1H7QA

Dtdp-manganese complex of spsa from bacillus subtilis
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
255
structure length
240
Chain Sequence
PKVSVIMTSYNKSDYVAKSISSILSQTFSDFELFIMDDNSNEETLNVIRPFLNDNRVRFYQSDISGVKERTEKTRYAALINQAIEMAEGEYITYATDDNIYMPDRLLKMVRELDTHPEKAVIYSASKTYHLNDIVKETVRPAAQVTWNAPCAIDHCSVMHRYSVLEKVKEKFGSYWDESPAFYRIGDARFFWRVNHFYPFYPLDEELDLNYITDNEFVRNLPPQRNCRELRESLKKLGMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SPORE COAT POLYSACCHARIDE BIOSYNTHESIS PROTEIN SPSA
publication title Three-Dimensional Structures of the Mn and Mg Dtdp Complexes of the Family Gt-2 Glycosyltransferase Spsa: A Comparison with Related Ndp-Sugar Glycosyltransferases.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 96
structure length 240
sequence length 255
ec nomenclature
pdb deposition date 2001-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1h7qA00
1S4NA 2JCJA 4CJBA 4EEGA 2VXLA 3CGXA 4FRBA 4HO0A 1YP3A 1H7HA 3F1CA 4NALA 5IDSA 1VZXA 4KRVA 4EVWA 1ZDGA 4P00A 4ZDQA 2OI7A 4M2BA 2QH5A 2Z86A 1FRWA 2MZBA 5CQPA 2RJ6A 1FG5N 5EIYA 4FRDA 1ZJ1A 1H7LA 1GWVA 4ASYA 1HM9A 1TW5A 1YROB 1G95A 3JUKA 1FR8A 4C2SA 3O3PA 2JCOA 1H5SD 2ZU9A 4ARWA 1EZIA 1NMMB 2AM4A 1PZYB 2I5EA 1FO9A 3T7MA 4G3QA 3USRA 4M28A 1ZDFA 5J49A 3SXEA 1G3LA 4KNRA 3V90A 1ON6A 1WVCA 2I7BA 4HOCA 1GX4A 1S4OA 4B5BA 5C48A 3JUJA 2ICYA 1R81A 2YQJA 2RJ8A 1H4EA 4EE3A 3I0KA 1S4PA 4M4KA 4B2WA 1H5SB 4J18A 4KPZA 1VGUA 2V0HA 5C1HA 2WVKA 3EE5A 2Y7AA 3CKQA 4L41C 5HS2A 1VZUA 1WT2A 3U2XA 4NAIA 5CMGX 1XZ6A 4JISA 3BRKX 1ZJOA 4Y7GA 3SX3A 2VD4A 1NHEB 2W0VA 1WSZA 2GGQA 2Y6PA 2FYCB 2WVLA 3V0MA 5CMIA 4KT7A 3TZTA 2I5KA 1VGTA 4KQLA 2GGOA 5CMHA 1G23A 1FXJA 3SXCA 4D11C 5CQMX 1ZJ2A 1G93A 3V0NA 2X5ZA 1W77A 1ZJPA 2D0JA 5C3AA 4KC2A 1MP3A 4IRPA 1O23B 2PGVA 1MC3A 1H5TB 3QVBA 3SXAA 1LZ7A 3ZLKA 5AJOA 3OKRA 5FV9A 2ZU7A 4EEAA 5CMFX 2PGYA 1OMZA 3SX5A 1YP4A 4EEMA 5CQOA 2WGZA 1ZCYA 3HL3A 2BO8A 2JCKA 1H5TA 4Y7FA 4B4GA 3E25A 1G0RA 1FZWA 4HO4A 1G1LA 3OH1A 2VXMA 4HO2A 5C38A 2WVMA 4B42A 1E5KA 3I0IX 4DECA 4HO9A 2P6WA 1FOAA 1VH3A 2W0WA 2Y4MA 1JV1A 4D0TA 2AH9A 2AECA 3NGWA 2YQHA 2AGDA 3I0CA 1ZI3A 1ZI5A 3OH0A 2X5SA 4AYJA 4HCQA 1MP5A 3OAMA 1XHBA 4Y6UA 3IOIA 4LW3A 2RJ7A 4G3PA 1V83A 1NWGB 1QG8A 1YP2A 4ECMA 2X60A 5DDTA 3IOJA 3RMWA 1PZTA 3U2TA 3V0QA 5C36A 3F1YA 1VGWA 1H7EA 5CQNX 5BXCA 5C3BA 1R80A 3U2WA 4FROA 2P72A 3PNNA 4IRQA 3CU0A 5C3DA 3U2VA 1H7QA 2FY7A 1ZCTA 2JCLA 2BO7A 2O1FA 4FRHA 2OEFA 5FU8A 1OMXA 2XWMA 3T7OA 1NQIB 4UEGA 1R7XA 1VICA 2ZU8A 1LL2A 4XWIA 1ON8A 1QGSA 2UX8A 4JD0A 1H7GA 1ZCVA 3OH3A 5CQLX 3ST8A 1VZTA 3R3IA 5CMJA 2YQSA 5EJ1A 1K4VA 3FOQA 1EYRA 4FREA 1GQCA 2Y4LA 1R82A 5I1FA 1IIMA 3I0LA 1FGGA 4LW6A 1W57A 4YS8A 2RJ9A 1GA8A 2XMHA 5FU0A 4CVHA 5L6SA 1FR9A 5C4EA 4Y7VA 1O0RA 1H5SA 3GUEA 1FO8A 4Y9XA 1TW1A 1GWWA 2VS4A 5C47A 1VH1A 2RJ1A 5C1GA 5C4DA 3U2UA 3U0XA 2AESA 1R7UA 2YCMA 4KC4A 2V0KA 2D7RA 2A8WA 3LW6A 3V0LA 1R7VA 1ZI1A 1JYLA 2P73A 2AM5A 3Q7UA 3I0GA 5EJZA 3SXDA 1WT3A 3CKVA 2A8UA 1SS9A 2AE7A 3OC9A 4B2XA 3DK5A 1GX0A 3CKJA 1MP4A 1ZIZA 4G87A 2RIYA 4EE5A 1GQ9A 1G9RA 4HO8A 1Z90A 1TZFA 5FTSA 4FRQA 1ZI4A 2XWNA 3TQDA 4AC3A 4B4BA 4M2AA 2VS3A 1ZCUA 3ZGGA 2YQCA 4NAKA 2FYBA 3ZLLA 4D0ZA 3ZF8A 2DPWA 3POLA 4FCUA 3K8EA 3SX8A 1H5SC 1KWSA 5C4CA 1VPAA 2D7IA 3Q4SA 3RSBA 1HJLA 2XMEA 4BMAA 3OH2A 1G97A 4DDZA 2Z87A 4MYBA 1R7YA 1TVYA 1G8OA 3I0FA 3OGZA 2O1GA 5JQQA 2VSIA 3N9WA 5DDVA 2FYDB 3U0YA 2RIZA 4R7PA 1H4DA 2V0JA 2BO6A 4B4MA 4CJ8A 4KXOA 5C1LA 3SX7A 3KIAA 5AJPA 3D8VA 1W55A 2RITA 3IOHA 4K6RA 4FRPA 1HM8A 2NXVA 1NKHB 2QGIA 3T7NA 3JTJA 1H7TA 5FUHA 2VS5A 3PKPA 1QWJA 4KNXA 