4B42A

Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
293
structure length
293
Chain Sequence
MKRKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLGSASQRQTGASVFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIATLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLLTETVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
publication title Allosteric competitive inhibitors of the glucose-1-phosphate thymidylyltransferase (RmlA) from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 100
structure length 293
sequence length 293
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.74: 1L-myo-inositol 1-phosphate cytidylyltransferase.
pdb deposition date 2012-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4b42A00
4D0ZA 4Y7GA 1G8OA 2A8WA 4M4KA 1LZJA 2YC5A 2XWMA 2NXVA 1TZFA 1G0RA 1JYLA 2WVKA 1W57A 4NAIA 2Y6PA 4Y64A 5CMHA 4DECA 3E25A 1MP4A 1FO9A 2D0JA 4HO0A 1FGXA 1R7TA 3Q80A 1ZCYA 1OMXA 1MP5A 4M2AA 1XHBA 1WT1A 4B4BA 4CJCA 2Z87A 3ST8A 1S4NA 4Y7UA 2RJ6A 5FU8A 2DPWA 3RMWA 5FYEA 2GGQA 3OH0A 5FV9A 1H4DA 1VH3A 3V0MA 2FYCB 2ZU8A 1JVGA 2D7RA 4Y6UA 3V91A 2FFVA 2W0VA 3OH2A 3RMVA 1G95A 4D11A 2OI5A 2YQSA 1QWJA 1OQMB 5CQNX 1H5RA 1VGZA 3NGWA 4FCEA 1H5RB 1W77A 2O1HA 1JVDA 4IRQA 4Y63A 4G3PA 1GA8A 1IINA 5AJPA 2Y4MA 1LL0A 4LW3A 1S4PA 1GWWA 3I0JA 1EZIA 3SXBA 4P02A 1HV9A 2JCJA 1ZJOA 2OEGA 3SX7A 2BO6A 2AECA 4UEGA 4K6RA 3U0YA 3R2WA 4ZDQA 4EE3A 1G9RA 2OI6A 1FWYA 4JD0A 3U2WA 2ZU7A 4C2SA 5JQQA 2WAWA 4KNRA 1H4CA 5C3BA 2GGOA 1GX4A 2P72A 1EYRA 1MC3A 4FRBA 1H7HA 1H5TA 4FRDA 2X60A 1VZTA 1H5TB 1VM8A 1PZTA 4J18A 1R80A 2O1GA 4KNXA 2YQJA 5CMJA 3V0OA 5CQPA 1MP3A 1YP2A 3I0EA 1ZI1A 1VGTA 3V8ZA 5HS2A 2X65A 1WT2A 1HM0A 4FRLA 1ZDGA 4Y62A 4R7PA 3DUVA 3U0XA 4M28A 3OH1A 2V0HA 5CQOA 1I52A 2V0JA 3OGZA 2WEEA 1GQCA 4CJ8A 4KQLA 3K8EA 4FRHA 1R7YA 1ZJ3A 4D11C 2XWNA 3I0IX 5DDTA 1NMMB 2P6WA 1W55A 2PGYA 3D98A 3OKRA 4ASJA 4NANA 4B2WA 2FYDB 3U2VA 5IFYA 1R7XA 3ZF8A 1G23A 4B5BA 4YS8A 5C38A 4BQHA 2VD4A 3U2TA 1ON8A 4B2XA 1VZXA 2AM3A 2RITA 3T7MA 4AYLA 1ZCVA 5J49A 4FRMA 5FTVA 5IDSA 2XMEA 1H4EA 1NQIB 4ECMA 1ZCUA 1ZJPA 2VFZA 4FROA 2AM5A 3SX5A 3I0FA 5CMGX 2OI7A 4FREA 2YCMA 2RJ5A 4MNDA 2E3DA 1FRWA 3CU0A 1V82A 3TZTA 1VPAA 1HM8A 1GWVA 2AGDA 5EJZA 3OH3A 1HJJA 5IDTA 3JUJA 3V90A 1LZIA 4HO5A 2Z86A 3SXGA 1TW1A 4AYJA 3QVBA 1OMZA 4FQWA 4NAKA 1Z90A 4Y9XA 1ZHJA 2PGVA 1FG5N 2RJ7A 2WVLA 2ICXA 3CKQA 2JCOA 2BO8A 4B3UA 3I0CA 1VICA 4DDZA 4CVHA 3ZGFA 3SXAA 2VSHA 1ON6A 1H7TA 1G97A 1H5SD 2FYBA 1VH1A 2QGIA 2VS4A 4L41C 4MYBA 2RJ8A 2YQCA 3BRKX 2FFUA 4KC4A 3V8YA 1G3LA 4ARWA 4G87A 3CKVA 2FYAA 5C3DA 1E5KA 1FZWA 3FWWA 3IOJA 3SXDA 3D8VA 3Q7UA 5C1GA 4HO8A 4D0TA 1JYKA 1KWSA 1ZJ1A 3SX3A 3DK5A 5C8RA 3IOIA 1FGGA 1ZI4A 1VGUA 4EVWA 2OEFA 4EEOA 1WT3A 5C48A 2Y7AA 1YP4A 2AM4A 2E8BA 2Q4JA 4HO2A 2RJ0A 3PKPA 1XZ6A 1K4VA 4Y7FA 4EEAA 4FCUA 2MZBA 2VS5A 3PKQA 1NHEB 1GQ9A 2I5EA 3KIAA 2WVMA 2JCKA 4HG6A 1H5SA 3D5NA 1H5SB 2ICYA 4XWIA 1NWGB 2BO4A 1FOAA 2AE7A 2D7IA 3E26A 1G2VA 4EE5A 4IRPA 2QKXA 1QGQA 1ZDFA 4HO3A 3RSBA 3OAMA 5C4CA 1QG8A 4JISA 1GX0A 5CQMX 5FU0A 4E1KA 3SXEA 4KXOA 3TQDA 3ZGGA 2CU2A 3ZLLA 3BCVA 3HL3A 1SS9A 3I0HA 3CGXA 4ASYA 3I0KA 4DE7A 2RJ1A 2RIYA 1HM9A 2UX8A 5EJ1A 4EE4A 4KC2A 1R7UA 2Y4JA 1FXJA 3U2XA 2FY7A 2QH5A 2X5ZA 3CKNA 2V0IA 1R81A 2Y4KA 4EEMA 4HO9A 1QGSA 5C36A 3V0PA 5FTSA 1HJLA 3V0NA 1H7FA 3I0DA 2VS3A 2Y4LA 3USRA 1TVYA 3LW6A 1S4OA 5L6VA 5DDVA 1VGWA 5AJOA 2RIZA 2PA4A 4B4GA 4G3QA 5C47A 3V0QA 1JV3A 4B4MA 2VXMA 4P00A 1ZJ2A 1H5SC 3U2UA 1TW5A 2JCLA 3PNNA 1FR9A 3N9WA 1WSZA 5C1HA 3GUEA 3T7OA 3CKJA 1O0RA 1V83A 3F1CA 4KPXA 