A;  4HO5 A;  1WT3 A;  2E3D A;  4HOC A;  1XHB A;  5HS2 A;  4MIX A;  5C3A A;  1EYR A;  1ZIZ A;  4ZDQ A;  4HO4 A;  4CJ8 A;  5FV9 A;  3I0K A;  2OI7 A;  1ZCY A;  4YS8 A;  2JCL A;  3TZT A;  4Y6N A;  4D0T A;  3F1Y A;  1W55 A;  1WVC A;  5FU0 A;  3JTJ A;  3OH2 A;  2YCM A;  3ZGF A;  4ASY A;  1VIC A;  1O7O A;  3I0G A;  5FU8 A;  2AM3 A;  1FWY A;  2FYB A;  3E25 A;  5CMI A;  2WE9 A;  4B4B A;  1VZT A;  4JD0 A;  3DJ4 A;  2RJ6 A;  2WEE A;  2O1H A;  1QG8 A;  2ZU7 A;  1E5K A;  4Y9X A;  2WVM A;  4EEM A;  1NF5 B;  2X60 A;  1HM0 A;  1HM9 A;  2Y7A A;  4EEA A;  3OH3 A;  3OH1 A;  4FRQ A;  1FGX A;  1GA8 A;  2ICY A;  3DUV A;  2VXM A;  2O1G A;  3D5N A;  3TQD A;  3QVB A;  2X5S A;  2WAW A;  3RMW A;  2FFV A;  4UEG A;  4FRD A;  2VS4 A;  2ICX A;  2PX7 A;  4G3S A;  2I5K A;  5AJN A;  2RIZ A;  1FZW A;  1H5T B;  5C1H A;  2XMH A;  1FXO A;  3U2X A;  4KPX A;  5CMF X;  1WT1 A;  4ECM A;  3DK5 A;  2P73 A;  1MC3 A;  4HO9 A;  1VM8 A;  1WT2 A;  1ZI3 A;  2AGD A;  5EJ1 A;  3SXC A;  3SX8 A;  1R81 A;  2ZU8 A;  1HM8 A;  1TW1 A;  3CU0 A;  1HJJ A;  1INJ A;  3SPT A;  2VD4 A;  3HL3 A;  4B4M A;  1G95 A;  2GGQ A;  2QGI A;  5C1L A;  1O23 B;  4B3U A;  3PNN A;  1GWW A;  4G3Q A;  2E8B A;  3R2W A;  3OC9 A;  4IRP A;  1VZX A;  1XZ6 A;  2XWN A;  4LW3 A;  1ZJP A;  3OH0 A;  4M2B A;  4Y7F A;  2AES A;  2VFZ A;  5CMG X;  1VH3 A;  4FRE A;  2GGO A;  4FRH A;  3SXG A;  5AJP A;  2OI5 A;  1ON8 A;  4CJC A;  4HO0 A;  4O6M A;  3EE5 A;  4DEC A;  1G0R A;  1R7Y A;  2QH5 A;  1I52 A;  2ZU9 A;  3BRK X;  1R82 A;  2RJ4 A;  2WGZ A;  3U2W A;  1LZ7 A;  3ZLL A;  2AM5 A;  1H4D A;  1GQC A;  2YQH A;  4DDZ A;  2JCK A;  3CKV A;  3V0M A;  3JUJ A;  3FWW A;  1VGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...