1OQMB 4AYLA 1HV9A 3CKNA 5C4FA 1ZHJA 3K8DA 4Y64A 3V0PA 2X65A 4CJCA 3SXGA 4EE4A 1V82A 2OI5A 3FWWA 1H4CA 2RIXA 3ZGFA 4D11A 5FTVA 1JVDA 2WAWA 3V8ZA 1LZIA 5AJNA 1ZJ3A 2OEGA 2VSHA 4G3SA 2QKXA 2OI6A 1HM0A 4BQHA 3CKOA 5C8RA 2Y4JA 3OH4A 1INJA 3DUVA 1V84A 1ZJ0A 2VFZA 4Y7UA 4ASJA 2XWLA 1VM8A 4MNDA 3PKQA 3RMVA 3SXBA 2FYAA 4FRMA 2E8BA 4Y6NA 4Y63A 3R2WA 3BCVA 2ICXA 1FXOA 4Y62A 2YC5A 2PA4A 2YC3A 3D98A 1H7FA 1LZ0A 3I0JA 2RJ0A 2FFUA 4EEOA 1FWYA 1H3MA 5C49A 2APCA 1JYKA 4HO5A 2V0LA 1QGQA 1G2VA 2PX7A 4AAWA 1JVGA 1WT0A 2Q4JA 4HO3A 3V8YA 2Y4KA 1NF5B 1I52A 1LVWA 2CU2A 3SPTA 2FFVA 4HG6A 4D48A 4P02A 2O1HA 5IFYA 1LL3A 1INIA 3DJ4A 4DE7A 3E26A 4FCEA 4E1KA 1WT1A 2WE9A 2BO4A 4GBPA 1VGZA 3I0DA 3USQA 4KPXA 4FRLA 4FQWA 4HO6A 1IINA 3I0HA 2E3DA 2RJ4A 5C4BA 1H5RB 2YESA 1JV3A 4B3UA 3V0OA 4KC1A 1LZJA 3Q80A 3V91A 1HJJA 5L6VA 4NANA 5IDTA 2RJ5A 2AM3A 4Y7TA 1LL0A 1O7QA 1R7TA 2WEEA 3I0EA 1FGXA 2V0IA 3D5NA 5FYEA 1O7OA 1H5RA 4FRAA
chains in the Genus database with same CATH superfamily
1S4NA 2JCJA 4CJBA 4EEGA 2VXLA 3CGXA 4FRBA 4HO0A 1YP3A 1H7HA 3F1CA 4NALA 5IDSA 1VZXA 2VK9A 4KRVA 4EVWA 1ZDGA 4P00A 4ZDQA 2OI7A 4M2BA 2QH5A 2Z86A 1FRWA 2MZBA 5CQPA 2RJ6A 1FG5N 5EIYA 4FRDA 1ZJ1A 1H7LA 1GWVA 4ASYA 1HM9A 1TW5A 1YROB 1G95A 3JUKA 1FR8A 4C2SA 3O3PA 2JCOA 1H5SD 2ZU9A 4ARWA 1EZIA 1NMMB 2AM4A 1PZYB 2I5EA 1FO9A 3T7MA 4G3QA 3USRA 4M28A 1ZDFA 5J49A 3SXEA 1G3LA 2J0BA 4KNRA 3V90A 1ON6A 1WVCA 2I7BA 4HOCA 1GX4A 1S4OA 4FIXA 4B5BA 5C48A 3JUJA 2ICYA 1R81A 2YQJA 2RJ8A 1H4EA 4EE3A 3I0KA 1S4PA 4M4KA 4B2WA 1H5SB 4J18A 4KPZA 1VGUA 2V0HA 5C1HA 2WVKA 3EE5A 2Y7AA 3CKQA 4L41C 5HS2A 1VZUA 1WT2A 3U2XA 4NAIA 5CMGX 1XZ6A 4JISA 3BRKX 1ZJOA 4Y7GA 3SX3A 2VD4A 1NHEB 2W0VA 1WSZA 2GGQA 2Y6PA 2FYCB 2WVLA 3V0MA 5CMIA 4KT7A 3TZTA 2I5KA 1VGTA 4KQLA 2GGOA 5CMHA 1G23A 1FXJA 3SXCA 4D11C 5CQMX 1ZJ2A 1G93A 3V0NA 2X5ZA 1W77A 1ZJPA 2D0JA 5D92A 5C3AA 4KC2A 1MP3A 4IRPA 1O23B 2PGVA 1MC3A 1H5TB 3QVBA 3SXAA 1LZ7A 3ZLKA 5AJOA 3OKRA 5FV9A 2ZU7A 4EEAA 5CMFX 2PGYA 1OMZA 3SX5A 1YP4A 4EEMA 5CQOA 2WGZA 1ZCYA 3HL3A 2BO8A 4MIXA 2JCKA 1H5TA 4Y7FA 4B4GA 3E25A 1G0RA 1FZWA 4HO4A 1G1LA 3OH1A 2VXMA 4HO2A 5C38A 2WVMA 4B42A 1E5KA 3I0IX 4DECA 4HO9A 2P6WA 1FOAA 1VH3A 2W0WA 2Y4MA 1JV1A 4D0TA 2AH9A 2AECA 3NGWA 2YQHA 2AGDA 3I0CA 1ZI3A 1ZI5A 3OH0A 2X5SA 4AYJA 4HCQA 1MP5A 3OAMA 1XHBA 4Y6UA 3IOIA 4LW3A 2RJ7A 4G3PA 1V83A 1NWGB 1QG8A 1YP2A 4Q7CA 4ECMA 2X60A 5DDTA 3IOJA 3RMWA 4O6MA 1PZTA 3U2TA 3V0QA 5C36A 3F1YA 1VGWA 1H7EA 5CQNX 5BXCA 5C3BA 1R80A 3U2WA 4FROA 2P72A 3PNNA 4IRQA 3CU0A 5C3DA 3U2VA 1H7QA 2FY7A 1ZCTA 2JCLA 2BO7A 2O1FA 4FRHA 2OEFA 5FU8A 1OMXA 2XWMA 3T7OA 1NQIB 4UEGA 1R7XA 1VICA 2ZU8A 1LL2A 4XWIA 1ON8A 1QGSA 2UX8A 4JD0A 1H7GA 1ZCVA 3OH3A 5CQLX 3ST8A 1VZTA 3R3IA 5CMJA 2YQSA 4FIYA 5EJ1A 1K4VA 3FOQA 1EYRA 4FREA 1GQCA 2Y4LA 1R82A 5I1FA 1IIMA 3I0LA 1FGGA 4LW6A 1W57A 4YS8A 2RJ9A 1GA8A 2XMHA 5FU0A 4CVHA 5L6SA 1FR9A 5C4EA 4Y7VA 1O0RA 1H5SA 3GUEA 1FO8A 4Y9XA 1TW1A 1GWWA 2VS4A 5C47A 1VH1A 2RJ1A 5C1GA 5C4DA 3U2UA 3U0XA 2AESA 1R7UA 2YCMA 4KC4A 2V0KA 2D7RA 2A8WA 3LW6A 3V0LA 1R7VA 1ZI1A 1JYLA 2P73A 2AM5A 3Q7UA 3I0GA 5EJZA 3SXDA 1WT3A 3CKVA 2A8UA 1SS9A 2AE7A 3OC9A 4B2XA 1GX0A 3CKJA 1MP4A 1ZIZA 3DK5A 4G87A 2RIYA 4EE5A 1GQ9A 1G9RA 4HO8A 1Z90A 1TZFA 5FTSA 4FRQA 1ZI4A 2XWNA 3TQDA 4AC3A 4B4BA 4M2AA 2VS3A 1ZCUA 3ZGGA 2YQCA 4NAKA 2FYBA 3ZLLA 4D0ZA 3ZF8A 2DPWA 3POLA 4FCUA 3K8EA 3SX8A 1H5SC 1KWSA 5C4CA 1VPAA 2D7IA 3Q4SA 3RSBA 1HJLA 2XMEA 4BMAA 3OH2A 1G97A 4DDZA 2Z87A 4MYBA 1R7YA 1TVYA 1G8OA 3I0FA 3OGZA 2O1GA 5JQQA 2VSIA 3N9WA 5DDVA 2FYDB 3U0YA 2RIZA 4R7PA 1H4DA 2V0JA 2BO6A 4B4MA 4CJ8A 4KXOA 5C1LA 