3FOQA 3ZLKA 2BO7A 1G93A 3K8DA 3SPTA 1ZCTA 1H7QA 1LVWA 1O7QA 1V84A 3R3IA 1R82A 2YESA 4HO4A 5FUHA 4BMAA 3EE5A 4B42A 3CKOA 3SXCA 3V0LA 1NKHB 3T7NA 2YC3A 5EIYA 3USQA 2VSIA 2W0WA 2XMHA 5BXCA 1R7VA 2RJ9A 3OH4A 2RIXA 1IIMA 5CMIA 4KRVA 1WVCA 5CQLX 3SX8A 2I7BA 5C4EA 2I5KA 2A8UA 4D48A 1ZJ0A 2PX7A 1H7EA 2AESA 4Y7TA 4EEGA 5I1FA 4G3SA 2WE9A 5C4DA 5CMFX 4Y6NA 3POLA 2XWLA 1H3MA 1INIA 4HO6A 2VXLA 4NALA 2O1FA 5C4BA 1ZI3A 1INJA 3F1YA 4M2BA 1FR8A 1WT0A 4CJBA 1LZ7A 3Q4SA 1ZIZA 2AH9A 4FRAA 1YP3A 3OC9A 3I0LA 3O3PA 1FO8A 2APCA 1H7GA 3DJ4A 2YQHA 3IOHA 5L6SA 5AJNA 4HCQA 1JV1A 1LL3A 2X5SA 1O23B 1PZYB 4LW6A 1FXOA 1YROB 1LZ0A 1O7OA 2P73A 5C3AA 4GBPA 4AAWA 1G1LA 3JUKA 2V0KA 5C1LA 1VZUA 2RJ4A 4Y7VA 4KT7A 5C49A 3I0GA 1H7LA 4KPZA 4FRPA 1ZI5A 1NF5B 2ZU9A 4AC3A 4FRQA 1LL2A 5C4FA 2WGZA 2V0LA 4KC1A 3JTJA 4HOCA
chains in the Genus database with same CATH superfamily
4D0ZA 4Y7GA 1G8OA 2A8WA 4M4KA 1LZJA 2YC5A 2XWMA 2NXVA 1TZFA 1G0RA 1JYLA 2WVKA 1W57A 4NAIA 2Y6PA 4Y64A 5CMHA 4DECA 3E25A 1MP4A 2J0BA 1FO9A 2D0JA 4HO0A 1FGXA 2VK9A 1R7TA 3Q80A 1ZCYA 1OMXA 1MP5A 4M2AA 1XHBA 1WT1A 4B4BA 4CJCA 2Z87A 3ST8A 1S4NA 4Y7UA 2RJ6A 5FU8A 2DPWA 3RMWA 5FYEA 2GGQA 3OH0A 5FV9A 1H4DA 1VH3A 3V0MA 2FYCB 2ZU8A 1JVGA 2D7RA 4Y6UA 3V91A 2FFVA 2W0VA 3OH2A 3RMVA 1G95A 4D11A 2OI5A 2YQSA 1QWJA 1OQMB 5CQNX 1H5RA 1VGZA 3NGWA 4FCEA 1H5RB 1W77A 2O1HA 1JVDA 4IRQA 4Y63A 4G3PA 1GA8A 1IINA 5AJPA 2Y4MA 1LL0A 4LW3A 1S4PA 1GWWA 3I0JA 1EZIA 3SXBA 4P02A 1HV9A 2JCJA 1ZJOA 2OEGA 3SX7A 2BO6A 2AECA 4UEGA 4K6RA 3U0YA 3R2WA 4ZDQA 4EE3A 1G9RA 2OI6A 1FWYA 4JD0A 3U2WA 2ZU7A 4C2SA 5JQQA 2WAWA 4KNRA 1H4CA 5C3BA 2GGOA 1GX4A 2P72A 1EYRA 1MC3A 4FRBA 1H7HA 1H5TA 4FRDA 2X60A 1VZTA 1H5TB 1VM8A 1PZTA 4J18A 1R80A 2O1GA 4KNXA 2YQJA 5CMJA 3V0OA 5CQPA 1MP3A 1YP2A 3I0EA 1ZI1A 1VGTA 3V8ZA 5HS2A 2X65A 1WT2A 1HM0A 4FRLA 1ZDGA 4Y62A 4R7PA 3DUVA 3U0XA 4M28A 3OH1A 2V0HA 5CQOA 1I52A 2V0JA 3OGZA 2WEEA 1GQCA 4CJ8A 4KQLA 3K8EA 4FRHA 1R7YA 1ZJ3A 4D11C 2XWNA 3I0IX 5DDTA 1NMMB 2P6WA 1W55A 2PGYA 3D98A 3OKRA 4ASJA 4NANA 4B2WA 2FYDB 3U2VA 5IFYA 1R7XA 3ZF8A 1G23A 4B5BA 4YS8A 5C38A 4BQHA 2VD4A 3U2TA 1ON8A 4B2XA 1VZXA 2AM3A 2RITA 3T7MA 4AYLA 1ZCVA 5J49A 4FRMA 5FTVA 5IDSA 2XMEA 1H4EA 1NQIB 4ECMA 1ZCUA 1ZJPA 2VFZA 4FROA 2AM5A 3SX5A 3I0FA 5CMGX 2OI7A 4FREA 2YCMA 5D91A 2RJ5A 4MNDA 2E3DA 1FRWA 3CU0A 1V82A 3TZTA 1VPAA 1HM8A 1GWVA 2AGDA 5EJZA 3OH3A 1HJJA 5IDTA 3JUJA 3V90A 1LZIA 4HO5A 2Z86A 3SXGA 1TW1A 4AYJA 3QVBA 1OMZA 4FQWA 4NAKA 1Z90A 4Y9XA 1ZHJA 2PGVA 1FG5N 2RJ7A 2WVLA 2ICXA 3CKQA 4FIXA 2JCOA 2BO8A 4B3UA 3I0CA 1VICA 4DDZA 4CVHA 3ZGFA 3SXAA 2VSHA 1ON6A 1H7TA 1G97A 1H5SD 2FYBA 1VH1A 2QGIA 2VS4A 4L41C 4MYBA 2RJ8A 2YQCA 3BRKX 2FFUA 4KC4A 3V8YA 1G3LA 4ARWA 4G87A 3CKVA 2FYAA 5C3DA 1E5KA 1FZWA 3FWWA 3IOJA 3SXDA 3D8VA 3Q7UA 5C1GA 4HO8A 4D0TA 1JYKA 1KWSA 2C0NA 1ZJ1A 3SX3A 3DK5A 5C8RA 3IOIA 1FGGA 1ZI4A 1VGUA 4EVWA 2OEFA 4EEOA 1WT3A 5C48A 2Y7AA 1YP4A 2AM4A 2E8BA 2Q4JA 4HO2A 2RJ0A 3PKPA 1XZ6A 1K4VA 4Y7FA 4EEAA 4FCUA 2J0AA 4Q7CA 2MZBA 2VS5A 3PKQA 1NHEB 1GQ9A 2I5EA 3KIAA 2WVMA 2JCKA 4HG6A 1H5SA 3D5NA 1H5SB 2ICYA 4XWIA 1NWGB 2BO4A 1FOAA 2AE7A 2D7IA 3E26A 1G2VA 4EE5A 4IRPA 2QKXA 1QGQA 1ZDFA 4HO3A 4O6MA 3RSBA 3OAMA 5C4CA 1QG8A 4JISA 1GX0A 5CQMX 5FU0A 4E1KA 3SXEA 4KXOA 3TQDA 3ZGGA 2CU2A 3ZLLA 3BCVA 3HL3A 1SS9A 3I0HA 3CGXA 4ASYA 3I0KA 4DE7A 2RJ1A 2RIYA 1HM9A 2UX8A 5EJ1A 4EE4A 4KC2A 1R7UA 2Y4JA 1FXJA 3U2XA 2FY7A 2QH5A 2X5ZA 3CKNA 2V0IA 1R81A 2Y4KA 4EEMA 4HO9A 1QGSA 5D92A 3V0PA 5C36A 5FTSA 1HJLA 3V0NA 1H7FA 3I0DA 2VS3A 2Y4LA 3USRA 1TVYA 3LW6A 1S4OA 5L6VA 5DDVA 1VGWA 5AJOA 2RIZA 2PA4A 4B4GA 