4B42A

Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
293
structure length
293
Chain Sequence
MKRKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLGSASQRQTGASVFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIATLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLLTETVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
publication title Allosteric competitive inhibitors of the glucose-1-phosphate thymidylyltransferase (RmlA) from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 100
structure length 293
sequence length 293
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.74: 1L-myo-inositol 1-phosphate cytidylyltransferase.
pdb deposition date 2012-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4b42A00
1G97A 4KQLA 3T7OA 2VS5A 2YQCA 1H5SA 5C36A 1MC3A 2WAWA 3I0GA 1HM8A 3V0MA 1LL0A 1FR9A 2VD4A 2Y4MA 2D0JA 1H7TA 5CMFX 2P73A 4E1KA 1VZXA 4FCUA 5C3AA 2BO7A 1ZJPA 4KC2A 4B3UA 4Y6UA 4HO3A 2W0WA 4NALA 2V0HA 5FV9A 3Q4SA 3OKRA 1ZI1A 3U2UA 1G0RA 3CKOA 5EIYA 4NAIA 4ASYA 1ZCUA 2OI5A 1V83A 3CKVA 1WT0A 4Y63A 1EYRA 3DJ4A 5AJPA 2X5SA 4HG6A 2Y4JA 3DK5A 3OGZA 1H4DA 4EE3A 3BCVA 1K4VA 1W55A 3O3PA 2AH9A 1FXJA 2X60A 4EEAA 3D5NA 5CQMX 1XZ6A 1O7QA 2A8UA 1PZYB 4HO0A 5C49A 1NF5B 3SXCA 2VSHA 1INIA 2APCA 1VM8A 2YQHA 3I0IX 4P00A 2VXMA 3SPTA 3OH3A 4AYLA 4JISA 3U2TA 3V90A 2PGVA 1G93A 2RJ1A 3CKJA 3GUEA 4MNDA 5IDTA 1W77A 1ZCTA 4LW6A 1V84A 1H5SD 2P6WA 4NAKA 4FRBA 4CJBA 2Y7AA 2I5EA 2YC3A 4ASJA 2RJ8A 3JUKA 5JQQA 1WSZA 3SXDA 3U2XA 4CJ8A 5AJNA 2VSIA 5DDVA 2WVMA 5FU8A 4KPXA 2FFVA 2OEFA 1O7OA 1VICA 2RJ0A 3DUVA 4GBPA 4Y7VA 3Q80A 4K6RA 4KC1A 2Z87A 4B42A 1HV9A 3FWWA 1VZUA 3SXGA 2Z86A 2VFZA 5J49A 4Y6NA 3ZGGA 1VPAA 2YCMA 2D7IA 3ZLLA 5L6VA 4JD0A 1ZJ3A 5C47A 4FRAA 4FRHA 2WVKA 5C4EA 3E25A 3I0HA 1HJLA 1FGGA 4HO6A 1O0RA 4HO5A 1LZJA 3USQA 4B2XA 4KC4A 4D48A 1JYKA 3D98A 1G2VA 3RMWA 1TW5A 1OQMB 3PKQA 1FR8A 2AM4A 2O1GA 1VGZA 2AM5A 3V8ZA 4B5BA 3SX3A 2JCOA 2BO6A 3OH0A 2RJ7A 1HM0A 1H7LA 1ZJ2A 2RJ5A 2FYDB 2ICXA 2FYBA 3NGWA 2PX7A 5CQPA 4DECA 2OI6A 4B2WA 2WE9A 4EEMA 3T7MA 2O1HA 1G8OA 3F1CA 3U2VA 3T7NA 3I0CA 1EZIA 2RJ9A 2ZU9A 5CMGX 2MZBA 1R7TA 5FTSA 4HOCA 5HS2A 4FCEA 1V82A 1VH3A 3I0FA 4B4MA 4EEGA 2FYAA 3ZF8A 4AC3A 4HO4A 3V91A 3ZLKA 3SX7A 4Y7TA 1S4PA 4G87A 4KT7A 1QGQA 1ZJ0A 2DPWA 1H4CA 4KPZA 2YESA 1GQCA 3BRKX 3V0OA 4KNXA 3LW6A 1TZFA 3SXAA 4G3PA 1VGUA 3V0PA 1ON6A 4B4BA 1GX0A 1MP4A 2FYCB 5FTVA 2BO4A 3TZTA 1ZI3A 5L6SA 4EE4A 1WT1A 2D7RA 1G3LA 5FU0A 1YP4A 1NKHB 1VH1A 2NXVA 1S4NA 2E8BA 1MP5A 1R7XA 1FGXA 1JV3A 5C4CA 2QH5A 1PZTA 3HL3A 1H7FA 5I1FA 1GA8A 4Y62A 5EJ1A 1W57A 2XWMA 2Q4JA 4DE7A 1ZIZA 1LL2A 2A8WA 5C1GA 4M2AA 1ON8A 3V0LA 2ZU7A 2XMHA 5C8RA 2AESA 1JV1A 1G95A 1ZHJA 3I0EA 5C3BA 3V0NA 2VXLA 1ZI5A 2RIYA 5C48A 2VS3A 1VGWA 2AE7A 4IRPA 1LZ7A 2FFUA 1G9RA 2JCLA 2ZU8A 1KWSA 2WVLA 4C2SA 2WEEA 3FOQA 3F1YA 4NANA 2PA4A 4FREA 4MYBA 3U0YA 3K8EA 1GWWA 2QKXA 5CQLX 3JTJA 3ST8A 4HCQA 4CJCA 3CKQA 2CU2A 4M2BA 3K8DA 1ZCYA 1H5TA 4EE5A 1LL3A 1LVWA 5DDTA 2YC5A 1H7GA 1R7UA 1YP3A 1JVDA 1FZWA 1FXOA 1GWVA 2V0JA 2XMEA 4G3SA 1VZTA 5CMIA 1MP3A 4FRQA 2AM3A 3OC9A 2RIXA 1H5RA 4ARWA 2JCKA 2YQSA 4G3QA 2JCJA 3N9WA 1H5SC 1ZJ1A 4D0ZA 2XWNA 4M28A 1H7QA 1H3MA 1IIMA 2XWLA 4LW3A 4HO2A 4P02A 4Y7FA 5IDSA 2W0VA 2X65A 3I0DA 4FRPA 1FRWA 1YP2A 2I5KA 1ZDFA 1NQIB 4HO8A 3USRA 1IINA 4M4KA 1R7VA 2I7BA 4ECMA 1ZI4A 1NMMB 2RIZA 2AECA 3U0XA 4FRDA 3RSBA 3TQDA 2PGYA 1QG8A 1VGTA 1R7YA 5CQOA 3OH1A 1LZIA 3CU0A 1ZJOA 2UX8A 5FUHA 3SX5A 2X5ZA 2VS4A 1G1LA 2OEGA 4Y7GA 3ZGFA 4FRMA 3OH2A 2YQJA 3I0JA 4ZDQA 3E26A 2FY7A 4R7PA 1G23A 5CMHA 3I0LA 