3SX7A 3KIAA 5AJPA 3D8VA 1W55A 2RITA 3IOHA 4K6RA 4FRPA 1HM8A 2NXVA 1NKHB 2QGIA 3T7NA 3JTJA 1H7TA 5FUHA 2VS5A 3PKPA 1QWJA 4KNXA 1OQMB 4AYLA 1HV9A 3CKNA 5C4FA 1ZHJA 2C0NA 3K8DA 4Y64A 3V0PA 2X65A 4CJCA 3SXGA 4EE4A 1V82A 2OI5A 3FWWA 1H4CA 2RIXA 3ZGFA 4D11A 5FTVA 1JVDA 2WAWA 3V8ZA 1LZIA 5AJNA 1ZJ3A 2OEGA 2VSHA 4G3SA 2QKXA 2OI6A 1HM0A 4BQHA 3CKOA 5C8RA 2Y4JA 3OH4A 1INJA 3DUVA 1V84A 1ZJ0A 2VFZA 4Y7UA 4ASJA 2XWLA 1VM8A 4MNDA 3PKQA 3RMVA 3SXBA 2FYAA 4FRMA 2E8BA 4Y6NA 4Y63A 3R2WA 3BCVA 2ICXA 1FXOA 4Y62A 2YC5A 2PA4A 2YC3A 3D98A 1H7FA 1LZ0A 3I0JA 2RJ0A 2FFUA 4EEOA 1FWYA 1H3MA 5C49A 2APCA 1JYKA 4HO5A 2V0LA 1QGQA 1G2VA 2PX7A 4AAWA 1JVGA 1WT0A 2Q4JA 4HO3A 3V8YA 2Y4KA 1NF5B 1I52A 1LVWA 2CU2A 3SPTA 2FFVA 4HG6A 4D48A 4P02A 2O1HA 5IFYA 4O6NA 1LL3A 1INIA 3DJ4A 4DE7A 3E26A 4FCEA 4E1KA 1WT1A 2WE9A 2BO4A 4GBPA 5D91A 1VGZA 3I0DA 3USQA 4KPXA 4FRLA 4FQWA 4HO6A 1IINA 3I0HA 2E3DA 2RJ4A 5C4BA 1H5RB 2YESA 1JV3A 4B3UA 3V0OA 4KC1A 1LZJA 3Q80A 3V91A 1HJJA 5L6VA 4NANA 5IDTA 2RJ5A 2AM3A 2J0AA 4Y7TA 1LL0A 1O7QA 1R7TA 2WEEA 3I0EA 1FGXA 2V0IA 3D5NA 5FYEA 1O7OA 1H5RA 4FRAA
chains in the Genus database with same CATH topology
1S4NA 2JCJA 4CJBA 4EEGA 2VXLA 3CGXA 4FRBA 4HO0A 1YP3A 1H7HA 3F1CA 4NALA 5IDSA 1VZXA 2VK9A 4KRVA 4EVWA 1ZDGA 4P00A 4ZDQA 2OI7A 4M2BA 2QH5A 2Z86A 1FRWA 2MZBA 5CQPA 2RJ6A 1FG5N 5EIYA 4FRDA 1ZJ1A 1H7LA 1GWVA 4ASYA 1HM9A 1TW5A 1YROB 1G95A 3JUKA 1FR8A 4C2SA 3O3PA 2JCOA 1H5SD 2ZU9A 4ARWA 1EZIA 1NMMB 2AM4A 1PZYB 2I5EA 1FO9A 3T7MA 4G3QA 3USRA 4M28A 1ZDFA 5J49A 3SXEA 1G3LA 2J0BA 4KNRA 3V90A 1ON6A 1WVCA 2I7BA 4HOCA 1GX4A 1S4OA 4FIXA 4B5BA 5C48A 3JUJA 2ICYA 1R81A 2YQJA 2RJ8A 1H4EA 4EE3A 3I0KA 1S4PA 4M4KA 4B2WA 1H5SB 4J18A 4KPZA 1VGUA 2V0HA 5C1HA 2WVKA 3EE5A 2Y7AA 3CKQA 4L41C 5HS2A 1VZUA 1WT2A 3U2XA 4NAIA 5CMGX 1XZ6A 4JISA 3BRKX 1ZJOA 4Y7GA 3SX3A 2VD4A 1NHEB 2W0VA 1WSZA 2GGQA 2Y6PA 2FYCB 2WVLA 3V0MA 5CMIA 4KT7A 3TZTA 2I5KA 1VGTA 4KQLA 2GGOA 5CMHA 1G23A 1FXJA 3SXCA 4D11C 5CQMX 1ZJ2A 1G93A 3V0NA 2X5ZA 1W77A 1ZJPA 2D0JA 5D92A 5C3AA 4KC2A 1MP3A 4IRPA 1O23B 2PGVA 1MC3A 1H5TB 3QVBA 3SXAA 1LZ7A 3ZLKA 5AJOA 3OKRA 5FV9A 2ZU7A 4EEAA 5CMFX 2PGYA 1OMZA 3SX5A 1YP4A 4EEMA 5CQOA 2WGZA 1ZCYA 3HL3A 2BO8A 4MIXA 2JCKA 1H5TA 4Y7FA 4B4GA 3E25A 1G0RA 1FZWA 4HO4A 1G1LA 3OH1A 2VXMA 4HO2A 5C38A 2WVMA 4B42A 1E5KA 3I0IX 4DECA 4HO9A 2P6WA 1FOAA 1VH3A 2W0WA 2Y4MA 1JV1A 4D0TA 2AH9A 2AECA 3NGWA 2YQHA 2AGDA 3I0CA 1ZI3A 1ZI5A 3OH0A 2X5SA 4AYJA 4HCQA 1MP5A 3OAMA 1XHBA 4Y6UA 3IOIA 4LW3A 2RJ7A 4G3PA 1V83A 1NWGB 1QG8A 1YP2A 4Q7CA 4ECMA 2X60A 5DDTA 3IOJA 3RMWA 4O6MA 1PZTA 3U2TA 3V0QA 5C36A 3F1YA 1VGWA 1H7EA 5CQNX 5BXCA 5C3BA 1R80A 3U2WA 4FROA 2P72A 3PNNA 4IRQA 3CU0A 5C3DA 3U2VA 1H7QA 2FY7A 1ZCTA 2JCLA 2BO7A 2O1FA 4FRHA 2OEFA 5FU8A 1OMXA 2XWMA 3T7OA 1NQIB 4UEGA 1R7XA 1VICA 2ZU8A 1LL2A 4XWIA 1ON8A 1QGSA 2UX8A 4JD0A 1H7GA 1ZCVA 3OH3A 5CQLX 3ST8A 1VZTA 3R3IA 5CMJA 2YQSA 4FIYA 5EJ1A 1K4VA 3FOQA 1EYRA 4FREA 1GQCA 2Y4LA 1R82A 5I1FA 1IIMA 3I0LA 1FGGA 4LW6A 1W57A 4YS8A 2RJ9A 1GA8A 2XMHA 5FU0A 4CVHA 5L6SA 1FR9A 5C4EA 4Y7VA 1O0RA 1H5SA 3GUEA 1FO8A 4Y9XA 1TW1A 1GWWA 2VS4A 5C47A 1VH1A 2RJ1A 5C1GA 5C4DA 3U2UA 3U0XA 2AESA 1R7UA 2YCMA 4KC4A 2V0KA 2D7RA 2A8WA 3LW6A 3V0LA 1R7VA 1ZI1A 1JYLA 2P73A 2AM5A 3Q7UA 3I0GA 5EJZA 3SXDA 1WT3A 3CKVA 2A8UA 1SS9A 2AE7A 3OC9A 4B2XA 1GX0A 3CKJA 1MP4A 1ZIZA 3DK5A 4G87A 2RIYA 4EE5A 1GQ9A 1G9RA 4HO8A 1Z90A 1TZFA 5FTSA 4FRQA 1ZI4A 2XWNA 3TQDA 4AC3A 4B4BA 4M2AA 2VS3A 1ZCUA 3ZGGA 2YQCA 4NAKA 2FYBA 3ZLLA 4D0ZA 3ZF8A 2DPWA 3POLA 4FCUA 3K8EA 3SX8A 1H5SC 1KWSA 5C4CA 1VPAA 2D7IA 3Q4SA 3RSBA 1HJLA 2XMEA 4BMAA 3OH2A 1G97A 