4G3QA 5C47A 3V0QA 1JV3A 4B4MA 2VXMA 4P00A 1ZJ2A 1H5SC 3U2UA 1TW5A 2JCLA 3PNNA 1FR9A 3N9WA 1WSZA 5C1HA 3GUEA 3T7OA 3CKJA 1O0RA 1V83A 3F1CA 4KPXA 3FOQA 3ZLKA 2BO7A 1G93A 3K8DA 4FIYA 1ZCTA 3SPTA 1H7QA 1LVWA 1O7QA 1V84A 3R3IA 1R82A 2YESA 4HO4A 5FUHA 4BMAA 3EE5A 4B42A 3CKOA 3SXCA 3V0LA 1NKHB 3T7NA 2YC3A 5EIYA 3USQA 2VSIA 2W0WA 2XMHA 5BXCA 1R7VA 2RJ9A 3OH4A 2RIXA 1IIMA 5CMIA 4KRVA 1WVCA 5CQLX 3SX8A 2I7BA 5C4EA 2I5KA 2A8UA 4D48A 4MIXA 1ZJ0A 2PX7A 1H7EA 2AESA 4Y7TA 4EEGA 5I1FA 4G3SA 2WE9A 5C4DA 5CMFX 4Y6NA 3POLA 2XWLA 1H3MA 1INIA 4HO6A 2VXLA 4NALA 2O1FA 5C4BA 1ZI3A 1INJA 3F1YA 4O6NA 4M2BA 1FR8A 1WT0A 4CJBA 1LZ7A 3Q4SA 1ZIZA 2AH9A 4FRAA 1YP3A 3OC9A 3I0LA 3O3PA 1FO8A 2APCA 1H7GA 3DJ4A 2YQHA 3IOHA 5L6SA 5AJNA 4HCQA 1JV1A 1LL3A 2X5SA 1O23B 1PZYB 4LW6A 1FXOA 1YROB 1LZ0A 1O7OA 2P73A 5C3AA 4GBPA 4AAWA 1G1LA 3JUKA 2V0KA 5C1LA 1VZUA 2RJ4A 4Y7VA 4KT7A 5C49A 3I0GA 1H7LA 4KPZA 4FRPA 1ZI5A 1NF5B 2ZU9A 4AC3A 4FRQA 1LL2A 5C4FA 2WGZA 2V0LA 4KC1A 3JTJA 4HOCA
chains in the Genus database with same CATH topology
4D0ZA 4Y7GA 1G8OA 2A8WA 4M4KA 1LZJA 2YC5A 2XWMA 2NXVA 1TZFA 1G0RA 1JYLA 2WVKA 1W57A 4NAIA 2Y6PA 4Y64A 5CMHA 4DECA 3E25A 1MP4A 2J0BA 1FO9A 2D0JA 4HO0A 1FGXA 2VK9A 1R7TA 3Q80A 1ZCYA 1OMXA 1MP5A 4M2AA 1XHBA 1WT1A 4B4BA 4CJCA 2Z87A 3ST8A 1S4NA 4Y7UA 2RJ6A 5FU8A 2DPWA 3RMWA 5FYEA 2GGQA 3OH0A 5FV9A 1H4DA 1VH3A 3V0MA 2FYCB 2ZU8A 1JVGA 2D7RA 4Y6UA 3V91A 2FFVA 2W0VA 3OH2A 3RMVA 1G95A 4D11A 2OI5A 2YQSA 1QWJA 1OQMB 5CQNX 1H5RA 1VGZA 3NGWA 4FCEA 1H5RB 1W77A 2O1HA 1JVDA 4IRQA 4Y63A 4G3PA 1GA8A 1IINA 5AJPA 2Y4MA 1LL0A 4LW3A 1S4PA 1GWWA 3I0JA 1EZIA 3SXBA 4P02A 1HV9A 2JCJA 1ZJOA 2OEGA 3SX7A 2BO6A 2AECA 4UEGA 4K6RA 3U0YA 3R2WA 4ZDQA 4EE3A 1G9RA 2OI6A 1FWYA 4JD0A 3U2WA 2ZU7A 4C2SA 5JQQA 2WAWA 4KNRA 1H4CA 5C3BA 2GGOA 1GX4A 2P72A 1EYRA 1MC3A 4FRBA 1H7HA 1H5TA 4FRDA 2X60A 1VZTA 1H5TB 1VM8A 1PZTA 4J18A 1R80A 2O1GA 4KNXA 2YQJA 5CMJA 3V0OA 5CQPA 1MP3A 1YP2A 3I0EA 1ZI1A 1VGTA 3V8ZA 5HS2A 2X65A 1WT2A 1HM0A 4FRLA 1ZDGA 4Y62A 4R7PA 3DUVA 3U0XA 4M28A 3OH1A 2V0HA 5CQOA 1I52A 2V0JA 3OGZA 2WEEA 1GQCA 4CJ8A 4KQLA 3K8EA 4FRHA 1R7YA 1ZJ3A 4D11C 2XWNA 3I0IX 5DDTA 1NMMB 2P6WA 1W55A 2PGYA 3D98A 3OKRA 4ASJA 4NANA 4B2WA 2FYDB 3U2VA 5IFYA 1R7XA 3ZF8A 1G23A 4B5BA 4YS8A 5C38A 4BQHA 2VD4A 3U2TA 1ON8A 4B2XA 1VZXA 2AM3A 2RITA 3T7MA 4AYLA 1ZCVA 5J49A 4FRMA 5FTVA 5IDSA 2XMEA 1H4EA 1NQIB 4ECMA 1ZCUA 1ZJPA 2VFZA 4FROA 2AM5A 3SX5A 3I0FA 5CMGX 2OI7A 4FREA 2YCMA 5D91A 2RJ5A 4MNDA 2E3DA 1FRWA 3CU0A 1V82A 3TZTA 1VPAA 1HM8A 1GWVA 2AGDA 5EJZA 3OH3A 1HJJA 5IDTA 3JUJA 3V90A 1LZIA 4HO5A 2Z86A 3SXGA 1TW1A 4AYJA 3QVBA 1OMZA 4FQWA 4NAKA 1Z90A 4Y9XA 1ZHJA 2PGVA 1FG5N 2RJ7A 2WVLA 2ICXA 3CKQA 4FIXA 2JCOA 2BO8A 4B3UA 3I0CA 1VICA 4DDZA 4CVHA 3ZGFA 3SXAA 2VSHA 1ON6A 1H7TA 1G97A 1H5SD 2FYBA 1VH1A 2QGIA 2VS4A 4L41C 4MYBA 2RJ8A 2YQCA 3BRKX 2FFUA 4KC4A 3V8YA 1G3LA 4ARWA 4G87A 3CKVA 2FYAA 5C3DA 1E5KA 1FZWA 3FWWA 3IOJA 3SXDA 3D8VA 3Q7UA 5C1GA 4HO8A 4D0TA 1JYKA 1KWSA 2C0NA 1ZJ1A 3SX3A 3DK5A 5C8RA 3IOIA 1FGGA 1ZI4A 1VGUA 4EVWA 2OEFA 4EEOA 1WT3A 5C48A 2Y7AA 1YP4A 2AM4A 2E8BA 2Q4JA 4HO2A 2RJ0A 3PKPA 1XZ6A 1K4VA 4Y7FA 4EEAA 4FCUA 2J0AA 4Q7CA 2MZBA 2VS5A 3PKQA 1NHEB 1GQ9A 2I5EA 3KIAA 2WVMA 2JCKA 4HG6A 1H5SA 3D5NA 1H5SB 2ICYA 4XWIA 1NWGB 2BO4A 1FOAA 2AE7A 2D7IA 3E26A 1G2VA 4EE5A 4IRPA 2QKXA 1QGQA 1ZDFA 4HO3A 4O6MA 3RSBA 3OAMA 5C4CA 1QG8A 4JISA 1GX0A 5CQMX 5FU0A 4E1KA 3SXEA 4KXOA 3TQDA 3ZGGA 2CU2A 3ZLLA 3BCVA 3HL3A 1SS9A 3I0HA 3CGXA 4ASYA 3I0KA 4DE7A 2RJ1A 2RIYA 1HM9A 2UX8A 5EJ1A 4EE4A 4KC2A 1R7UA 2Y4JA 1FXJA 3U2XA 2FY7A 2QH5A 2X5ZA 3CKNA 