3D8VA 2V0LA 2Y6PA 1ZCVA 5C38A 4KNRA 1WVCA 1H7EA 4L41C 1NWGB 4Y64A 5CMJA 3PKPA 1YROB 1TW1A 4D11C 3V8YA 5IFYA 1SS9A 3JUJA 1FWYA 1HJJA 3QVBA 2Y4KA 3R2WA 4BQHA 4EVWA 1FO9A 1XHBA 1R81A 1R82A 3CGXA 4DDZA 3SXEA 4D11A 3Q7UA 5FYEA 3IOHA 2BO8A 1JYLA 1FG5N 4AYJA 1WT2A 3IOJA 2ICYA 1NHEB 1JVGA 5AJOA 3V0QA 2O1FA 1FO8A 1GQ9A 4CVHA 4YS8A 2WGZA 2GGOA 4FROA 4XWIA 3R3IA 4B4GA 1Z90A 2V0IA 1S4OA 1H5TB 1WT3A 1ZDGA 2Y4LA 1I52A 5C3DA 1QWJA 4KRVA 5BXCA 1TVYA 1O23B 4HO9A 1GX4A 4BMAA 4FQWA 3U2WA 1FOAA 2GGQA 1H5RB 4J18A 5C4FA 1H7HA 2V0KA 3SXBA 3OAMA 3RMVA 4FRLA 5C4BA 1R80A 3POLA 1LZ0A 3PNNA 3EE5A 3SX8A 2RJ6A 4IRQA 4Y9XA 1E5KA 3CKNA 3I0KA 1OMXA 3OH4A 4KXOA 1H5SB 4UEGA 2P72A 5C4DA 1H4EA 1QGSA 1HM9A 2OI7A 5CQNX 2QGIA 1INJA 2E3DA 5EJZA 2RITA 4EEOA 4Y7UA 1OMZA 5C1HA 3KIAA 2AGDA 3IOIA 4D0TA 4AAWA 5C1LA 2RJ4A
chains in the Genus database with same CATH superfamily
1G97A 4KQLA 3T7OA 2VS5A 2YQCA 1H5SA 5C36A 1MC3A 2WAWA 3I0GA 1HM8A 3V0MA 1LL0A 1FR9A 2VD4A 2Y4MA 2D0JA 1H7TA 5CMFX 2P73A 4E1KA 1VZXA 4FCUA 5C3AA 2BO7A 1ZJPA 4KC2A 4B3UA 4Y6UA 4HO3A 2W0WA 4NALA 2V0HA 5FV9A 3Q4SA 3OKRA 1ZI1A 3U2UA 1G0RA 3CKOA 5EIYA 4NAIA 4ASYA 1ZCUA 2OI5A 1V83A 3CKVA 1WT0A 4Y63A 1EYRA 3DJ4A 5AJPA 2X5SA 4HG6A 2Y4JA 3DK5A 3OGZA 1H4DA 4EE3A 3BCVA 1K4VA 4O6NA 1W55A 3O3PA 2AH9A 1FXJA 2X60A 4EEAA 3D5NA 5CQMX 1XZ6A 1O7QA 2A8UA 1PZYB 4HO0A 5C49A 1NF5B 3SXCA 2VSHA 1INIA 2APCA 1VM8A 2YQHA 3I0IX 4P00A 2VXMA 3SPTA 3OH3A 4AYLA 4JISA 3U2TA 3V90A 2PGVA 1G93A 2RJ1A 3CKJA 3GUEA 4MNDA 5IDTA 1W77A 1ZCTA 4LW6A 1V84A 1H5SD 2P6WA 4NAKA 4FRBA 4CJBA 2Y7AA 2I5EA 2YC3A 4O6MA 4ASJA 2RJ8A 3JUKA 5JQQA 1WSZA 3SXDA 3U2XA 4CJ8A 5AJNA 2VSIA 5DDVA 2WVMA 5FU8A 4KPXA 2FFVA 2OEFA 1O7OA 1VICA 2RJ0A 3DUVA 4GBPA 4Y7VA 3Q80A 4K6RA 4KC1A 2Z87A 4B42A 1HV9A 3FWWA 1VZUA 3SXGA 2Z86A 2VFZA 5J49A 4Y6NA 3ZGGA 1VPAA 2YCMA 2D7IA 3ZLLA 5L6VA 4JD0A 1ZJ3A 5C47A 4FRAA 4FRHA 2WVKA 5C4EA 3E25A 3I0HA 1HJLA 1FGGA 4HO6A 1O0RA 4HO5A 1LZJA 3USQA 4B2XA 4KC4A 4D48A 1JYKA 3D98A 1G2VA 3RMWA 1TW5A 1OQMB 3PKQA 1FR8A 2AM4A 2O1GA 1VGZA 2AM5A 3V8ZA 4B5BA 3SX3A 2JCOA 2BO6A 3OH0A 2RJ7A 1HM0A 1H7LA 1ZJ2A 2RJ5A 2FYDB 2ICXA 2FYBA 3NGWA 2PX7A 5CQPA 4DECA 2OI6A 4Q7CA 2WE9A 4B2WA 3T7MA 2O1HA 1G8OA 3F1CA 3U2VA 4EEMA 3T7NA 3I0CA 1EZIA 2RJ9A 2ZU9A 5CMGX 2MZBA 1R7TA 5FTSA 4HOCA 5HS2A 4FCEA 1V82A 1VH3A 3I0FA 4B4MA 4EEGA 2FYAA 3ZF8A 4AC3A 4HO4A 3V91A 3ZLKA 3SX7A 4Y7TA 1S4PA 4G87A 4KT7A 1QGQA 1ZJ0A 2DPWA 1H4CA 4KPZA 2YESA 1GQCA 3BRKX 3V0OA 2C0NA 4KNXA 3LW6A 1TZFA 3SXAA 4G3PA 2J0BA 1VGUA 3V0PA 1ON6A 4B4BA 1GX0A 1MP4A 2FYCB 5FTVA 2BO4A 3TZTA 2J0AA 1ZI3A 5L6SA 4EE4A 1WT1A 2D7RA 1G3LA 5FU0A 1YP4A 1NKHB 1VH1A 2NXVA 1S4NA 2E8BA 1MP5A 1R7XA 1FGXA 1JV3A 5C4CA 2QH5A 1PZTA 3HL3A 1H7FA 5I1FA 1GA8A 4Y62A 5EJ1A 1W57A 2XWMA 2Q4JA 4DE7A 1ZIZA 1LL2A 2A8WA 5C1GA 4M2AA 1ON8A 3V0LA 2ZU7A 2XMHA 5C8RA 2AESA 1JV1A 1G95A 1ZHJA 3I0EA 5C3BA 3V0NA 2VXLA 1ZI5A 2RIYA 5C48A 2VS3A 1VGWA 2AE7A 4IRPA 1LZ7A 2FFUA 1G9RA 2JCLA 2ZU8A 1KWSA 2WVLA 4C2SA 2WEEA 3FOQA 3F1YA 4NANA 2PA4A 4FREA 4MYBA 3U0YA 3K8EA 1GWWA 2QKXA 5CQLX 3JTJA 3ST8A 4HCQA 4CJCA 3CKQA 2CU2A 4M2BA 3K8DA 1ZCYA 1H5TA 4EE5A 1LL3A 1LVWA 4FIYA 5DDTA 2YC5A 1H7GA 1R7UA 1YP3A 1JVDA 1FZWA 1FXOA 1GWVA 2V0JA 2XMEA 4G3SA 1VZTA 5CMIA 1MP3A 4FRQA 2AM3A 3OC9A 2RIXA 1H5RA 4ARWA 2JCKA 2YQSA 4G3QA 2JCJA 3N9WA 1H5SC 1ZJ1A 4D0ZA 2XWNA 4M28A 1H7QA 1H3MA 1IIMA 2XWLA 4LW3A 4HO2A 4P02A 4Y7FA 5IDSA 2W0VA 2X65A 3I0DA 4FRPA 1FRWA 1YP2A 2I5KA 1ZDFA 1NQIB 4HO8A 3USRA 1IINA 4M4KA 1R7VA 2I7BA 4ECMA 1ZI4A 5D92A 1NMMB 2RIZA 2AECA 3U0XA 4FRDA 3RSBA 3TQDA 2PGYA 1QG8A 1VGTA 1R7YA 5CQOA 3OH1A 