1H7QA

Dtdp-manganese complex of spsa from bacillus subtilis
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
255
structure length
240
Chain Sequence
PKVSVIMTSYNKSDYVAKSISSILSQTFSDFELFIMDDNSNEETLNVIRPFLNDNRVRFYQSDISGVKERTEKTRYAALINQAIEMAEGEYITYATDDNIYMPDRLLKMVRELDTHPEKAVIYSASKTYHLNDIVKETVRPAAQVTWNAPCAIDHCSVMHRYSVLEKVKEKFGSYWDESPAFYRIGDARFFWRVNHFYPFYPLDEELDLNYITDNEFVRNLPPQRNCRELRESLKKLGMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPORE COAT POLYSACCHARIDE BIOSYNTHESIS PROTEIN SPSA
publication title Three-Dimensional Structures of the Mn and Mg Dtdp Complexes of the Family Gt-2 Glycosyltransferase Spsa: A Comparison with Related Ndp-Sugar Glycosyltransferases.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 96
structure length 240
sequence length 255
ec nomenclature
pdb deposition date 2001-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1h7qA00
1H5SC 5C4EA 1ZI1A 2AESA 3D8VA 2X60A 2P72A 2WAWA 3RMWA 4B3UA 4FRBA 4FROA 2MZBA 4B4MA 3QVBA 4DDZA 3ZGFA 5C4DA 1H7HA 1O7QA 1VGTA 1G9RA 2OEGA 5CMFX 4E1KA 1ZJ1A 2Y4LA 3CKVA 4BQHA 2RITA 2VS3A 4B4BA 4EEOA 2Y4MA 3OH4A 4B42A 3ZF8A 2RIZA 1WT3A 2OI6A 1IIMA 2P73A 4CJ8A 1HV9A 2VS5A 3IOJA 4Y63A 2FYDB 5C38A 1ZCYA 1ZHJA 2JCOA 1E5KA 3F1CA 5C3AA 4FCEA 2V0HA 1I52A 2WVMA 2E8BA 1H4DA 3HL3A 4LW3A 2AM5A 2RJ9A 5C4FA 1FGGA 1FZWA 1LZ7A 1S4OA 4M2AA 2Y6PA 1ZJOA 3SX8A 3U2XA 3E25A 1NQIB 3CU0A 4HO4A 2XWMA 5IDSA 1R82A 2BO7A 3Q7UA 4Y6UA 1ZCVA 2RJ7A 1H4CA 3PNNA 5AJOA 3EE5A 5IFYA 4KPZA 4CVHA 5CMHA 4EEGA 3I0GA 1NWGB 2Z86A 4KNXA 1GA8A 1VZXA 4Y9XA 1OMZA 1MP4A 2AM4A 2OEFA 4G87A 3DUVA 1HM0A 1G0RA 2BO6A 4IRPA 2FFUA 4Y7TA 1LZ0A 3SXDA 3R3IA 5L6SA 1V84A 1ZJPA 2YQCA 1ZJ0A 2WGZA 4HOCA 1PZYB 4G3PA 5DDTA 5C3BA 2E3DA 4D11C 1G8OA 1TW5A 3BRKX 1ON6A 2YESA 2PGVA 1W55A 1GX0A 1WVCA 4HO2A 1ZDFA 