2V0IA 1R81A 2Y4KA 4EEMA 4HO9A 1QGSA 5D92A 3V0PA 5C36A 5FTSA 1HJLA 3V0NA 1H7FA 3I0DA 2VS3A 2Y4LA 3USRA 1TVYA 3LW6A 1S4OA 5L6VA 5DDVA 1VGWA 5AJOA 2RIZA 2PA4A 4B4GA 4G3QA 5C47A 3V0QA 1JV3A 4B4MA 2VXMA 4P00A 1ZJ2A 1H5SC 3U2UA 1TW5A 2JCLA 3PNNA 1FR9A 3N9WA 1WSZA 5C1HA 3GUEA 3T7OA 3CKJA 1O0RA 1V83A 3F1CA 4KPXA 3FOQA 3ZLKA 2BO7A 1G93A 3K8DA 4FIYA 1ZCTA 3SPTA 1H7QA 1LVWA 1O7QA 1V84A 3R3IA 1R82A 2YESA 4HO4A 5FUHA 4BMAA 3EE5A 4B42A 3CKOA 3SXCA 3V0LA 1NKHB 3T7NA 2YC3A 5EIYA 3USQA 2VSIA 2W0WA 2XMHA 5BXCA 1R7VA 2RJ9A 3OH4A 2RIXA 1IIMA 5CMIA 4KRVA 1WVCA 5CQLX 3SX8A 2I7BA 5C4EA 2I5KA 2A8UA 4D48A 4MIXA 1ZJ0A 2PX7A 1H7EA 2AESA 4Y7TA 4EEGA 5I1FA 4G3SA 2WE9A 5C4DA 5CMFX 4Y6NA 3POLA 2XWLA 1H3MA 1INIA 4HO6A 2VXLA 4NALA 2O1FA 5C4BA 1ZI3A 1INJA 3F1YA 4O6NA 4M2BA 1FR8A 1WT0A 4CJBA 1LZ7A 3Q4SA 1ZIZA 2AH9A 4FRAA 1YP3A 3OC9A 3I0LA 3O3PA 1FO8A 2APCA 1H7GA 3DJ4A 2YQHA 3IOHA 5L6SA 5AJNA 4HCQA 1JV1A 1LL3A 2X5SA 1O23B 1PZYB 4LW6A 1FXOA 1YROB 1LZ0A 1O7OA 2P73A 5C3AA 4GBPA 4AAWA 1G1LA 3JUKA 2V0KA 5C1LA 1VZUA 2RJ4A 4Y7VA 4KT7A 5C49A 3I0GA 1H7LA 4KPZA 4FRPA 1ZI5A 1NF5B 2ZU9A 4AC3A 4FRQA 1LL2A 5C4FA 2WGZA 2V0LA 4KC1A 3JTJA 4HOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D0Z A;  4Y7G A;  1G8O A;  2A8W A;  4M4K A;  1LZJ A;  2YC5 A;  2XWM A;  2NXV A;  1TZF A;  1G0R A;  1JYL A;  2WVK A;  1W57 A;  4NAI A;  2Y6P A;  4Y64 A;  5CMH A;  4DEC A;  3E25 A;  1MP4 A;  1FO9 A;  2D0J A;  4HO0 A;  1FGX A;  1R7T A;  3Q80 A;  1ZCY A;  1OMX A;  1MP5 A;  4M2A A;  1XHB A;  1WT1 A;  4B4B A;  4CJC A;  2Z87 A;  3ST8 A;  1S4N A;  4Y7U A;  2RJ6 A;  5FU8 A;  2DPW A;  3RMW A;  5FYE A;  2GGQ A;  3OH0 A;  5FV9 A;  1H4D A;  1VH3 A;  3V0M A;  2FYC B;  2ZU8 A;  1JVG A;  2D7R A;  4Y6U A;  3V91 A;  2FFV A;  2W0V A;  3OH2 A;  3RMV A;  1G95 A;  4D11 A;  2OI5 A;  2YQS A;  1QWJ A;  1OQM B;  5CQN X;  1H5R A;  1VGZ A;  3NGW A;  4FCE A;  1H5R B;  1W77 A;  2O1H A;  1JVD A;  4IRQ A;  4Y63 A;  4G3P A;  1GA8 A;  1IIN A;  5AJP A;  2Y4M A;  1LL0 A;  4LW3 A;  1S4P A;  1GWW A;  3I0J A;  1EZI A;  3SXB A;  4P02 A;  1HV9 A;  2JCJ A;  1ZJO A;  2OEG A;  3SX7 A;  2BO6 A;  2AEC A;  4UEG A;  4K6R A;  3U0Y A;  3R2W A;  4ZDQ A;  4EE3 A;  1G9R A;  2OI6 A;  1FWY A;  4JD0 A;  3U2W A;  2ZU7 A;  4C2S A;  5JQQ A;  2WAW A;  4KNR A;  1H4C A;  5C3B A;  2GGO A;  1GX4 A;  2P72 A;  1EYR A;  1MC3 A;  4FRB A;  1H7H A;  1H5T A;  4FRD A;  2X60 A;  1VZT A;  1H5T B;  1VM8 A;  1PZT A;  4J18 A;  1R80 A;  2O1G A;  4KNX A;  2YQJ A;  5CMJ A;  3V0O A;  5CQP A;  1MP3 A;  1YP2 A;  3I0E A;  1ZI1 A;  1VGT A;  3V8Z A;  5HS2 A;  2X65 A;  1WT2 A;  1HM0 A;  4FRL A;  1ZDG A;  4Y62 A;  4R7P A;  3DUV A;  3U0X A;  4M28 A;  3OH1 A;  2V0H A;  5CQO A;  1I52 A;  2V0J A;  3OGZ A;  2WEE A;  1GQC A;  4CJ8 A;  4KQL A;  3K8E A;  4FRH A;  1R7Y A;  1ZJ3 A;  4D11 C;  2XWN A;  3I0I X;  5DDT A;  1NMM B;  2P6W A;  1W55 A;  2PGY A;  3D98 A;  3OKR A;  4ASJ A;  4NAN A;  4B2W A;  2FYD B;  3U2V A;  5IFY A;  1R7X A;  3ZF8 A;  1G23 A;  4B5B A;  4YS8 A;  5C38 A;  4BQH A;  2VD4 A;  3U2T A;  1ON8 A;  4B2X A;  1VZX A;  2AM3 A;  2RIT A;  3T7M A;  4AYL A;  1ZCV A;  5J49 A;  4FRM A;  5FTV A;  5IDS A;  2XME A;  1H4E A;  1NQI B;  4ECM A;  1ZCU A;  1ZJP A;  2VFZ A;  4FRO A;  2AM5 A;  3SX5 A;  3I0F A;  5CMG X;  2OI7 A;  4FRE A;  2YCM A;  2RJ5 A;  4MND A;  2E3D A;  1FRW A;  3CU0 A;  1V82 A;  3TZT A;  1VPA A;  1HM8 A;  1GWV A;  2AGD A;  5EJZ A;  3OH3 A;  1HJJ A;  5IDT A;  3JUJ A;  3V90 A;  1LZI A;  4HO5 A;  2Z86 A;  3SXG A;  1TW1 A;  4AYJ A;  3QVB A;  1OMZ A;  4FQW A;  4NAK A;  1Z90 A;  4Y9X A;  