1LZIA 3CU0A 1ZJOA 2UX8A 5FUHA 3SX5A 2X5ZA 2VS4A 1G1LA 2OEGA 4Y7GA 3ZGFA 4FRMA 3OH2A 2YQJA 3I0JA 4ZDQA 3E26A 2FY7A 4R7PA 1G23A 5CMHA 3I0LA 3D8VA 2V0LA 2Y6PA 1ZCVA 5C38A 4KNRA 1WVCA 1H7EA 4L41C 1NWGB 4Y64A 5CMJA 3PKPA 1YROB 1TW1A 4D11C 3V8YA 5IFYA 1SS9A 3JUJA 1FWYA 1HJJA 3QVBA 2Y4KA 3R2WA 2VK9A 4BQHA 1FO9A 1XHBA 4EVWA 1R81A 1R82A 3CGXA 4DDZA 3SXEA 4D11A 3Q7UA 5FYEA 3IOHA 2BO8A 1JYLA 1FG5N 4AYJA 1WT2A 3IOJA 2ICYA 1NHEB 1JVGA 5AJOA 3V0QA 2O1FA 1FO8A 1GQ9A 4CVHA 4YS8A 2WGZA 2GGOA 4FROA 4XWIA 3R3IA 4B4GA 1Z90A 2V0IA 1S4OA 1H5TB 1WT3A 1ZDGA 2Y4LA 1I52A 5C3DA 1QWJA 4KRVA 5BXCA 1TVYA 1O23B 4HO9A 1GX4A 4BMAA 4FQWA 3U2WA 1FOAA 2GGQA 1H5RB 4J18A 5C4FA 1H7HA 2V0KA 3SXBA 3OAMA 3RMVA 4FRLA 5C4BA 1R80A 3POLA 1LZ0A 3PNNA 3EE5A 3SX8A 2RJ6A 4IRQA 4Y9XA 1E5KA 3CKNA 3I0KA 1OMXA 3OH4A 4KXOA 1H5SB 4UEGA 2P72A 5C4DA 1H4EA 1QGSA 1HM9A 2OI7A 5CQNX 2QGIA 1INJA 2E3DA 5EJZA 5D91A 4FIXA 2RITA 4EEOA 4Y7UA 1OMZA 5C1HA 3KIAA 2AGDA 3IOIA 4D0TA 4AAWA 5C1LA 4MIXA 2RJ4A
chains in the Genus database with same CATH topology
1G97A 4KQLA 3T7OA 2VS5A 2YQCA 1H5SA 5C36A 1MC3A 2WAWA 3I0GA 1HM8A 3V0MA 1LL0A 1FR9A 2VD4A 2Y4MA 2D0JA 1H7TA 5CMFX 2P73A 4E1KA 1VZXA 4FCUA 5C3AA 2BO7A 1ZJPA 4KC2A 4B3UA 4Y6UA 4HO3A 2W0WA 4NALA 2V0HA 5FV9A 3Q4SA 3OKRA 1ZI1A 3U2UA 1G0RA 3CKOA 5EIYA 4NAIA 4ASYA 1ZCUA 2OI5A 1V83A 3CKVA 1WT0A 4Y63A 1EYRA 3DJ4A 5AJPA 2X5SA 4HG6A 2Y4JA 3DK5A 3OGZA 1H4DA 4EE3A 3BCVA 1K4VA 4O6NA 1W55A 3O3PA 2AH9A 1FXJA 2X60A 4EEAA 3D5NA 5CQMX 1XZ6A 1O7QA 2A8UA 1PZYB 4HO0A 5C49A 1NF5B 3SXCA 2VSHA 1INIA 2APCA 1VM8A 2YQHA 3I0IX 4P00A 2VXMA 3SPTA 3OH3A 4AYLA 4JISA 3U2TA 3V90A 2PGVA 1G93A 2RJ1A 3CKJA 3GUEA 4MNDA 5IDTA 1W77A 1ZCTA 4LW6A 1V84A 1H5SD 2P6WA 4NAKA 4FRBA 4CJBA 2Y7AA 2I5EA 2YC3A 4O6MA 4ASJA 2RJ8A 3JUKA 5JQQA 1WSZA 3SXDA 3U2XA 4CJ8A 5AJNA 2VSIA 5DDVA 2WVMA 5FU8A 4KPXA 2FFVA 2OEFA 1O7OA 1VICA 2RJ0A 3DUVA 4GBPA 4Y7VA 3Q80A 4K6RA 4KC1A 2Z87A 4B42A 1HV9A 3FWWA 1VZUA 3SXGA 2Z86A 2VFZA 5J49A 4Y6NA 3ZGGA 1VPAA 2YCMA 2D7IA 3ZLLA 5L6VA 4JD0A 1ZJ3A 5C47A 4FRAA 4FRHA 2WVKA 5C4EA 3E25A 3I0HA 1HJLA 1FGGA 4HO6A 1O0RA 4HO5A 1LZJA 3USQA 4B2XA 4KC4A 4D48A 1JYKA 3D98A 1G2VA 3RMWA 1TW5A 1OQMB 3PKQA 1FR8A 2AM4A 2O1GA 1VGZA 2AM5A 3V8ZA 4B5BA 3SX3A 2JCOA 2BO6A 3OH0A 2RJ7A 1HM0A 1H7LA 1ZJ2A 2RJ5A 2FYDB 2ICXA 2FYBA 3NGWA 2PX7A 5CQPA 4DECA 2OI6A 4Q7CA 2WE9A 4B2WA 3T7MA 2O1HA 1G8OA 3F1CA 3U2VA 4EEMA 3T7NA 3I0CA 1EZIA 2RJ9A 2ZU9A 5CMGX 2MZBA 1R7TA 5FTSA 4HOCA 5HS2A 4FCEA 1V82A 1VH3A 3I0FA 4B4MA 4EEGA 2FYAA 3ZF8A 4AC3A 4HO4A 3V91A 3ZLKA 3SX7A 4Y7TA 1S4PA 4G87A 4KT7A 1QGQA 1ZJ0A 2DPWA 1H4CA 4KPZA 2YESA 1GQCA 3BRKX 3V0OA 2C0NA 4KNXA 3LW6A 1TZFA 3SXAA 4G3PA 2J0BA 1VGUA 3V0PA 1ON6A 4B4BA 1GX0A 1MP4A 2FYCB 5FTVA 2BO4A 3TZTA 2J0AA 1ZI3A 5L6SA 4EE4A 1WT1A 2D7RA 1G3LA 5FU0A 1YP4A 1NKHB 1VH1A 2NXVA 1S4NA 2E8BA 1MP5A 1R7XA 1FGXA 1JV3A 5C4CA 2QH5A 1PZTA 3HL3A 1H7FA 5I1FA 1GA8A 4Y62A 5EJ1A 1W57A 2XWMA 2Q4JA 4DE7A 1ZIZA 1LL2A 2A8WA 5C1GA 4M2AA 1ON8A 3V0LA 2ZU7A 2XMHA 5C8RA 2AESA 1JV1A 1G95A 1ZHJA 3I0EA 5C3BA 3V0NA 2VXLA 1ZI5A 2RIYA 5C48A 2VS3A 1VGWA 2AE7A 4IRPA 1LZ7A 2FFUA 1G9RA 2JCLA 2ZU8A 1KWSA 2WVLA 4C2SA 2WEEA 3FOQA 3F1YA 4NANA 2PA4A 4FREA 4MYBA 3U0YA 3K8EA 1GWWA 2QKXA 5CQLX 3JTJA 3ST8A 4HCQA 4CJCA 3CKQA 2CU2A 4M2BA 3K8DA 1ZCYA 1H5TA 4EE5A 1LL3A 1LVWA 4FIYA 5DDTA 2YC5A 1H7GA 1R7UA 1YP3A 1JVDA 1FZWA 1FXOA 1GWVA 2V0JA 2XMEA 4G3SA 1VZTA 5CMIA 1MP3A 4FRQA 2AM3A 3OC9A 2RIXA 1H5RA 4ARWA 2JCKA 2YQSA 4G3QA 2JCJA 3N9WA 1H5SC 1ZJ1A 4D0ZA 2XWNA 4M28A 1H7QA 1H3MA 1IIMA 2XWLA 4LW3A 4HO2A 4P02A 4Y7FA 5IDSA 2W0VA 2X65A 3I0DA 4FRPA 