1G2VA 1FWYA 2XWNA 2ICXA 1JVDA 2WVLA 2Y4KA 3FOQA 2QGIA 2P6WA 5CQLX 3JUJA 2D7IA 5FTVA 3D98A 5FYEA 4Y6NA 1JYKA 4AAWA 2ZU7A 1WT0A 3CKQA 3PKPA 2WEEA 2RJ4A 1H7FA 4JD0A 2PGYA 1V82A 1ZDGA 1LZJA 4FREA 3V0LA 2AH9A 2BO4A 3U2TA 5L6VA 2Q4JA 1IINA 3JTJA 4G3QA 1H7GA 1H7QA 2GGQA 2X5ZA 4FCUA 4R7PA 3OC9A 4EEAA 2VXLA 1LL3A 4IRQA 4MNDA 2APCA 1LL2A 2RIXA 4KC1A 4DE7A 4UEGA 2YCMA 3I0CA 3I0JA 1TVYA 2Y4JA 3Q4SA 2PX7A 4D48A 2FYCB 1MP3A 4M28A 4P00A 3V0NA 2O1GA 4FRPA 2V0JA 4B2XA 1YP3A 4FQWA 2ZU9A 1W77A 1ZIZA 4HO9A 1FXOA 1G93A 2FFVA 3OGZA 5C1HA 1K4VA 5CQPA 3RSBA 1TW1A 1SS9A 1JV1A 3OAMA 1G3LA 2WVKA 3LW6A 1YROB 3SXGA 5C8RA 4AC3A 5EJZA 4AYJA 2AM3A 2VS4A 3V0MA 4ZDQA 2RJ5A 4Y7FA 1LZIA 1VZTA 5CQMX 1R80A 2PA4A 3NGWA 1GQ9A 1R7VA 4D0TA 5C49A 2XWLA 3U0XA 2BO8A 3ZGGA 3U2UA 4NAIA 2CU2A 2FYBA 4KRVA 3KIAA 3TQDA 3JUKA 4G3SA 2NXVA 2RJ6A 2JCJA 1H5RA 3V91A 3V0QA 3USRA 2D7RA 2Z87A 1FG5N 3DK5A 5C3DA 1H4EA 4B2WA 3SPTA 1ZJ2A 4ASJA 4FRQA 1O7OA 1ZJ3A 2XMEA 3E26A 1ZI4A 1PZTA 3O3PA 4DECA 3RMVA 1ZI3A 4B5BA 2QH5A 1OMXA 2GGOA 3U2WA 2V0LA 2VXMA 2X65A 2YC3A 4CJBA 2A8WA 1INIA 3ST8A 1FRWA 5CMGX 1MC3A 4BMAA 1W57A 4XWIA 1NHEB 1H5SA 3SX7A 5DDVA 2AECA 1VGZA 2W0VA 4HO0A 3GUEA 2UX8A 3SX5A 1VGUA 4EEMA 3ZLKA 4Y7UA 4Y7VA 5FU8A 4J18A 4YS8A 5FU0A 2D0JA 4ASYA 1GWWA 2OI5A 5CMIA 1FO8A 1QWJA 4JISA 5J49A 2FY7A 4EVWA 1GX4A 2I7BA 3OH2A 4HO8A 1FOAA 4HG6A 1H7TA 4P02A 1FR8A 3V0PA 4ECMA 2OI7A 1G23A 2DPWA 1H5RB 1OQMB 3CKNA 2WE9A 3I0FA 5CQNX 1V83A 3IOIA 1O23B 4FRAA 2RJ0A 1ZI5A 3OKRA 2AE7A 5C4CA 2RJ8A 1WSZA 4FRLA 2YQSA 5CQOA 2YQHA 3ZLLA 1EYRA 1FO9A 2JCLA 5C4BA 3SXCA 2V0IA 4HO6A 3I0DA 1XHBA 3POLA 3SXAA 1FXJA 1VGWA 4KC4A 4FRDA 4AYLA 2RIYA 4GBPA 3T7NA 1ZCTA 1JV3A 3K8DA 5EJ1A 2Y7AA 1VH3A 1R7XA 1O0RA 3V8ZA 1QGQA 1MP5A 5FTSA 5FV9A 4NANA 1VH1A 1QG8A 4B4GA 2QKXA 4LW6A 3T7OA 1H5SB 3PKQA 1H5TA 5C47A 