4DDZA 2Z87A 4MYBA 1R7YA 1TVYA 1G8OA 3I0FA 3OGZA 2O1GA 5JQQA 2VSIA 3N9WA 5DDVA 2FYDB 3U0YA 2RIZA 4R7PA 1H4DA 2V0JA 2BO6A 4B4MA 4CJ8A 4KXOA 5C1LA 3SX7A 3KIAA 5AJPA 3D8VA 1W55A 2RITA 3IOHA 4K6RA 4FRPA 1HM8A 2NXVA 1NKHB 2QGIA 3T7NA 3JTJA 1H7TA 5FUHA 2VS5A 3PKPA 1QWJA 4KNXA 1OQMB 4AYLA 1HV9A 3CKNA 5C4FA 1ZHJA 2C0NA 3K8DA 4Y64A 3V0PA 2X65A 4CJCA 3SXGA 4EE4A 1V82A 2OI5A 3FWWA 1H4CA 2RIXA 3ZGFA 4D11A 5FTVA 1JVDA 2WAWA 3V8ZA 1LZIA 5AJNA 1ZJ3A 2OEGA 2VSHA 4G3SA 2QKXA 2OI6A 1HM0A 4BQHA 3CKOA 5C8RA 2Y4JA 3OH4A 1INJA 3DUVA 1V84A 1ZJ0A 2VFZA 4Y7UA 4ASJA 2XWLA 1VM8A 4MNDA 3PKQA 3RMVA 3SXBA 2FYAA 4FRMA 2E8BA 4Y6NA 4Y63A 3R2WA 3BCVA 2ICXA 1FXOA 4Y62A 2YC5A 2PA4A 2YC3A 3D98A 1H7FA 1LZ0A 3I0JA 2RJ0A 2FFUA 4EEOA 1FWYA 1H3MA 5C49A 2APCA 1JYKA 4HO5A 2V0LA 1QGQA 1G2VA 2PX7A 4AAWA 1JVGA 1WT0A 2Q4JA 4HO3A 3V8YA 2Y4KA 1NF5B 1I52A 1LVWA 2CU2A 3SPTA 2FFVA 4HG6A 4D48A 4P02A 2O1HA 5IFYA 4O6NA 1LL3A 1INIA 3DJ4A 4DE7A 3E26A 4FCEA 4E1KA 1WT1A 2WE9A 2BO4A 4GBPA 5D91A 1VGZA 3I0DA 3USQA 4KPXA 4FRLA 4FQWA 4HO6A 1IINA 3I0HA 2E3DA 2RJ4A 5C4BA 1H5RB 2YESA 1JV3A 4B3UA 3V0OA 4KC1A 1LZJA 3Q80A 3V91A 1HJJA 5L6VA 4NANA 5IDTA 2RJ5A 2AM3A 2J0AA 4Y7TA 1LL0A 1O7QA 1R7TA 2WEEA 3I0EA 1FGXA 2V0IA 3D5NA 5FYEA 1O7OA 1H5RA 4FRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S4N A;  2JCJ A;  4CJB A;  4EEG A;  2VXL A;  3CGX A;  4FRB A;  4HO0 A;  1YP3 A;  1H7H A;  3F1C A;  4NAL A;  5IDS A;  1VZX A;  4KRV A;  4EVW A;  1ZDG A;  4P00 A;  4ZDQ A;  2OI7 A;  4M2B A;  2QH5 A;  2Z86 A;  1FRW A;  2MZB A;  5CQP A;  2RJ6 A;  1FG5 N;  5EIY A;  4FRD A;  1ZJ1 A;  1H7L A;  1GWV A;  4ASY A;  1HM9 A;  1TW5 A;  1YRO B;  1G95 A;  3JUK A;  1FR8 A;  4C2S A;  3O3P A;  2JCO A;  1H5S D;  2ZU9 A;  4ARW A;  1EZI A;  1NMM B;  2AM4 A;  1PZY B;  2I5E A;  1FO9 A;  3T7M A;  4G3Q A;  3USR A;  4M28 A;  1ZDF A;  5J49 A;  3SXE A;  1G3L A;  4KNR A;  3V90 A;  1ON6 A;  1WVC A;  2I7B A;  4HOC A;  1GX4 A;  1S4O A;  4B5B A;  5C48 A;  3JUJ A;  2ICY A;  1R81 A;  2YQJ A;  2RJ8 A;  1H4E A;  4EE3 A;  3I0K A;  1S4P A;  4M4K A;  4B2W A;  1H5S B;  4J18 A;  4KPZ A;  1VGU A;  2V0H A;  5C1H A;  2WVK A;  3EE5 A;  2Y7A A;  3CKQ A;  4L41 C;  5HS2 A;  1VZU A;  1WT2 A;  3U2X A;  4NAI A;  5CMG X;  1XZ6 A;  4JIS A;  3BRK X;  1ZJO A;  4Y7G A;  3SX3 A;  2VD4 A;  1NHE B;  2W0V A;  1WSZ A;  2GGQ A;  2Y6P A;  2FYC B;  2WVL A;  3V0M A;  5CMI A;  4KT7 A;  3TZT A;  2I5K A;  1VGT A;  4KQL A;  2GGO A;  5CMH A;  1G23 A;  1FXJ A;  3SXC A;  4D11 C;  5CQM X;  1ZJ2 A;  1G93 A;  3V0N A;  2X5Z A;  1W77 A;  1ZJP A;  2D0J A;  5C3A A;  4KC2 A;  1MP3 A;  4IRP A;  1O23 B;  2PGV A;  1MC3 A;  1H5T B;  3QVB A;  3SXA A;  1LZ7 A;  3ZLK A;  5AJO A;  3OKR A;  5FV9 A;  2ZU7 A;  4EEA A;  5CMF X;  2PGY A;  1OMZ A;  3SX5 A;  1YP4 A;  4EEM A;  5CQO A;  2WGZ A;  1ZCY A;  3HL3 A;  2BO8 A;  2JCK A;  1H5T A;  4Y7F A;  4B4G A;  3E25 A;  1G0R A;  1FZW A;  4HO4 A;  1G1L A;  3OH1 A;  2VXM A;  4HO2 A;  5C38 A;  2WVM A;  4B42 A;  1E5K A;  3I0I X;  4DEC A;  4HO9 A;  2P6W A;  1FOA A;  1VH3 A;  2W0W A;  2Y4M A;  1JV1 A;  4D0T A;  2AH9 A;  2AEC A;  3NGW A;  2YQH A;  2AGD A;  3I0C A;  1ZI3 A;  1ZI5 A;  3OH0 A;  2X5S A;  4AYJ A;  4HCQ A;  1MP5 A;  3OAM A;  1XHB A;  4Y6U A;  3IOI A;  4LW3 A;  2RJ7 A;  4G3P A;  1V83 A;  1NWG B;  1QG8 A;  1YP2 A;  4ECM A;  2X60 A;  5DDT A;  3IOJ A;  3RMW A;  1PZT A;  3U2T A;  3V0Q A;  5C36 A;  3F1Y A;  1VGW A;  1H7E A;  5CQN X;  5BXC A;  5C3B A;  1R80 A;  3U2W A;  4FRO A;  2P72 A;  3PNN A;  4IRQ A;  3CU0 A;  5C3D A;  3U2V A;  1H7Q A;  2FY7 A;  1ZCT A;  2JCL A;  2BO7 A;  2O1F A;  4FRH