1FRWA 1YP2A 2I5KA 1ZDFA 1NQIB 4HO8A 3USRA 1IINA 4M4KA 1R7VA 2I7BA 4ECMA 1ZI4A 5D92A 1NMMB 2RIZA 2AECA 3U0XA 4FRDA 3RSBA 3TQDA 2PGYA 1QG8A 1VGTA 1R7YA 5CQOA 3OH1A 1LZIA 3CU0A 1ZJOA 2UX8A 5FUHA 3SX5A 2X5ZA 2VS4A 1G1LA 2OEGA 4Y7GA 3ZGFA 4FRMA 3OH2A 2YQJA 3I0JA 4ZDQA 3E26A 2FY7A 4R7PA 1G23A 5CMHA 3I0LA 3D8VA 2V0LA 2Y6PA 1ZCVA 5C38A 4KNRA 1WVCA 1H7EA 4L41C 1NWGB 4Y64A 5CMJA 3PKPA 1YROB 1TW1A 4D11C 3V8YA 5IFYA 1SS9A 3JUJA 1FWYA 1HJJA 3QVBA 2Y4KA 3R2WA 2VK9A 4BQHA 1FO9A 1XHBA 4EVWA 1R81A 1R82A 3CGXA 4DDZA 3SXEA 4D11A 3Q7UA 5FYEA 3IOHA 2BO8A 1JYLA 1FG5N 4AYJA 1WT2A 3IOJA 2ICYA 1NHEB 1JVGA 5AJOA 3V0QA 2O1FA 1FO8A 1GQ9A 4CVHA 4YS8A 2WGZA 2GGOA 4FROA 4XWIA 3R3IA 4B4GA 1Z90A 2V0IA 1S4OA 1H5TB 1WT3A 1ZDGA 2Y4LA 1I52A 5C3DA 1QWJA 4KRVA 5BXCA 1TVYA 1O23B 4HO9A 1GX4A 4BMAA 4FQWA 3U2WA 1FOAA 2GGQA 1H5RB 4J18A 5C4FA 1H7HA 2V0KA 3SXBA 3OAMA 3RMVA 4FRLA 5C4BA 1R80A 3POLA 1LZ0A 3PNNA 3EE5A 3SX8A 2RJ6A 4IRQA 4Y9XA 1E5KA 3CKNA 3I0KA 1OMXA 3OH4A 4KXOA 1H5SB 4UEGA 2P72A 5C4DA 1H4EA 1QGSA 1HM9A 2OI7A 5CQNX 2QGIA 1INJA 2E3DA 5EJZA 5D91A 4FIXA 2RITA 4EEOA 4Y7UA 1OMZA 5C1HA 3KIAA 2AGDA 3IOIA 4D0TA 4AAWA 5C1LA 4MIXA 2RJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G97 A;  4KQL A;  3T7O A;  2VS5 A;  2YQC A;  1H5S A;  5C36 A;  1MC3 A;  2WAW A;  3I0G A;  1HM8 A;  3V0M A;  1LL0 A;  1FR9 A;  2VD4 A;  2Y4M A;  2D0J A;  1H7T A;  5CMF X;  2P73 A;  4E1K A;  1VZX A;  4FCU A;  5C3A A;  2BO7 A;  1ZJP A;  4KC2 A;  4B3U A;  4Y6U A;  4HO3 A;  2W0W A;  4NAL A;  2V0H A;  5FV9 A;  3Q4S A;  3OKR A;  1ZI1 A;  3U2U A;  1G0R A;  3CKO A;  5EIY A;  4NAI A;  4ASY A;  1ZCU A;  2OI5 A;  1V83 A;  3CKV A;  1WT0 A;  4Y63 A;  1EYR A;  3DJ4 A;  5AJP A;  2X5S A;  4HG6 A;  2Y4J A;  3DK5 A;  3OGZ A;  1H4D A;  4EE3 A;  3BCV A;  1K4V A;  1W55 A;  3O3P A;  2AH9 A;  1FXJ A;  2X60 A;  4EEA A;  3D5N A;  5CQM X;  1XZ6 A;  1O7Q A;  2A8U A;  1PZY B;  4HO0 A;  5C49 A;  1NF5 B;  3SXC A;  2VSH A;  1INI A;  2APC A;  1VM8 A;  2YQH A;  3I0I X;  4P00 A;  2VXM A;  3SPT A;  3OH3 A;  4AYL A;  4JIS A;  3U2T A;  3V90 A;  2PGV A;  1G93 A;  2RJ1 A;  3CKJ A;  3GUE A;  4MND A;  5IDT A;  1W77 A;  1ZCT A;  4LW6 A;  1V84 A;  1H5S D;  2P6W A;  4NAK A;  4FRB A;  4CJB A;  2Y7A A;  2I5E A;  2YC3 A;  4ASJ A;  2RJ8 A;  3JUK A;  5JQQ A;  1WSZ A;  3SXD A;  3U2X A;  4CJ8 A;  5AJN A;  2VSI A;  5DDV A;  2WVM A;  5FU8 A;  4KPX A;  2FFV A;  2OEF A;  1O7O A;  1VIC A;  2RJ0 A;  3DUV A;  4GBP A;  4Y7V A;  3Q80 A;  4K6R A;  4KC1 A;  2Z87 A;  4B42 A;  1HV9 A;  3FWW A;  1VZU A;  3SXG A;  2Z86 A;  2VFZ A;  5J49 A;  4Y6N A;  3ZGG A;  1VPA A;  2YCM A;  2D7I A;  3ZLL A;  5L6V A;  4JD0 A;  1ZJ3 A;  5C47 A;  4FRA A;  4FRH A;  2WVK A;  5C4E A;  3E25 A;  3I0H A;  1HJL A;  1FGG A;  4HO6 A;  1O0R A;  4HO5 A;  1LZJ A;  3USQ A;  4B2X A;  4KC4 A;  4D48 A;  1JYK A;  3D98 A;  1G2V A;  3RMW A;  1TW5 A;  1OQM B;  3PKQ A;  1FR8 A;  2AM4 A;  2O1G A;  1VGZ A;  2AM5 A;  3V8Z A;  4B5B A;  3SX3 A;  2JCO A;  2BO6 A;  3OH0 A;  2RJ7 A;  1HM0 A;  1H7L A;  1ZJ2 A;  2RJ5 A;  2FYD B;  2ICX A;  2FYB A;  3NGW A;  2PX7 A;  5CQP A;  4DEC A;  2OI6 A;  4B2W A;  2WE9 A;  4EEM A;  3T7M A;  2O1H A;  1G8O A;  3F1C A;  3U2V A;  3T7N A;  3I0C A;  1EZI A;  2RJ9 A;  2ZU9 A;  5CMG X;  2MZB A;  1R7T A;  5FTS A;  4HOC A;  5HS2 A;  4FCE A;  1V82 A;  1VH3 A;  3I0F A;  4B4M A;  4EEG A;  2FYA A;  3ZF8 A;  4AC3 A;  4HO4 A;  3V91 A;  3ZLK A;  3SX7 A;  4Y7T A;  1S4P A;  4G87 A;  4KT7 A;  1QGQ A;  1ZJ0 A;  2DPW A;  1H4C A;  4KPZ A;  2YES A;  1GQC A;  3BRK X;  3V0O A;  4KNX A;  3LW6 A;  1TZF A;  