1ZHJ A;  2PGV A;  1FG5 N;  2RJ7 A;  2WVL A;  2ICX A;  3CKQ A;  2JCO A;  2BO8 A;  4B3U A;  3I0C A;  1VIC A;  4DDZ A;  4CVH A;  3ZGF A;  3SXA A;  2VSH A;  1ON6 A;  1H7T A;  1G97 A;  1H5S D;  2FYB A;  1VH1 A;  2QGI A;  2VS4 A;  4L41 C;  4MYB A;  2RJ8 A;  2YQC A;  3BRK X;  2FFU A;  4KC4 A;  3V8Y A;  1G3L A;  4ARW A;  4G87 A;  3CKV A;  2FYA A;  5C3D A;  1E5K A;  1FZW A;  3FWW A;  3IOJ A;  3SXD A;  3D8V A;  3Q7U A;  5C1G A;  4HO8 A;  4D0T A;  1JYK A;  1KWS A;  1ZJ1 A;  3SX3 A;  3DK5 A;  5C8R A;  3IOI A;  1FGG A;  1ZI4 A;  1VGU A;  4EVW A;  2OEF A;  4EEO A;  1WT3 A;  5C48 A;  2Y7A A;  1YP4 A;  2AM4 A;  2E8B A;  2Q4J A;  4HO2 A;  2RJ0 A;  3PKP A;  1XZ6 A;  1K4V A;  4Y7F A;  4EEA A;  4FCU A;  2MZB A;  2VS5 A;  3PKQ A;  1NHE B;  1GQ9 A;  2I5E A;  3KIA A;  2WVM A;  2JCK A;  4HG6 A;  1H5S A;  3D5N A;  1H5S B;  2ICY A;  4XWI A;  1NWG B;  2BO4 A;  1FOA A;  2AE7 A;  2D7I A;  3E26 A;  1G2V A;  4EE5 A;  4IRP A;  2QKX A;  1QGQ A;  1ZDF A;  4HO3 A;  3RSB A;  3OAM A;  5C4C A;  1QG8 A;  4JIS A;  1GX0 A;  5CQM X;  5FU0 A;  4E1K A;  3SXE A;  4KXO A;  3TQD A;  3ZGG A;  2CU2 A;  3ZLL A;  3BCV A;  3HL3 A;  1SS9 A;  3I0H A;  3CGX A;  4ASY A;  3I0K A;  4DE7 A;  2RJ1 A;  2RIY A;  1HM9 A;  2UX8 A;  5EJ1 A;  4EE4 A;  4KC2 A;  1R7U A;  2Y4J A;  1FXJ A;  3U2X A;  2FY7 A;  2QH5 A;  2X5Z A;  3CKN A;  2V0I A;  1R81 A;  2Y4K A;  4EEM A;  4HO9 A;  1QGS A;  5C36 A;  3V0P A;  5FTS A;  1HJL A;  3V0N A;  1H7F A;  3I0D A;  2VS3 A;  2Y4L A;  3USR A;  1TVY A;  3LW6 A;  1S4O A;  5L6V A;  5DDV A;  1VGW A;  5AJO A;  2RIZ A;  2PA4 A;  4B4G A;  4G3Q A;  5C47 A;  3V0Q A;  1JV3 A;  4B4M A;  2VXM A;  4P00 A;  1ZJ2 A;  1H5S C;  3U2U A;  1TW5 A;  2JCL A;  3PNN A;  1FR9 A;  3N9W A;  1WSZ A;  5C1H A;  3GUE A;  3T7O A;  3CKJ A;  1O0R A;  1V83 A;  3F1C A;  4KPX A;  3FOQ A;  3ZLK A;  2BO7 A;  1G93 A;  3K8D A;  3SPT A;  1ZCT A;  1H7Q A;  1LVW A;  1O7Q A;  1V84 A;  3R3I A;  1R82 A;  2YES A;  4HO4 A;  5FUH A;  4BMA A;  3EE5 A;  4B42 A;  3CKO A;  3SXC A;  3V0L A;  1NKH B;  3T7N A;  2YC3 A;  5EIY A;  3USQ A;  2VSI A;  2W0W A;  2XMH A;  5BXC A;  1R7V A;  2RJ9 A;  3OH4 A;  2RIX A;  1IIM A;  5CMI A;  4KRV A;  1WVC A;  5CQL X;  3SX8 A;  2I7B A;  5C4E A;  2I5K A;  2A8U A;  4D48 A;  1ZJ0 A;  2PX7 A;  1H7E A;  2AES A;  4Y7T A;  4EEG A;  5I1F A;  4G3S A;  2WE9 A;  5C4D A;  5CMF X;  4Y6N A;  3POL A;  2XWL A;  1H3M A;  1INI A;  4HO6 A;  2VXL A;  4NAL A;  2O1F A;  5C4B A;  1ZI3 A;  1INJ A;  3F1Y A;  4M2B A;  1FR8 A;  1WT0 A;  4CJB A;  1LZ7 A;  3Q4S A;  1ZIZ A;  2AH9 A;  4FRA A;  1YP3 A;  3OC9 A;  3I0L A;  3O3P A;  1FO8 A;  2APC A;  1H7G A;  3DJ4 A;  2YQH A;  3IOH A;  5L6S A;  5AJN A;  4HCQ A;  1JV1 A;  1LL3 A;  2X5S A;  1O23 B;  1PZY B;  4LW6 A;  1FXO A;  1YRO B;  1LZ0 A;  1O7O A;  2P73 A;  5C3A A;  4GBP A;  4AAW A;  1G1L A;  3JUK A;  2V0K A;  5C1L A;  1VZU A;  2RJ4 A;  4Y7V A;  4KT7 A;  5C49 A;  3I0G A;  1H7L A;  4KPZ A;  4FRP A;  1ZI5 A;  1NF5 B;  2ZU9 A;  4AC3 A;  4FRQ A;  1LL2 A;  5C4F A;  2WGZ A;  2V0L A;  4KC1 A;  3JTJ A;  4HOC A; 
#chains in the Genus database with same CATH topology