A;  2OEF A;  5FU8 A;  1OMX A;  2XWM A;  3T7O A;  1NQI B;  4UEG A;  1R7X A;  1VIC A;  2ZU8 A;  1LL2 A;  4XWI A;  1ON8 A;  1QGS A;  2UX8 A;  4JD0 A;  1H7G A;  1ZCV A;  3OH3 A;  5CQL X;  3ST8 A;  1VZT A;  3R3I A;  5CMJ A;  2YQS A;  5EJ1 A;  1K4V A;  3FOQ A;  1EYR A;  4FRE A;  1GQC A;  2Y4L A;  1R82 A;  5I1F A;  1IIM A;  3I0L A;  1FGG A;  4LW6 A;  1W57 A;  4YS8 A;  2RJ9 A;  1GA8 A;  2XMH A;  5FU0 A;  4CVH A;  5L6S A;  1FR9 A;  5C4E A;  4Y7V A;  1O0R A;  1H5S A;  3GUE A;  1FO8 A;  4Y9X A;  1TW1 A;  1GWW A;  2VS4 A;  5C47 A;  1VH1 A;  2RJ1 A;  5C1G A;  5C4D A;  3U2U A;  3U0X A;  2AES A;  1R7U A;  2YCM A;  4KC4 A;  2V0K A;  2D7R A;  2A8W A;  3LW6 A;  3V0L A;  1R7V A;  1ZI1 A;  1JYL A;  2P73 A;  2AM5 A;  3Q7U A;  3I0G A;  5EJZ A;  3SXD A;  1WT3 A;  3CKV A;  2A8U A;  1SS9 A;  2AE7 A;  3OC9 A;  4B2X A;  3DK5 A;  1GX0 A;  3CKJ A;  1MP4 A;  1ZIZ A;  4G87 A;  2RIY A;  4EE5 A;  1GQ9 A;  1G9R A;  4HO8 A;  1Z90 A;  1TZF A;  5FTS A;  4FRQ A;  1ZI4 A;  2XWN A;  3TQD A;  4AC3 A;  4B4B A;  4M2A A;  2VS3 A;  1ZCU A;  3ZGG A;  2YQC A;  4NAK A;  2FYB A;  3ZLL A;  4D0Z A;  3ZF8 A;  2DPW A;  3POL A;  4FCU A;  3K8E A;  3SX8 A;  1H5S C;  1KWS A;  5C4C A;  1VPA A;  2D7I A;  3Q4S A;  3RSB A;  1HJL A;  2XME A;  4BMA A;  3OH2 A;  1G97 A;  4DDZ A;  2Z87 A;  4MYB A;  1R7Y A;  1TVY A;  1G8O A;  3I0F A;  3OGZ A;  2O1G A;  5JQQ A;  2VSI A;  3N9W A;  5DDV A;  2FYD B;  3U0Y A;  2RIZ A;  4R7P A;  1H4D A;  2V0J A;  2BO6 A;  4B4M A;  4CJ8 A;  4KXO A;  5C1L A;  3SX7 A;  3KIA A;  5AJP A;  3D8V A;  1W55 A;  2RIT A;  3IOH A;  4K6R A;  4FRP A;  1HM8 A;  2NXV A;  1NKH B;  2QGI A;  3T7N A;  3JTJ A;  1H7T A;  5FUH A;  2VS5 A;  3PKP A;  1QWJ A;  4KNX A;  1OQM B;  4AYL A;  1HV9 A;  3CKN A;  5C4F A;  1ZHJ A;  3K8D A;  4Y64 A;  3V0P A;  2X65 A;  4CJC A;  3SXG A;  4EE4 A;  1V82 A;  2OI5 A;  3FWW A;  1H4C A;  2RIX A;  3ZGF A;  4D11 A;  5FTV A;  1JVD A;  2WAW A;  3V8Z A;  1LZI A;  5AJN A;  1ZJ3 A;  2OEG A;  2VSH A;  4G3S A;  2QKX A;  2OI6 A;  1HM0 A;  4BQH A;  3CKO A;  5C8R A;  2Y4J A;  3OH4 A;  1INJ A;  3DUV A;  1V84 A;  1ZJ0 A;  2VFZ A;  4Y7U A;  4ASJ A;  2XWL A;  1VM8 A;  4MND A;  3PKQ A;  3RMV A;  3SXB A;  2FYA A;  4FRM A;  2E8B A;  4Y6N A;  4Y63 A;  3R2W A;  3BCV A;  2ICX A;  1FXO A;  4Y62 A;  2YC5 A;  2PA4 A;  2YC3 A;  3D98 A;  1H7F A;  1LZ0 A;  3I0J A;  2RJ0 A;  2FFU A;  4EEO A;  1FWY A;  1H3M A;  5C49 A;  2APC A;  1JYK A;  4HO5 A;  2V0L A;  1QGQ A;  1G2V A;  2PX7 A;  4AAW A;  1JVG A;  1WT0 A;  2Q4J A;  4HO3 A;  3V8Y A;  2Y4K A;  1NF5 B;  1I52 A;  1LVW A;  2CU2 A;  3SPT A;  2FFV A;  4HG6 A;  4D48 A;  4P02 A;  2O1H A;  5IFY A;  1LL3 A;  1INI A;  3DJ4 A;  4DE7 A;  3E26 A;  4FCE A;  4E1K A;  1WT1 A;  2WE9 A;  2BO4 A;  4GBP A;  1VGZ A;  3I0D A;  3USQ A;  4KPX A;  4FRL A;  4FQW A;  4HO6 A;  1IIN A;  3I0H A;  2E3D A;  2RJ4 A;  5C4B A;  1H5R B;  2YES A;  1JV3 A;  4B3U A;  3V0O A;  4KC1 A;  1LZJ A;  3Q80 A;  3V91 A;  1HJJ A;  5L6V A;  4NAN A;  5IDT A;  2RJ5 A;  2AM3 A;  4Y7T A;  1LL0 A;  1O7Q A;  1R7T A;  2WEE A;  3I0E A;  1FGX A;  2V0I A;  3D5N A;  5FYE A;  1O7O A;  1H5R A;  4FRA A; 
#chains in the Genus database with same CATH topology