3SXA A;  4G3P A;  1VGU A;  3V0P A;  1ON6 A;  4B4B A;  1GX0 A;  1MP4 A;  2FYC B;  5FTV A;  2BO4 A;  3TZT A;  1ZI3 A;  5L6S A;  4EE4 A;  1WT1 A;  2D7R A;  1G3L A;  5FU0 A;  1YP4 A;  1NKH B;  1VH1 A;  2NXV A;  1S4N A;  2E8B A;  1MP5 A;  1R7X A;  1FGX A;  1JV3 A;  5C4C A;  2QH5 A;  1PZT A;  3HL3 A;  1H7F A;  5I1F A;  1GA8 A;  4Y62 A;  5EJ1 A;  1W57 A;  2XWM A;  2Q4J A;  4DE7 A;  1ZIZ A;  1LL2 A;  2A8W A;  5C1G A;  4M2A A;  1ON8 A;  3V0L A;  2ZU7 A;  2XMH A;  5C8R A;  2AES A;  1JV1 A;  1G95 A;  1ZHJ A;  3I0E A;  5C3B A;  3V0N A;  2VXL A;  1ZI5 A;  2RIY A;  5C48 A;  2VS3 A;  1VGW A;  2AE7 A;  4IRP A;  1LZ7 A;  2FFU A;  1G9R A;  2JCL A;  2ZU8 A;  1KWS A;  2WVL A;  4C2S A;  2WEE A;  3FOQ A;  3F1Y A;  4NAN A;  2PA4 A;  4FRE A;  4MYB A;  3U0Y A;  3K8E A;  1GWW A;  2QKX A;  5CQL X;  3JTJ A;  3ST8 A;  4HCQ A;  4CJC A;  3CKQ A;  2CU2 A;  4M2B A;  3K8D A;  1ZCY A;  1H5T A;  4EE5 A;  1LL3 A;  1LVW A;  5DDT A;  2YC5 A;  1H7G A;  1R7U A;  1YP3 A;  1JVD A;  1FZW A;  1FXO A;  1GWV A;  2V0J A;  2XME A;  4G3S A;  1VZT A;  5CMI A;  1MP3 A;  4FRQ A;  2AM3 A;  3OC9 A;  2RIX A;  1H5R A;  4ARW A;  2JCK A;  2YQS A;  4G3Q A;  2JCJ A;  3N9W A;  1H5S C;  1ZJ1 A;  4D0Z A;  2XWN A;  4M28 A;  1H7Q A;  1H3M A;  1IIM A;  2XWL A;  4LW3 A;  4HO2 A;  4P02 A;  4Y7F A;  5IDS A;  2W0V A;  2X65 A;  3I0D A;  4FRP A;  1FRW A;  1YP2 A;  2I5K A;  1ZDF A;  1NQI B;  4HO8 A;  3USR A;  1IIN A;  4M4K A;  1R7V A;  2I7B A;  4ECM A;  1ZI4 A;  1NMM B;  2RIZ A;  2AEC A;  3U0X A;  4FRD A;  3RSB A;  3TQD A;  2PGY A;  1QG8 A;  1VGT A;  1R7Y A;  5CQO A;  3OH1 A;  1LZI A;  3CU0 A;  1ZJO A;  2UX8 A;  5FUH A;  3SX5 A;  2X5Z A;  2VS4 A;  1G1L A;  2OEG A;  4Y7G A;  3ZGF A;  4FRM A;  3OH2 A;  2YQJ A;  3I0J A;  4ZDQ A;  3E26 A;  2FY7 A;  4R7P A;  1G23 A;  5CMH A;  3I0L A;  3D8V A;  2V0L A;  2Y6P A;  1ZCV A;  5C38 A;  4KNR A;  1WVC A;  1H7E A;  4L41 C;  1NWG B;  4Y64 A;  5CMJ A;  3PKP A;  1YRO B;  1TW1 A;  4D11 C;  3V8Y A;  5IFY A;  1SS9 A;  3JUJ A;  1FWY A;  1HJJ A;  3QVB A;  2Y4K A;  3R2W A;  4BQH A;  4EVW A;  1FO9 A;  1XHB A;  1R81 A;  1R82 A;  3CGX A;  4DDZ A;  3SXE A;  4D11 A;  3Q7U A;  5FYE A;  3IOH A;  2BO8 A;  1JYL A;  1FG5 N;  4AYJ A;  1WT2 A;  3IOJ A;  2ICY A;  1NHE B;  1JVG A;  5AJO A;  3V0Q A;  2O1F A;  1FO8 A;  1GQ9 A;  4CVH A;  4YS8 A;  2WGZ A;  2GGO A;  4FRO A;  4XWI A;  3R3I A;  4B4G A;  1Z90 A;  2V0I A;  1S4O A;  1H5T B;  1WT3 A;  1ZDG A;  2Y4L A;  1I52 A;  5C3D A;  1QWJ A;  4KRV A;  5BXC A;  1TVY A;  1O23 B;  4HO9 A;  1GX4 A;  4BMA A;  4FQW A;  3U2W A;  1FOA A;  2GGQ A;  1H5R B;  4J18 A;  5C4F A;  1H7H A;  2V0K A;  3SXB A;  3OAM A;  3RMV A;  4FRL A;  5C4B A;  1R80 A;  3POL A;  1LZ0 A;  3PNN A;  3EE5 A;  3SX8 A;  2RJ6 A;  4IRQ A;  4Y9X A;  1E5K A;  3CKN A;  3I0K A;  1OMX A;  3OH4 A;  4KXO A;  1H5S B;  4UEG A;  2P72 A;  5C4D A;  1H4E A;  1QGS A;  1HM9 A;  2OI7 A;  5CQN X;  2QGI A;  1INJ A;  2E3D A;  5EJZ A;  2RIT A;  4EEO A;  4Y7U A;  1OMZ A;  5C1H A;  3KIA A;  2AGD A;  3IOI A;  4D0T A;  4AAW A;  5C1L A;  2RJ4 A; 
#chains in the Genus database with same CATH topology