 4D0Z A;  4Y7G A;  1G8O A;  2A8W A;  4M4K A;  1LZJ A;  2YC5 A;  2XWM A;  2NXV A;  1TZF A;  1G0R A;  1JYL A;  2WVK A;  1W57 A;  4NAI A;  2Y6P A;  4Y64 A;  5CMH A;  4DEC A;  3E25 A;  1MP4 A;  2J0B A;  1FO9 A;  2D0J A;  4HO0 A;  1FGX A;  2VK9 A;  1R7T A;  3Q80 A;  1ZCY A;  1OMX A;  1MP5 A;  4M2A A;  1XHB A;  1WT1 A;  4B4B A;  4CJC A;  2Z87 A;  3ST8 A;  1S4N A;  4Y7U A;  2RJ6 A;  5FU8 A;  2DPW A;  3RMW A;  5FYE A;  2GGQ A;  3OH0 A;  5FV9 A;  1H4D A;  1VH3 A;  3V0M A;  2FYC B;  2ZU8 A;  1JVG A;  2D7R A;  4Y6U A;  3V91 A;  2FFV A;  2W0V A;  3OH2 A;  3RMV A;  1G95 A;  4D11 A;  2OI5 A;  2YQS A;  1QWJ A;  1OQM B;  5CQN X;  1H5R A;  1VGZ A;  3NGW A;  4FCE A;  1H5R B;  1W77 A;  2O1H A;  1JVD A;  4IRQ A;  4Y63 A;  4G3P A;  1GA8 A;  1IIN A;  5AJP A;  2Y4M A;  1LL0 A;  4LW3 A;  1S4P A;  1GWW A;  3I0J A;  1EZI A;  3SXB A;  4P02 A;  1HV9 A;  2JCJ A;  1ZJO A;  2OEG A;  3SX7 A;  2BO6 A;  2AEC A;  4UEG A;  4K6R A;  3U0Y A;  3R2W A;  4ZDQ A;  4EE3 A;  1G9R A;  2OI6 A;  1FWY A;  4JD0 A;  3U2W A;  2ZU7 A;  4C2S A;  5JQQ A;  2WAW A;  4KNR A;  1H4C A;  5C3B A;  2GGO A;  1GX4 A;  2P72 A;  1EYR A;  1MC3 A;  4FRB A;  1H7H A;  1H5T A;  4FRD A;  2X60 A;  1VZT A;  1H5T B;  1VM8 A;  1PZT A;  4J18 A;  1R80 A;  2O1G A;  4KNX A;  2YQJ A;  5CMJ A;  3V0O A;  5CQP A;  1MP3 A;  1YP2 A;  3I0E A;  1ZI1 A;  1VGT A;  3V8Z A;  5HS2 A;  2X65 A;  1WT2 A;  1HM0 A;  4FRL A;  1ZDG A;  4Y62 A;  4R7P A;  3DUV A;  3U0X A;  4M28 A;  3OH1 A;  2V0H A;  5CQO A;  1I52 A;  2V0J A;  3OGZ A;  2WEE A;  1GQC A;  4CJ8 A;  4KQL A;  3K8E A;  4FRH A;  1R7Y A;  1ZJ3 A;  4D11 C;  2XWN A;  3I0I X;  5DDT A;  1NMM B;  2P6W A;  1W55 A;  2PGY A;  3D98 A;  3OKR A;  4ASJ A;  4NAN A;  4B2W A;  2FYD B;  3U2V A;  5IFY A;  1R7X A;  3ZF8 A;  1G23 A;  4B5B A;  4YS8 A;  5C38 A;  4BQH A;  2VD4 A;  3U2T A;  1ON8 A;  4B2X A;  1VZX A;  2AM3 A;  2RIT A;  3T7M A;  4AYL A;  1ZCV A;  5J49 A;  4FRM A;  5FTV A;  5IDS A;  2XME A;  1H4E A;  1NQI B;  4ECM A;  1ZCU A;  1ZJP A;  2VFZ A;  4FRO A;  2AM5 A;  3SX5 A;  3I0F A;  5CMG X;  2OI7 A;  4FRE A;  2YCM A;  5D91 A;  2RJ5 A;  4MND A;  2E3D A;  1FRW A;  3CU0 A;  1V82 A;  3TZT A;  1VPA A;  1HM8 A;  1GWV A;  2AGD A;  5EJZ A;  3OH3 A;  1HJJ A;  5IDT A;  3JUJ A;  3V90 A;  1LZI A;  4HO5 A;  2Z86 A;  3SXG A;  1TW1 A;  4AYJ A;  3QVB A;  1OMZ A;  4FQW A;  4NAK A;  1Z90 A;  4Y9X A;  1ZHJ A;  2PGV A;  1FG5 N;  2RJ7 A;  2WVL A;  2ICX A;  3CKQ A;  4FIX A;  2JCO A;  2BO8 A;  4B3U A;  3I0C A;  1VIC A;  4DDZ A;  4CVH A;  3ZGF A;  3SXA A;  2VSH A;  1ON6 A;  1H7T A;  1G97 A;  1H5S D;  2FYB A;  1VH1 A;  2QGI A;  2VS4 A;  4L41 C;  4MYB A;  2RJ8 A;  2YQC A;  3BRK X;  2FFU A;  4KC4 A;  3V8Y A;  1G3L A;  4ARW A;  4G87 A;  3CKV A;  2FYA A;  5C3D A;  1E5K A;  1FZW A;  3FWW A;  3IOJ A;  3SXD A;  3D8V A;  3Q7U A;  5C1G A;  4HO8 A;  4D0T A;  1JYK A;  1KWS A;  2C0N A;  1ZJ1 A;  3SX3 A;  3DK5 A;  5C8R A;  3IOI A;  1FGG A;  1ZI4 A;  1VGU A;  4EVW A;  2OEF A;  4EEO A;  1WT3 A;  5C48 A;  2Y7A A;  1YP4 A;  2AM4 A;  2E8B A;  2Q4J A;  4HO2 A;  2RJ0 A;  3PKP A;  1XZ6 A;  1K4V A;  4Y7F A;  4EEA A;  4FCU A;  2J0A A;  4Q7C A;  2MZB A;  2VS5 A;  3PKQ A;  1NHE B;  1GQ9 A;  2I5E A;  3KIA A;  2WVM A;  2JCK A;  4HG6 A;  1H5S A;  3D5N A;  1H5S B;  2ICY A;  4XWI A;  1NWG B;  2BO4 A;  1FOA A;  2AE7 A;  2D7I A;  3E26 A;  1G2V A;  4EE5 A;  4IRP A;  2QKX A;  1QGQ A;  1ZDF A;  4HO3 A;  4O6M A;  3RSB A;  3OAM A;  5C4C A;  1QG8 A;  4JIS A;  1GX0 A;  5CQM X;  5FU0 A;  4E1K A;  3SXE A;  4KXO A;  3TQD A;  3ZGG A;  2CU2 A;  3ZLL A;  3BCV A;  3HL3 A;  1SS9 A;  3I0H A;  3CGX A;  4ASY A;  3I0K A;  4DE7 A;  2RJ1 A;  2RIY A;  1HM9 A;  2UX8 A;  5EJ1 A;  4EE4 A;  4KC2 A;  1R7U A;  2Y4J A;  1FXJ A;  3U2X A;  2FY7 A;  2QH5 A;  2X5Z A;  3CKN A;  2V0I A;  1R81 A;  2Y4K A;  4EEM A;  4HO9 A;  1QGS A;  5D92 A;  3V0P A;  5C36 A;  5FTS A;  1HJL A;  3V0N A;  1H7F A;  3I0D A;  2VS3 A;  2Y4L A;  3USR A;  1TVY A;  3LW6 A;  1S4O A;  5L6V A;  5DDV A;  1VGW A;  5AJO A;  2RIZ A;  2PA4 A;  