 1S4N A;  2JCJ A;  4CJB A;  4EEG A;  2VXL A;  3CGX A;  4FRB A;  4HO0 A;  1YP3 A;  1H7H A;  3F1C A;  4NAL A;  5IDS A;  1VZX A;  2VK9 A;  4KRV A;  4EVW A;  1ZDG A;  4P00 A;  4ZDQ A;  2OI7 A;  4M2B A;  2QH5 A;  2Z86 A;  1FRW A;  2MZB A;  5CQP A;  2RJ6 A;  1FG5 N;  5EIY A;  4FRD A;  1ZJ1 A;  1H7L A;  1GWV A;  4ASY A;  1HM9 A;  1TW5 A;  1YRO B;  1G95 A;  3JUK A;  1FR8 A;  4C2S A;  3O3P A;  2JCO A;  1H5S D;  2ZU9 A;  4ARW A;  1EZI A;  1NMM B;  2AM4 A;  1PZY B;  2I5E A;  1FO9 A;  3T7M A;  4G3Q A;  3USR A;  4M28 A;  1ZDF A;  5J49 A;  3SXE A;  1G3L A;  2J0B A;  4KNR A;  3V90 A;  1ON6 A;  1WVC A;  2I7B A;  4HOC A;  1GX4 A;  1S4O A;  4FIX A;  4B5B A;  5C48 A;  3JUJ A;  2ICY A;  1R81 A;  2YQJ A;  2RJ8 A;  1H4E A;  4EE3 A;  3I0K A;  1S4P A;  4M4K A;  4B2W A;  1H5S B;  4J18 A;  4KPZ A;  1VGU A;  2V0H A;  5C1H A;  2WVK A;  3EE5 A;  2Y7A A;  3CKQ A;  4L41 C;  5HS2 A;  1VZU A;  1WT2 A;  3U2X A;  4NAI A;  5CMG X;  1XZ6 A;  4JIS A;  3BRK X;  1ZJO A;  4Y7G A;  3SX3 A;  2VD4 A;  1NHE B;  2W0V A;  1WSZ A;  2GGQ A;  2Y6P A;  2FYC B;  2WVL A;  3V0M A;  5CMI A;  4KT7 A;  3TZT A;  2I5K A;  1VGT A;  4KQL A;  2GGO A;  5CMH A;  1G23 A;  1FXJ A;  3SXC A;  4D11 C;  5CQM X;  1ZJ2 A;  1G93 A;  3V0N A;  2X5Z A;  1W77 A;  1ZJP A;  2D0J A;  5D92 A;  5C3A A;  4KC2 A;  1MP3 A;  4IRP A;  1O23 B;  2PGV A;  1MC3 A;  1H5T B;  3QVB A;  3SXA A;  1LZ7 A;  3ZLK A;  5AJO A;  3OKR A;  5FV9 A;  2ZU7 A;  4EEA A;  5CMF X;  2PGY A;  1OMZ A;  3SX5 A;  1YP4 A;  4EEM A;  5CQO A;  2WGZ A;  1ZCY A;  3HL3 A;  2BO8 A;  4MIX A;  2JCK A;  1H5T A;  4Y7F A;  4B4G A;  3E25 A;  1G0R A;  1FZW A;  4HO4 A;  1G1L A;  3OH1 A;  2VXM A;  4HO2 A;  5C38 A;  2WVM A;  4B42 A;  1E5K A;  3I0I X;  4DEC A;  4HO9 A;  2P6W A;  1FOA A;  1VH3 A;  2W0W A;  2Y4M A;  1JV1 A;  4D0T A;  2AH9 A;  2AEC A;  3NGW A;  2YQH A;  2AGD A;  3I0C A;  1ZI3 A;  1ZI5 A;  3OH0 A;  2X5S A;  4AYJ A;  4HCQ A;  1MP5 A;  3OAM A;  1XHB A;  4Y6U A;  3IOI A;  4LW3 A;  2RJ7 A;  4G3P A;  1V83 A;  1NWG B;  1QG8 A;  1YP2 A;  4Q7C A;  4ECM A;  2X60 A;  5DDT A;  3IOJ A;  3RMW A;  4O6M A;  1PZT A;  3U2T A;  3V0Q A;  5C36 A;  3F1Y A;  1VGW A;  1H7E A;  5CQN X;  5BXC A;  5C3B A;  1R80 A;  3U2W A;  4FRO A;  2P72 A;  3PNN A;  4IRQ A;  3CU0 A;  5C3D A;  3U2V A;  1H7Q A;  2FY7 A;  1ZCT A;  2JCL A;  2BO7 A;  2O1F A;  4FRH A;  2OEF A;  5FU8 A;  1OMX A;  2XWM A;  3T7O A;  1NQI B;  4UEG A;  1R7X A;  1VIC A;  2ZU8 A;  1LL2 A;  4XWI A;  1ON8 A;  1QGS A;  2UX8 A;  4JD0 A;  1H7G A;  1ZCV A;  3OH3 A;  5CQL X;  3ST8 A;  1VZT A;  3R3I A;  5CMJ A;  2YQS A;  4FIY A;  5EJ1 A;  1K4V A;  3FOQ A;  1EYR A;  4FRE A;  1GQC A;  2Y4L A;  1R82 A;  5I1F A;  1IIM A;  3I0L A;  1FGG A;  4LW6 A;  1W57 A;  4YS8 A;  2RJ9 A;  1GA8 A;  2XMH A;  5FU0 A;  4CVH A;  5L6S A;  1FR9 A;  5C4E A;  4Y7V A;  1O0R A;  1H5S A;  3GUE A;  1FO8 A;  4Y9X A;  1TW1 A;  1GWW A;  2VS4 A;  5C47 A;  1VH1 A;  2RJ1 A;  5C1G A;  5C4D A;  3U2U A;  3U0X A;  2AES A;  1R7U A;  2YCM A;  4KC4 A;  2V0K A;  2D7R A;  2A8W A;  3LW6 A;  3V0L A;  1R7V A;  1ZI1 A;  1JYL A;  2P73 A;  2AM5 A;  3Q7U A;  3I0G A;  5EJZ A;  3SXD A;  1WT3 A;  3CKV A;  2A8U A;  1SS9 A;  2AE7 A;  3OC9 A;  4B2X A;  1GX0 A;  3CKJ A;  1MP4 A;  1ZIZ A;  3DK5 A;  4G87 A;  2RIY A;  4EE5 A;  1GQ9 A;  1G9R A;  4HO8 A;  1Z90 A;  1TZF A;  5FTS A;  4FRQ A;  1ZI4 A;  2XWN A;  3TQD A;  4AC3 A;  4B4B A;  4M2A A;  2VS3 A;  1ZCU A;  3ZGG A;  2YQC A;  4NAK A;  2FYB A;  3ZLL A;  4D0Z A;  3ZF8 A;  2DPW A;  3POL A;  4FCU A;  3K8E A;  3SX8 A;  1H5S C;  1KWS A;  5C4C A;  1VPA A;  2D7I A;  3Q4S A;  3RSB A;  1HJL A;  2XME A;  4BMA A;  3OH2 A;  1G97 A;  4DDZ A;  2Z87 A;  4MYB A;  1R7Y A;  1TVY A;  1G8O A;  3I0F A;  3OGZ A;  2O1G A;  5JQQ A;  2VSI A;  3N9W A;  5DDV A;  2FYD B;  3U0Y A;  2RIZ A;  4R7P A;  1H4D A;  2V0J A;  2BO6 A;  4B4M A;  4CJ8 A;  4KXO A;  5C1L A;  3SX7 A;  3KIA A;  5AJP A;  3D8V A;  1W55 A;  2RIT A;  3IOH A;  4K6R A;  4FRP A;  1HM8 A;  2NXV A;  1NKH B;  