 1G97 A;  4KQL A;  3T7O A;  2VS5 A;  2YQC A;  1H5S A;  5C36 A;  1MC3 A;  2WAW A;  3I0G A;  1HM8 A;  3V0M A;  1LL0 A;  1FR9 A;  2VD4 A;  2Y4M A;  2D0J A;  1H7T A;  5CMF X;  2P73 A;  4E1K A;  1VZX A;  4FCU A;  5C3A A;  2BO7 A;  1ZJP A;  4KC2 A;  4B3U A;  4Y6U A;  4HO3 A;  2W0W A;  4NAL A;  2V0H A;  5FV9 A;  3Q4S A;  3OKR A;  1ZI1 A;  3U2U A;  1G0R A;  3CKO A;  5EIY A;  4NAI A;  4ASY A;  1ZCU A;  2OI5 A;  1V83 A;  3CKV A;  1WT0 A;  4Y63 A;  1EYR A;  3DJ4 A;  5AJP A;  2X5S A;  4HG6 A;  2Y4J A;  3DK5 A;  3OGZ A;  1H4D A;  4EE3 A;  3BCV A;  1K4V A;  4O6N A;  1W55 A;  3O3P A;  2AH9 A;  1FXJ A;  2X60 A;  4EEA A;  3D5N A;  5CQM X;  1XZ6 A;  1O7Q A;  2A8U A;  1PZY B;  4HO0 A;  5C49 A;  1NF5 B;  3SXC A;  2VSH A;  1INI A;  2APC A;  1VM8 A;  2YQH A;  3I0I X;  4P00 A;  2VXM A;  3SPT A;  3OH3 A;  4AYL A;  4JIS A;  3U2T A;  3V90 A;  2PGV A;  1G93 A;  2RJ1 A;  3CKJ A;  3GUE A;  4MND A;  5IDT A;  1W77 A;  1ZCT A;  4LW6 A;  1V84 A;  1H5S D;  2P6W A;  4NAK A;  4FRB A;  4CJB A;  2Y7A A;  2I5E A;  2YC3 A;  4O6M A;  4ASJ A;  2RJ8 A;  3JUK A;  5JQQ A;  1WSZ A;  3SXD A;  3U2X A;  4CJ8 A;  5AJN A;  2VSI A;  5DDV A;  2WVM A;  5FU8 A;  4KPX A;  2FFV A;  2OEF A;  1O7O A;  1VIC A;  2RJ0 A;  3DUV A;  4GBP A;  4Y7V A;  3Q80 A;  4K6R A;  4KC1 A;  2Z87 A;  4B42 A;  1HV9 A;  3FWW A;  1VZU A;  3SXG A;  2Z86 A;  2VFZ A;  5J49 A;  4Y6N A;  3ZGG A;  1VPA A;  2YCM A;  2D7I A;  3ZLL A;  5L6V A;  4JD0 A;  1ZJ3 A;  5C47 A;  4FRA A;  4FRH A;  2WVK A;  5C4E A;  3E25 A;  3I0H A;  1HJL A;  1FGG A;  4HO6 A;  1O0R A;  4HO5 A;  1LZJ A;  3USQ A;  4B2X A;  4KC4 A;  4D48 A;  1JYK A;  3D98 A;  1G2V A;  3RMW A;  1TW5 A;  1OQM B;  3PKQ A;  1FR8 A;  2AM4 A;  2O1G A;  1VGZ A;  2AM5 A;  3V8Z A;  4B5B A;  3SX3 A;  2JCO A;  2BO6 A;  3OH0 A;  2RJ7 A;  1HM0 A;  1H7L A;  1ZJ2 A;  2RJ5 A;  2FYD B;  2ICX A;  2FYB A;  3NGW A;  2PX7 A;  5CQP A;  4DEC A;  2OI6 A;  4Q7C A;  2WE9 A;  4B2W A;  3T7M A;  2O1H A;  1G8O A;  3F1C A;  3U2V A;  4EEM A;  3T7N A;  3I0C A;  1EZI A;  2RJ9 A;  2ZU9 A;  5CMG X;  2MZB A;  1R7T A;  5FTS A;  4HOC A;  5HS2 A;  4FCE A;  1V82 A;  1VH3 A;  3I0F A;  4B4M A;  4EEG A;  2FYA A;  3ZF8 A;  4AC3 A;  4HO4 A;  3V91 A;  3ZLK A;  3SX7 A;  4Y7T A;  1S4P A;  4G87 A;  4KT7 A;  1QGQ A;  1ZJ0 A;  2DPW A;  1H4C A;  4KPZ A;  2YES A;  1GQC A;  3BRK X;  3V0O A;  2C0N A;  4KNX A;  3LW6 A;  1TZF A;  3SXA A;  4G3P A;  2J0B A;  1VGU A;  3V0P A;  1ON6 A;  4B4B A;  1GX0 A;  1MP4 A;  2FYC B;  5FTV A;  2BO4 A;  3TZT A;  2J0A A;  1ZI3 A;  5L6S A;  4EE4 A;  1WT1 A;  2D7R A;  1G3L A;  5FU0 A;  1YP4 A;  1NKH B;  1VH1 A;  2NXV A;  1S4N A;  2E8B A;  1MP5 A;  1R7X A;  1FGX A;  1JV3 A;  5C4C A;  2QH5 A;  1PZT A;  3HL3 A;  1H7F A;  5I1F A;  1GA8 A;  4Y62 A;  5EJ1 A;  1W57 A;  2XWM A;  2Q4J A;  4DE7 A;  1ZIZ A;  1LL2 A;  2A8W A;  5C1G A;  4M2A A;  1ON8 A;  3V0L A;  2ZU7 A;  2XMH A;  5C8R A;  2AES A;  1JV1 A;  1G95 A;  1ZHJ A;  3I0E A;  5C3B A;  3V0N A;  2VXL A;  1ZI5 A;  2RIY A;  5C48 A;  2VS3 A;  1VGW A;  2AE7 A;  4IRP A;  1LZ7 A;  2FFU A;  1G9R A;  2JCL A;  2ZU8 A;  1KWS A;  2WVL A;  4C2S A;  2WEE A;  3FOQ A;  3F1Y A;  4NAN A;  2PA4 A;  4FRE A;  4MYB A;  3U0Y A;  3K8E A;  1GWW A;  2QKX A;  5CQL X;  3JTJ A;  3ST8 A;  4HCQ A;  4CJC A;  3CKQ A;  2CU2 A;  4M2B A;  3K8D A;  1ZCY A;  1H5T A;  4EE5 A;  1LL3 A;  1LVW A;  4FIY A;  5DDT A;  2YC5 A;  1H7G A;  1R7U A;  1YP3 A;  1JVD A;  1FZW A;  1FXO A;  1GWV A;  2V0J A;  2XME A;  4G3S A;  1VZT A;  5CMI A;  1MP3 A;  4FRQ A;  2AM3 A;  3OC9 A;  2RIX A;  1H5R A;  4ARW A;  2JCK A;  2YQS A;  4G3Q A;  2JCJ A;  3N9W A;  1H5S C;  1ZJ1 A;  4D0Z A;  2XWN A;  4M28 A;  1H7Q A;  1H3M A;  1IIM A;  2XWL A;  4LW3 A;  4HO2 A;  4P02 A;  4Y7F A;  5IDS A;  2W0V A;  2X65 A;  3I0D A;  4FRP A;  1FRW A;  1YP2 A;  2I5K A;  1ZDF A;  1NQI B;  4HO8 A;  3USR A;  1IIN A;  4M4K A;  1R7V A;  2I7B A;  4ECM A;  1ZI4 A;  5D92 A;  1NMM B;  2RIZ A;  2AEC A;  3U0X A;  4FRD A;  3RSB A;  3TQD A;  2PGY A;  1QG8 A;  1VGT A;  1R7Y A;  5CQO A;  