4B4G A;  4G3Q A;  5C47 A;  3V0Q A;  1JV3 A;  4B4M A;  2VXM A;  4P00 A;  1ZJ2 A;  1H5S C;  3U2U A;  1TW5 A;  2JCL A;  3PNN A;  1FR9 A;  3N9W A;  1WSZ A;  5C1H A;  3GUE A;  3T7O A;  3CKJ A;  1O0R A;  1V83 A;  3F1C A;  4KPX A;  3FOQ A;  3ZLK A;  2BO7 A;  1G93 A;  3K8D A;  4FIY A;  1ZCT A;  3SPT A;  1H7Q A;  1LVW A;  1O7Q A;  1V84 A;  3R3I A;  1R82 A;  2YES A;  4HO4 A;  5FUH A;  4BMA A;  3EE5 A;  4B42 A;  3CKO A;  3SXC A;  3V0L A;  1NKH B;  3T7N A;  2YC3 A;  5EIY A;  3USQ A;  2VSI A;  2W0W A;  2XMH A;  5BXC A;  1R7V A;  2RJ9 A;  3OH4 A;  2RIX A;  1IIM A;  5CMI A;  4KRV A;  1WVC A;  5CQL X;  3SX8 A;  2I7B A;  5C4E A;  2I5K A;  2A8U A;  4D48 A;  4MIX A;  1ZJ0 A;  2PX7 A;  1H7E A;  2AES A;  4Y7T A;  4EEG A;  5I1F A;  4G3S A;  2WE9 A;  5C4D A;  5CMF X;  4Y6N A;  3POL A;  2XWL A;  1H3M A;  1INI A;  4HO6 A;  2VXL A;  4NAL A;  2O1F A;  5C4B A;  1ZI3 A;  1INJ A;  3F1Y A;  4O6N A;  4M2B A;  1FR8 A;  1WT0 A;  4CJB A;  1LZ7 A;  3Q4S A;  1ZIZ A;  2AH9 A;  4FRA A;  1YP3 A;  3OC9 A;  3I0L A;  3O3P A;  1FO8 A;  2APC A;  1H7G A;  3DJ4 A;  2YQH A;  3IOH A;  5L6S A;  5AJN A;  4HCQ A;  1JV1 A;  1LL3 A;  2X5S A;  1O23 B;  1PZY B;  4LW6 A;  1FXO A;  1YRO B;  1LZ0 A;  1O7O A;  2P73 A;  5C3A A;  4GBP A;  4AAW A;  1G1L A;  3JUK A;  2V0K A;  5C1L A;  1VZU A;  2RJ4 A;  4Y7V A;  4KT7 A;  5C49 A;  3I0G A;  1H7L A;  4KPZ A;  4FRP A;  1ZI5 A;  1NF5 B;  2ZU9 A;  4AC3 A;  4FRQ A;  1LL2 A;  5C4F A;  2WGZ A;  2V0L A;  4KC1 A;  3JTJ A;  4HOC A; 
#chains in the Genus database with same CATH homology
 4D0Z A;  4Y7G A;  1G8O A;  2A8W A;  4M4K A;  1LZJ A;  2YC5 A;  2XWM A;  2NXV A;  1TZF A;  1G0R A;  1JYL A;  2WVK A;  1W57 A;  4NAI A;  2Y6P A;  4Y64 A;  5CMH A;  4DEC A;  3E25 A;  1MP4 A;  2J0B A;  1FO9 A;  2D0J A;  4HO0 A;  1FGX A;  2VK9 A;  1R7T A;  3Q80 A;  1ZCY A;  1OMX A;  1MP5 A;  4M2A A;  1XHB A;  1WT1 A;  4B4B A;  4CJC A;  2Z87 A;  3ST8 A;  1S4N A;  4Y7U A;  2RJ6 A;  5FU8 A;  2DPW A;  3RMW A;  5FYE A;  2GGQ A;  3OH0 A;  5FV9 A;  1H4D A;  1VH3 A;  3V0M A;  2FYC B;  2ZU8 A;  1JVG A;  2D7R A;  4Y6U A;  3V91 A;  2FFV A;  2W0V A;  3OH2 A;  3RMV A;  1G95 A;  4D11 A;  2OI5 A;  2YQS A;  1QWJ A;  1OQM B;  5CQN X;  1H5R A;  1VGZ A;  3NGW A;  4FCE A;  1H5R B;  1W77 A;  2O1H A;  1JVD A;  4IRQ A;  4Y63 A;  4G3P A;  1GA8 A;  1IIN A;  5AJP A;  2Y4M A;  1LL0 A;  4LW3 A;  1S4P A;  1GWW A;  3I0J A;  1EZI A;  3SXB A;  4P02 A;  1HV9 A;  2JCJ A;  1ZJO A;  2OEG A;  3SX7 A;  2BO6 A;  2AEC A;  4UEG A;  4K6R A;  3U0Y A;  3R2W A;  4ZDQ A;  4EE3 A;  1G9R A;  2OI6 A;  1FWY A;  4JD0 A;  3U2W A;  2ZU7 A;  4C2S A;  5JQQ A;  2WAW A;  4KNR A;  1H4C A;  5C3B A;  2GGO A;  1GX4 A;  2P72 A;  1EYR A;  1MC3 A;  4FRB A;  1H7H A;  1H5T A;  4FRD A;  2X60 A;  1VZT A;  1H5T B;  1VM8 A;  1PZT A;  4J18 A;  1R80 A;  2O1G A;  4KNX A;  2YQJ A;  5CMJ A;  3V0O A;  5CQP A;  1MP3 A;  1YP2 A;  3I0E A;  1ZI1 A;  1VGT A;  3V8Z A;  5HS2 A;  2X65 A;  1WT2 A;  1HM0 A;  4FRL A;  1ZDG A;  4Y62 A;  4R7P A;  3DUV A;  3U0X A;  4M28 A;  3OH1 A;  2V0H A;  5CQO A;  1I52 A;  2V0J A;  3OGZ A;  2WEE A;  1GQC A;  4CJ8 A;  4KQL A;  3K8E A;  4FRH A;  1R7Y A;  1ZJ3 A;  4D11 C;  2XWN A;  3I0I X;  5DDT A;  1NMM B;  2P6W A;  1W55 A;  2PGY A;  3D98 A;  3OKR A;  4ASJ A;  4NAN A;  4B2W A;  2FYD B;  3U2V A;  5IFY A;  1R7X A;  3ZF8 A;  1G23 A;  4B5B A;  4YS8 A;  5C38 A;  4BQH A;  2VD4 A;  3U2T A;  1ON8 A;  4B2X A;  1VZX A;  2AM3 A;  2RIT A;  3T7M A;  4AYL A;  1ZCV A;  5J49 A;  4FRM A;  5FTV A;  5IDS A;  2XME A;  1H4E A;  1NQI B;  4ECM A;  1ZCU A;  1ZJP