2QGI A;  3T7N A;  3JTJ A;  1H7T A;  5FUH A;  2VS5 A;  3PKP A;  1QWJ A;  4KNX A;  1OQM B;  4AYL A;  1HV9 A;  3CKN A;  5C4F A;  1ZHJ A;  2C0N A;  3K8D A;  4Y64 A;  3V0P A;  2X65 A;  4CJC A;  3SXG A;  4EE4 A;  1V82 A;  2OI5 A;  3FWW A;  1H4C A;  2RIX A;  3ZGF A;  4D11 A;  5FTV A;  1JVD A;  2WAW A;  3V8Z A;  1LZI A;  5AJN A;  1ZJ3 A;  2OEG A;  2VSH A;  4G3S A;  2QKX A;  2OI6 A;  1HM0 A;  4BQH A;  3CKO A;  5C8R A;  2Y4J A;  3OH4 A;  1INJ A;  3DUV A;  1V84 A;  1ZJ0 A;  2VFZ A;  4Y7U A;  4ASJ A;  2XWL A;  1VM8 A;  4MND A;  3PKQ A;  3RMV A;  3SXB A;  2FYA A;  4FRM A;  2E8B A;  4Y6N A;  4Y63 A;  3R2W A;  3BCV A;  2ICX A;  1FXO A;  4Y62 A;  2YC5 A;  2PA4 A;  2YC3 A;  3D98 A;  1H7F A;  1LZ0 A;  3I0J A;  2RJ0 A;  2FFU A;  4EEO A;  1FWY A;  1H3M A;  5C49 A;  2APC A;  1JYK A;  4HO5 A;  2V0L A;  1QGQ A;  1G2V A;  2PX7 A;  4AAW A;  1JVG A;  1WT0 A;  2Q4J A;  4HO3 A;  3V8Y A;  2Y4K A;  1NF5 B;  1I52 A;  1LVW A;  2CU2 A;  3SPT A;  2FFV A;  4HG6 A;  4D48 A;  4P02 A;  2O1H A;  5IFY A;  4O6N A;  1LL3 A;  1INI A;  3DJ4 A;  4DE7 A;  3E26 A;  4FCE A;  4E1K A;  1WT1 A;  2WE9 A;  2BO4 A;  4GBP A;  5D91 A;  1VGZ A;  3I0D A;  3USQ A;  4KPX A;  4FRL A;  4FQW A;  4HO6 A;  1IIN A;  3I0H A;  2E3D A;  2RJ4 A;  5C4B A;  1H5R B;  2YES A;  1JV3 A;  4B3U A;  3V0O A;  4KC1 A;  1LZJ A;  3Q80 A;  3V91 A;  1HJJ A;  5L6V A;  4NAN A;  5IDT A;  2RJ5 A;  2AM3 A;  2J0A A;  4Y7T A;  1LL0 A;  1O7Q A;  1R7T A;  2WEE A;  3I0E A;  1FGX A;  2V0I A;  3D5N A;  5FYE A;  1O7O A;  1H5R A;  4FRA A; 
#chains in the Genus database with same CATH homology
 1S4N A;  2JCJ A;  4CJB A;  4EEG A;  2VXL A;  3CGX A;  4FRB A;  4HO0 A;  1YP3 A;  1H7H A;  3F1C A;  4NAL A;  5IDS A;  1VZX A;  2VK9 A;  4KRV A;  4EVW A;  1ZDG A;  4P00 A;  4ZDQ A;  2OI7 A;  4M2B A;  2QH5 A;  2Z86 A;  1FRW A;  2MZB A;  5CQP A;  2RJ6 A;  1FG5 N;  5EIY A;  4FRD A;  1ZJ1 A;  1H7L A;  1GWV A;  4ASY A;  1HM9 A;  1TW5 A;  1YRO B;  1G95 A;  3JUK A;  1FR8 A;  4C2S A;  3O3P A;  2JCO A;  1H5S D;  2ZU9 A;  4ARW A;  1EZI A;  1NMM B;  2AM4 A;  1PZY B;  2I5E A;  1FO9 A;  3T7M A;  4G3Q A;  3USR A;  4M28 A;  1ZDF A;  5J49 A;  3SXE A;  1G3L A;  2J0B A;  4KNR A;  3V90 A;  1ON6 A;  1WVC A;  2I7B A;  4HOC A;  1GX4 A;  1S4O A;  4FIX A;  4B5B A;  5C48 A;  3JUJ A;  2ICY A;  1R81 A;  2YQJ A;  2RJ8 A;  1H4E A;  4EE3 A;  3I0K A;  1S4P A;  4M4K A;  4B2W A;  1H5S B;  4J18 A;  4KPZ A;  1VGU A;  2V0H A;  5C1H A;  2WVK A;  3EE5 A;  2Y7A A;  3CKQ A;  4L41 C;  5HS2 A;  1VZU A;  1WT2 A;  3U2X A;  4NAI A;  5CMG X;  1XZ6 A;  4JIS A;  3BRK X;  1ZJO A;  4Y7G A;  3SX3 A;  2VD4 A;  1NHE B;  2W0V A;  1WSZ A;  2GGQ A;  2Y6P A;  2FYC B;  2WVL A;  3V0M A;  5CMI A;  4KT7 A;  3TZT A;  2I5K A;  1VGT A;  4KQL A;  2GGO A;  5CMH A;  1G23 A;  1FXJ A;  3SXC A;  4D11 C;  5CQM X;  1ZJ2 A;  1G93 A;  3V0N A;  2X5Z A;  1W77 A;  1ZJP A;  2D0J A;  5D92 A;  5C3A A;  4KC2 A;  1MP3 A;  4IRP A;  1O23 B;  2PGV A;  1MC3 A;  1H5T B;  3QVB A;  3SXA A;  1LZ7 A;  3ZLK A;  5AJO A;  3OKR A;  5FV9 A;  2ZU7 A;  4EEA A;  5CMF X;  2PGY A;  1OMZ A;  3SX5 A;  1YP4 A;  4EEM A;  5CQO A;  2WGZ A;  1ZCY A;  3HL3 A;  2BO8 A;  4MIX A;  2JCK A;  1H5T A;  4Y7F A;  4B4G A;  3E25 A;  1G0R A;  1FZW A;  4HO4 A;  1G1L A;  3OH1 A;  2VXM A;  4HO2 A;  5C38 A;  2WVM A;  4B42 A;  1E5K A;  3I0I X;  4DEC A;  4HO9 A;  2P6W A;  1FOA A;  1VH3 A;  2W0W A;  2Y4M A;  1JV1 A;  4D0T A;  2AH9 A;  2AEC A;  3NGW A;  2YQH A;  2AGD A;  3I0C A;  1ZI3 A;  1ZI5 A;  3OH0 A;  2X5S A;  4AYJ A;  4HCQ A;  1MP5 A;  3OAM A;  1XHB A;  4Y6U A;  3IOI A;  4LW3 A;  2RJ7 A;  