3OH1 A;  1LZI A;  3CU0 A;  1ZJO A;  2UX8 A;  5FUH A;  3SX5 A;  2X5Z A;  2VS4 A;  1G1L A;  2OEG A;  4Y7G A;  3ZGF A;  4FRM A;  3OH2 A;  2YQJ A;  3I0J A;  4ZDQ A;  3E26 A;  2FY7 A;  4R7P A;  1G23 A;  5CMH A;  3I0L A;  3D8V A;  2V0L A;  2Y6P A;  1ZCV A;  5C38 A;  4KNR A;  1WVC A;  1H7E A;  4L41 C;  1NWG B;  4Y64 A;  5CMJ A;  3PKP A;  1YRO B;  1TW1 A;  4D11 C;  3V8Y A;  5IFY A;  1SS9 A;  3JUJ A;  1FWY A;  1HJJ A;  3QVB A;  2Y4K A;  3R2W A;  2VK9 A;  4BQH A;  1FO9 A;  1XHB A;  4EVW A;  1R81 A;  1R82 A;  3CGX A;  4DDZ A;  3SXE A;  4D11 A;  3Q7U A;  5FYE A;  3IOH A;  2BO8 A;  1JYL A;  1FG5 N;  4AYJ A;  1WT2 A;  3IOJ A;  2ICY A;  1NHE B;  1JVG A;  5AJO A;  3V0Q A;  2O1F A;  1FO8 A;  1GQ9 A;  4CVH A;  4YS8 A;  2WGZ A;  2GGO A;  4FRO A;  4XWI A;  3R3I A;  4B4G A;  1Z90 A;  2V0I A;  1S4O A;  1H5T B;  1WT3 A;  1ZDG A;  2Y4L A;  1I52 A;  5C3D A;  1QWJ A;  4KRV A;  5BXC A;  1TVY A;  1O23 B;  4HO9 A;  1GX4 A;  4BMA A;  4FQW A;  3U2W A;  1FOA A;  2GGQ A;  1H5R B;  4J18 A;  5C4F A;  1H7H A;  2V0K A;  3SXB A;  3OAM A;  3RMV A;  4FRL A;  5C4B A;  1R80 A;  3POL A;  1LZ0 A;  3PNN A;  3EE5 A;  3SX8 A;  2RJ6 A;  4IRQ A;  4Y9X A;  1E5K A;  3CKN A;  3I0K A;  1OMX A;  3OH4 A;  4KXO A;  1H5S B;  4UEG A;  2P72 A;  5C4D A;  1H4E A;  1QGS A;  1HM9 A;  2OI7 A;  5CQN X;  2QGI A;  1INJ A;  2E3D A;  5EJZ A;  5D91 A;  4FIX A;  2RIT A;  4EEO A;  4Y7U A;  1OMZ A;  5C1H A;  3KIA A;  2AGD A;  3IOI A;  4D0T A;  4AAW A;  5C1L A;  4MIX A;  2RJ4 A; 
#chains in the Genus database with same CATH homology
 1G97 A;  4KQL A;  3T7O A;  2VS5 A;  2YQC A;  1H5S A;  5C36 A;  1MC3 A;  2WAW A;  3I0G A;  1HM8 A;  3V0M A;  1LL0 A;  1FR9 A;  2VD4 A;  2Y4M A;  2D0J A;  1H7T A;  5CMF X;  2P73 A;  4E1K A;  1VZX A;  4FCU A;  5C3A A;  2BO7 A;  1ZJP A;  4KC2 A;  4B3U A;  4Y6U A;  4HO3 A;  2W0W A;  4NAL A;  2V0H A;  5FV9 A;  3Q4S A;  3OKR A;  1ZI1 A;  3U2U A;  1G0R A;  3CKO A;  5EIY A;  4NAI A;  4ASY A;  1ZCU A;  2OI5 A;  1V83 A;  3CKV A;  1WT0 A;  4Y63 A;  1EYR A;  3DJ4 A;  5AJP A;  2X5S A;  4HG6 A;  2Y4J A;  3DK5 A;  3OGZ A;  1H4D A;  4EE3 A;  3BCV A;  1K4V A;  4O6N A;  1W55 A;  3O3P A;  2AH9 A;  1FXJ A;  2X60 A;  4EEA A;  3D5N A;  5CQM X;  1XZ6 A;  1O7Q A;  2A8U A;  1PZY B;  4HO0 A;  5C49 A;  1NF5 B;  3SXC A;  2VSH A;  1INI A;  2APC A;  1VM8 A;  2YQH A;  3I0I X;  4P00 A;  2VXM A;  3SPT A;  3OH3 A;  4AYL A;  4JIS A;  3U2T A;  3V90 A;  2PGV A;  1G93 A;  2RJ1 A;  3CKJ A;  3GUE A;  4MND A;  5IDT A;  1W77 A;  1ZCT A;  4LW6 A;  1V84 A;  1H5S D;  2P6W A;  4NAK A;  4FRB A;  4CJB A;  2Y7A A;  2I5E A;  2YC3 A;  4O6M A;  4ASJ A;  2RJ8 A;  3JUK A;  5JQQ A;  1WSZ A;  3SXD A;  3U2X A;  4CJ8 A;  5AJN A;  2VSI A;  5DDV A;  2WVM A;  5FU8 A;  4KPX A;  2FFV A;  2OEF A;  1O7O A;  1VIC A;  2RJ0 A;  3DUV A;  4GBP A;  4Y7V A;  3Q80 A;  4K6R A;  4KC1 A;  2Z87 A;  4B42 A;  1HV9 A;  3FWW A;  1VZU A;  3SXG A;  2Z86 A;  2VFZ A;  5J49 A;  4Y6N A;  3ZGG A;  1VPA A;  2YCM A;  2D7I A;  3ZLL A;  5L6V A;  4JD0 A;  1ZJ3 A;  5C47 A;  4FRA A;  4FRH A;  2WVK A;  5C4E A;  3E25 A;  3I0H A;  1HJL A;  1FGG A;  4HO6 A;  1O0R A;  4HO5 A;  1LZJ A;  3USQ A;  4B2X A;  4KC4 A;  4D48 A;  1JYK A;  3D98 A;  1G2V A;  3RMW A;  1TW5 A;  1OQM B;  3PKQ A;  1FR8 A;  2AM4 A;  2O1G A;  1VGZ A;  2AM5 A;  3V8Z A;  4B5B A;  3SX3 A;  2JCO A;  2BO6 A;  3OH0 A;  2RJ7 A;  1HM0 A;  1H7L A;  1ZJ2 A;  2RJ5 A;  2FYD B;  2ICX A;  2FYB A;  3NGW A;  2PX7 A;  5CQP A;  4DEC A;  2OI6 A;  4Q7C A;  2WE9 A;  4B2W A;  3T7M A;  2O1H A;  1G8O A;  3F1C A;  3U2V A;  4EEM A;  3T7N