A;  2VFZ A;  4FRO A;  2AM5 A;  3SX5 A;  3I0F A;  5CMG X;  2OI7 A;  4FRE A;  2YCM A;  5D91 A;  2RJ5 A;  4MND A;  2E3D A;  1FRW A;  3CU0 A;  1V82 A;  3TZT A;  1VPA A;  1HM8 A;  1GWV A;  2AGD A;  5EJZ A;  3OH3 A;  1HJJ A;  5IDT A;  3JUJ A;  3V90 A;  1LZI A;  4HO5 A;  2Z86 A;  3SXG A;  1TW1 A;  4AYJ A;  3QVB A;  1OMZ A;  4FQW A;  4NAK A;  1Z90 A;  4Y9X A;  1ZHJ A;  2PGV A;  1FG5 N;  2RJ7 A;  2WVL A;  2ICX A;  3CKQ A;  4FIX A;  2JCO A;  2BO8 A;  4B3U A;  3I0C A;  1VIC A;  4DDZ A;  4CVH A;  3ZGF A;  3SXA A;  2VSH A;  1ON6 A;  1H7T A;  1G97 A;  1H5S D;  2FYB A;  1VH1 A;  2QGI A;  2VS4 A;  4L41 C;  4MYB A;  2RJ8 A;  2YQC A;  3BRK X;  2FFU A;  4KC4 A;  3V8Y A;  1G3L A;  4ARW A;  4G87 A;  3CKV A;  2FYA A;  5C3D A;  1E5K A;  1FZW A;  3FWW A;  3IOJ A;  3SXD A;  3D8V A;  3Q7U A;  5C1G A;  4HO8 A;  4D0T A;  1JYK A;  1KWS A;  2C0N A;  1ZJ1 A;  3SX3 A;  3DK5 A;  5C8R A;  3IOI A;  1FGG A;  1ZI4 A;  1VGU A;  4EVW A;  2OEF A;  4EEO A;  1WT3 A;  5C48 A;  2Y7A A;  1YP4 A;  2AM4 A;  2E8B A;  2Q4J A;  4HO2 A;  2RJ0 A;  3PKP A;  1XZ6 A;  1K4V A;  4Y7F A;  4EEA A;  4FCU A;  2J0A A;  4Q7C A;  2MZB A;  2VS5 A;  3PKQ A;  1NHE B;  1GQ9 A;  2I5E A;  3KIA A;  2WVM A;  2JCK A;  4HG6 A;  1H5S A;  3D5N A;  1H5S B;  2ICY A;  4XWI A;  1NWG B;  2BO4 A;  1FOA A;  2AE7 A;  2D7I A;  3E26 A;  1G2V A;  4EE5 A;  4IRP A;  2QKX A;  1QGQ A;  1ZDF A;  4HO3 A;  4O6M A;  3RSB A;  3OAM A;  5C4C A;  1QG8 A;  4JIS A;  1GX0 A;  5CQM X;  5FU0 A;  4E1K A;  3SXE A;  4KXO A;  3TQD A;  3ZGG A;  2CU2 A;  3ZLL A;  3BCV A;  3HL3 A;  1SS9 A;  3I0H A;  3CGX A;  4ASY A;  3I0K A;  4DE7 A;  2RJ1 A;  2RIY A;  1HM9 A;  2UX8 A;  5EJ1 A;  4EE4 A;  4KC2 A;  1R7U A;  2Y4J A;  1FXJ A;  3U2X A;  2FY7 A;  2QH5 A;  2X5Z A;  3CKN A;  2V0I A;  1R81 A;  2Y4K A;  4EEM A;  4HO9 A;  1QGS A;  5D92 A;  3V0P A;  5C36 A;  5FTS A;  1HJL A;  3V0N A;  1H7F A;  3I0D A;  2VS3 A;  2Y4L A;  3USR A;  1TVY A;  3LW6 A;  1S4O A;  5L6V A;  5DDV A;  1VGW A;  5AJO A;  2RIZ A;  2PA4 A;  4B4G A;  4G3Q A;  5C47 A;  3V0Q A;  1JV3 A;  4B4M A;  2VXM A;  4P00 A;  1ZJ2 A;  1H5S C;  3U2U A;  1TW5 A;  2JCL A;  3PNN A;  1FR9 A;  3N9W A;  1WSZ A;  5C1H A;  3GUE A;  3T7O A;  3CKJ A;  1O0R A;  1V83 A;  3F1C A;  4KPX A;  3FOQ A;  3ZLK A;  2BO7 A;  1G93 A;  3K8D A;  4FIY A;  1ZCT A;  3SPT A;  1H7Q A;  1LVW A;  1O7Q A;  1V84 A;  3R3I A;  1R82 A;  2YES A;  4HO4 A;  5FUH A;  4BMA A;  3EE5 A;  4B42 A;  3CKO A;  3SXC A;  3V0L A;  1NKH B;  3T7N A;  2YC3 A;  5EIY A;  3USQ A;  2VSI A;  2W0W A;  2XMH A;  5BXC A;  1R7V A;  2RJ9 A;  3OH4 A;  2RIX A;  1IIM A;  5CMI A;  4KRV A;  1WVC A;  5CQL X;  3SX8 A;  2I7B A;  5C4E A;  2I5K A;  2A8U A;  4D48 A;  4MIX A;  1ZJ0 A;  2PX7 A;  1H7E A;  2AES A;  4Y7T A;  4EEG A;  5I1F A;  4G3S A;  2WE9 A;  5C4D A;  5CMF X;  4Y6N A;  3POL A;  2XWL A;  1H3M A;  1INI A;  4HO6 A;  2VXL A;  4NAL A;  2O1F A;  5C4B A;  1ZI3 A;  1INJ A;  3F1Y A;  4O6N A;  4M2B A;  1FR8 A;  1WT0 A;  4CJB A;  1LZ7 A;  3Q4S A;  1ZIZ A;  2AH9 A;  4FRA A;  1YP3 A;  3OC9 A;  3I0L A;  3O3P A;  1FO8 A;  2APC A;  1H7G A;  3DJ4 A;  2YQH A;  3IOH A;  5L6S A;  5AJN A;  4HCQ A;  1JV1 A;  1LL3 A;  2X5S A;  1O23 B;  1PZY B;  4LW6 A;  1FXO A;  1YRO B;  1LZ0 A;  1O7O A;  2P73 A;  5C3A A;  4GBP A;  4AAW A;  1G1L A;  3JUK A;  2V0K A;  5C1L A;  1VZU A;  2RJ4 A;  4Y7V A;  4KT7 A;  5C49 A;  3I0G A;  1H7L A;  4KPZ A;  4FRP A;  1ZI5 A;  1NF5 B;  2ZU9 A;  4AC3 A;  4FRQ A;  1LL2 A;  5C4F A;  2WGZ A;  2V0L A;  4KC1 A;  3JTJ A;  4HOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...