4G3P A;  1V83 A;  1NWG B;  1QG8 A;  1YP2 A;  4Q7C A;  4ECM A;  2X60 A;  5DDT A;  3IOJ A;  3RMW A;  4O6M A;  1PZT A;  3U2T A;  3V0Q A;  5C36 A;  3F1Y A;  1VGW A;  1H7E A;  5CQN X;  5BXC A;  5C3B A;  1R80 A;  3U2W A;  4FRO A;  2P72 A;  3PNN A;  4IRQ A;  3CU0 A;  5C3D A;  3U2V A;  1H7Q A;  2FY7 A;  1ZCT A;  2JCL A;  2BO7 A;  2O1F A;  4FRH A;  2OEF A;  5FU8 A;  1OMX A;  2XWM A;  3T7O A;  1NQI B;  4UEG A;  1R7X A;  1VIC A;  2ZU8 A;  1LL2 A;  4XWI A;  1ON8 A;  1QGS A;  2UX8 A;  4JD0 A;  1H7G A;  1ZCV A;  3OH3 A;  5CQL X;  3ST8 A;  1VZT A;  3R3I A;  5CMJ A;  2YQS A;  4FIY A;  5EJ1 A;  1K4V A;  3FOQ A;  1EYR A;  4FRE A;  1GQC A;  2Y4L A;  1R82 A;  5I1F A;  1IIM A;  3I0L A;  1FGG A;  4LW6 A;  1W57 A;  4YS8 A;  2RJ9 A;  1GA8 A;  2XMH A;  5FU0 A;  4CVH A;  5L6S A;  1FR9 A;  5C4E A;  4Y7V A;  1O0R A;  1H5S A;  3GUE A;  1FO8 A;  4Y9X A;  1TW1 A;  1GWW A;  2VS4 A;  5C47 A;  1VH1 A;  2RJ1 A;  5C1G A;  5C4D A;  3U2U A;  3U0X A;  2AES A;  1R7U A;  2YCM A;  4KC4 A;  2V0K A;  2D7R A;  2A8W A;  3LW6 A;  3V0L A;  1R7V A;  1ZI1 A;  1JYL A;  2P73 A;  2AM5 A;  3Q7U A;  3I0G A;  5EJZ A;  3SXD A;  1WT3 A;  3CKV A;  2A8U A;  1SS9 A;  2AE7 A;  3OC9 A;  4B2X A;  1GX0 A;  3CKJ A;  1MP4 A;  1ZIZ A;  3DK5 A;  4G87 A;  2RIY A;  4EE5 A;  1GQ9 A;  1G9R A;  4HO8 A;  1Z90 A;  1TZF A;  5FTS A;  4FRQ A;  1ZI4 A;  2XWN A;  3TQD A;  4AC3 A;  4B4B A;  4M2A A;  2VS3 A;  1ZCU A;  3ZGG A;  2YQC A;  4NAK A;  2FYB A;  3ZLL A;  4D0Z A;  3ZF8 A;  2DPW A;  3POL A;  4FCU A;  3K8E A;  3SX8 A;  1H5S C;  1KWS A;  5C4C A;  1VPA A;  2D7I A;  3Q4S A;  3RSB A;  1HJL A;  2XME A;  4BMA A;  3OH2 A;  1G97 A;  4DDZ A;  2Z87 A;  4MYB A;  1R7Y A;  1TVY A;  1G8O A;  3I0F A;  3OGZ A;  2O1G A;  5JQQ A;  2VSI A;  3N9W A;  5DDV A;  2FYD B;  3U0Y A;  2RIZ A;  4R7P A;  1H4D A;  2V0J A;  2BO6 A;  4B4M A;  4CJ8 A;  4KXO A;  5C1L A;  3SX7 A;  3KIA A;  5AJP A;  3D8V A;  1W55 A;  2RIT A;  3IOH A;  4K6R A;  4FRP A;  1HM8 A;  2NXV A;  1NKH B;  2QGI A;  3T7N A;  3JTJ A;  1H7T A;  5FUH A;  2VS5 A;  3PKP A;  1QWJ A;  4KNX A;  1OQM B;  4AYL A;  1HV9 A;  3CKN A;  5C4F A;  1ZHJ A;  2C0N A;  3K8D A;  4Y64 A;  3V0P A;  2X65 A;  4CJC A;  3SXG A;  4EE4 A;  1V82 A;  2OI5 A;  3FWW A;  1H4C A;  2RIX A;  3ZGF A;  4D11 A;  5FTV A;  1JVD A;  2WAW A;  3V8Z A;  1LZI A;  5AJN A;  1ZJ3 A;  2OEG A;  2VSH A;  4G3S A;  2QKX A;  2OI6 A;  1HM0 A;  4BQH A;  3CKO A;  5C8R A;  2Y4J A;  3OH4 A;  1INJ A;  3DUV A;  1V84 A;  1ZJ0 A;  2VFZ A;  4Y7U A;  4ASJ A;  2XWL A;  1VM8 A;  4MND A;  3PKQ A;  3RMV A;  3SXB A;  2FYA A;  4FRM A;  2E8B A;  4Y6N A;  4Y63 A;  3R2W A;  3BCV A;  2ICX A;  1FXO A;  4Y62 A;  2YC5 A;  2PA4 A;  2YC3 A;  3D98 A;  1H7F A;  1LZ0 A;  3I0J A;  2RJ0 A;  2FFU A;  4EEO A;  1FWY A;  1H3M A;  5C49 A;  2APC A;  1JYK A;  4HO5 A;  2V0L A;  1QGQ A;  1G2V A;  2PX7 A;  4AAW A;  1JVG A;  1WT0 A;  2Q4J A;  4HO3 A;  3V8Y A;  2Y4K A;  1NF5 B;  1I52 A;  1LVW A;  2CU2 A;  3SPT A;  2FFV A;  4HG6 A;  4D48 A;  4P02 A;  2O1H A;  5IFY A;  4O6N A;  1LL3 A;  1INI A;  3DJ4 A;  4DE7 A;  3E26 A;  4FCE A;  4E1K A;  1WT1 A;  2WE9 A;  2BO4 A;  4GBP A;  5D91 A;  1VGZ A;  3I0D A;  3USQ A;  4KPX A;  4FRL A;  4FQW A;  4HO6 A;  1IIN A;  3I0H A;  2E3D A;  2RJ4 A;  5C4B A;  1H5R B;  2YES A;  1JV3 A;  4B3U A;  3V0O A;  4KC1 A;  1LZJ A;  3Q80 A;  3V91 A;  1HJJ A;  5L6V A;  4NAN A;  5IDT A;  2RJ5 A;  2AM3 A;  2J0A A;  4Y7T A;  1LL0 A;  1O7Q A;  1R7T A;  2WEE A;  3I0E A;  1FGX A;  2V0I A;  3D5N A;  5FYE A;  1O7O A;  1H5R A;  4FRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...