A;  3I0C A;  1EZI A;  2RJ9 A;  2ZU9 A;  5CMG X;  2MZB A;  1R7T A;  5FTS A;  4HOC A;  5HS2 A;  4FCE A;  1V82 A;  1VH3 A;  3I0F A;  4B4M A;  4EEG A;  2FYA A;  3ZF8 A;  4AC3 A;  4HO4 A;  3V91 A;  3ZLK A;  3SX7 A;  4Y7T A;  1S4P A;  4G87 A;  4KT7 A;  1QGQ A;  1ZJ0 A;  2DPW A;  1H4C A;  4KPZ A;  2YES A;  1GQC A;  3BRK X;  3V0O A;  2C0N A;  4KNX A;  3LW6 A;  1TZF A;  3SXA A;  4G3P A;  2J0B A;  1VGU A;  3V0P A;  1ON6 A;  4B4B A;  1GX0 A;  1MP4 A;  2FYC B;  5FTV A;  2BO4 A;  3TZT A;  2J0A A;  1ZI3 A;  5L6S A;  4EE4 A;  1WT1 A;  2D7R A;  1G3L A;  5FU0 A;  1YP4 A;  1NKH B;  1VH1 A;  2NXV A;  1S4N A;  2E8B A;  1MP5 A;  1R7X A;  1FGX A;  1JV3 A;  5C4C A;  2QH5 A;  1PZT A;  3HL3 A;  1H7F A;  5I1F A;  1GA8 A;  4Y62 A;  5EJ1 A;  1W57 A;  2XWM A;  2Q4J A;  4DE7 A;  1ZIZ A;  1LL2 A;  2A8W A;  5C1G A;  4M2A A;  1ON8 A;  3V0L A;  2ZU7 A;  2XMH A;  5C8R A;  2AES A;  1JV1 A;  1G95 A;  1ZHJ A;  3I0E A;  5C3B A;  3V0N A;  2VXL A;  1ZI5 A;  2RIY A;  5C48 A;  2VS3 A;  1VGW A;  2AE7 A;  4IRP A;  1LZ7 A;  2FFU A;  1G9R A;  2JCL A;  2ZU8 A;  1KWS A;  2WVL A;  4C2S A;  2WEE A;  3FOQ A;  3F1Y A;  4NAN A;  2PA4 A;  4FRE A;  4MYB A;  3U0Y A;  3K8E A;  1GWW A;  2QKX A;  5CQL X;  3JTJ A;  3ST8 A;  4HCQ A;  4CJC A;  3CKQ A;  2CU2 A;  4M2B A;  3K8D A;  1ZCY A;  1H5T A;  4EE5 A;  1LL3 A;  1LVW A;  4FIY A;  5DDT A;  2YC5 A;  1H7G A;  1R7U A;  1YP3 A;  1JVD A;  1FZW A;  1FXO A;  1GWV A;  2V0J A;  2XME A;  4G3S A;  1VZT A;  5CMI A;  1MP3 A;  4FRQ A;  2AM3 A;  3OC9 A;  2RIX A;  1H5R A;  4ARW A;  2JCK A;  2YQS A;  4G3Q A;  2JCJ A;  3N9W A;  1H5S C;  1ZJ1 A;  4D0Z A;  2XWN A;  4M28 A;  1H7Q A;  1H3M A;  1IIM A;  2XWL A;  4LW3 A;  4HO2 A;  4P02 A;  4Y7F A;  5IDS A;  2W0V A;  2X65 A;  3I0D A;  4FRP A;  1FRW A;  1YP2 A;  2I5K A;  1ZDF A;  1NQI B;  4HO8 A;  3USR A;  1IIN A;  4M4K A;  1R7V A;  2I7B A;  4ECM A;  1ZI4 A;  5D92 A;  1NMM B;  2RIZ A;  2AEC A;  3U0X A;  4FRD A;  3RSB A;  3TQD A;  2PGY A;  1QG8 A;  1VGT A;  1R7Y A;  5CQO A;  3OH1 A;  1LZI A;  3CU0 A;  1ZJO A;  2UX8 A;  5FUH A;  3SX5 A;  2X5Z A;  2VS4 A;  1G1L A;  2OEG A;  4Y7G A;  3ZGF A;  4FRM A;  3OH2 A;  2YQJ A;  3I0J A;  4ZDQ A;  3E26 A;  2FY7 A;  4R7P A;  1G23 A;  5CMH A;  3I0L A;  3D8V A;  2V0L A;  2Y6P A;  1ZCV A;  5C38 A;  4KNR A;  1WVC A;  1H7E A;  4L41 C;  1NWG B;  4Y64 A;  5CMJ A;  3PKP A;  1YRO B;  1TW1 A;  4D11 C;  3V8Y A;  5IFY A;  1SS9 A;  3JUJ A;  1FWY A;  1HJJ A;  3QVB A;  2Y4K A;  3R2W A;  2VK9 A;  4BQH A;  1FO9 A;  1XHB A;  4EVW A;  1R81 A;  1R82 A;  3CGX A;  4DDZ A;  3SXE A;  4D11 A;  3Q7U A;  5FYE A;  3IOH A;  2BO8 A;  1JYL A;  1FG5 N;  4AYJ A;  1WT2 A;  3IOJ A;  2ICY A;  1NHE B;  1JVG A;  5AJO A;  3V0Q A;  2O1F A;  1FO8 A;  1GQ9 A;  4CVH A;  4YS8 A;  2WGZ A;  2GGO A;  4FRO A;  4XWI A;  3R3I A;  4B4G A;  1Z90 A;  2V0I A;  1S4O A;  1H5T B;  1WT3 A;  1ZDG A;  2Y4L A;  1I52 A;  5C3D A;  1QWJ A;  4KRV A;  5BXC A;  1TVY A;  1O23 B;  4HO9 A;  1GX4 A;  4BMA A;  4FQW A;  3U2W A;  1FOA A;  2GGQ A;  1H5R B;  4J18 A;  5C4F A;  1H7H A;  2V0K A;  3SXB A;  3OAM A;  3RMV A;  4FRL A;  5C4B A;  1R80 A;  3POL A;  1LZ0 A;  3PNN A;  3EE5 A;  3SX8 A;  2RJ6 A;  4IRQ A;  4Y9X A;  1E5K A;  3CKN A;  3I0K A;  1OMX A;  3OH4 A;  4KXO A;  1H5S B;  4UEG A;  2P72 A;  5C4D A;  1H4E A;  1QGS A;  1HM9 A;  2OI7 A;  5CQN X;  2QGI A;  1INJ A;  2E3D A;  5EJZ A;  5D91 A;  4FIX A;  2RIT A;  4EEO A;  4Y7U A;  1OMZ A;  5C1H A;  3KIA A;  2AGD A;  3IOI A;  4D0T A;  4AAW A;  5C1L A;  4MIX A;  2RJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...