3USQA 5AJPA 4HO3A 4Y64A 1R7YA 4KC2A 1NKHB 3OH0A 5C1GA 4M2BA 3R2WA 1R81A 4M4KA 2YQJA 3SXEA 4EE5A 1FR9A 2VD4A 3OH1A 4L41C 3BCVA 4FRMA 4KQLA 4Y62A 3I0LA 4K6RA 2JCKA 3U2VA 4KXOA 2O1HA 2V0KA 4MYBA 3CGXA 4D11A 1VPAA 1JYLA 1VICA 1NF5B 1H7EA 2VSIA 4CJCA 1ZCUA 1S4PA 4Y7GA 1XZ6A 5HS2A 2A8UA 1R7UA 5FUHA 3SXBA 3CKOA 4NAKA 1VZUA 3K8EA 2VFZA 1HJLA 5C36A 4EE3A 3V90A 4D0ZA 3I0EA 1GQCA 3CKJA 3D5NA 3N9WA 1G95A 2W0WA 1NMMB 2XMHA 1G1LA 1H5SD 1R7TA 4HCQA 1H3MA 5JQQA 1VM8A 1Z90A 2AGDA 1EZIA 4KT7A 1H7LA 3T7MA 1KWSA 3I0IX 2FYAA 1GWVA 1WT1A 1LVWA 3OH3A 5C1LA 5AJNA 1HJJA 5BXCA 1ON8A 3IOHA 4EE4A 4KPXA 1HM8A 1LL0A 3FWWA 3F1YA 2YC5A 2I5EA 3SX3A 4NALA 1HM9A 1H5TB 1WT2A 1INJA 4HO5A 3TZTA 1TZFA 3Q80A 2O1FA 2ZU8A 5C48A 5CMJA 3V0OA 3I0HA 1QGSA 4C2SA 2ICYA 3U0YA 5EIYA 5I1FA 1YP4A 1FGXA 2I5KA 3I0KA 4FRHA 5IDTA 3DJ4A 1S4NA 2RJ1A 4ARWA 3V8YA 4KNRA 2VSHA 1G97A 1YP2A 1JVGA 2X5SA
chains in the Genus database with same CATH superfamily
1H5SC 5C4EA 1ZI1A 2AESA 3D8VA 2X60A 2P72A 2WAWA 3RMWA 4B3UA 4FRBA 4FROA 2MZBA 4B4MA 3QVBA 4DDZA 3ZGFA 5C4DA 1H7HA 1O7QA 1VGTA 4O6MA 1G9RA 2OEGA 5CMFX 4E1KA 1ZJ1A 2Y4LA 3CKVA 4BQHA 2RITA 2VS3A 4B4BA 4EEOA 2Y4MA 3OH4A 4B42A 4O6NA 3ZF8A 2RIZA 1WT3A 2OI6A 1IIMA 2P73A 4CJ8A 1HV9A 2VS5A 3IOJA 4Y63A 2FYDB 5C38A 1ZCYA 1ZHJA 2JCOA 1E5KA 3F1CA 5C3AA 4FCEA 2V0HA 1I52A 2WVMA 2E8BA 1H4DA 3HL3A 4LW3A 2AM5A 2RJ9A 5C4FA 4FIXA 1FGGA 1FZWA 1LZ7A 1S4OA 4M2AA 2Y6PA 1ZJOA 3SX8A 3U2XA 3E25A 1NQIB 3CU0A 4HO4A 2XWMA 5IDSA 1R82A 2BO7A 3Q7UA 4Y6UA 1ZCVA 2RJ7A 1H4CA 3PNNA 5AJOA 3EE5A 5IFYA 4KPZA 4CVHA 5CMHA 4EEGA 3I0GA 1NWGB 2Z86A 4KNXA 1GA8A 1VZXA 4Y9XA 1OMZA 1MP4A 2AM4A 2OEFA 4G87A 3DUVA 1HM0A 1G0RA 2BO6A 4IRPA 2FFUA 4Y7TA 1LZ0A 3SXDA 3R3IA 5L6SA 1V84A 1ZJPA 2YQCA 1ZJ0A 2WGZA 4HOCA 1PZYB 4G3PA 5DDTA 5C3BA 2E3DA 4D11C 1G8OA 1TW5A 3BRKX 1ON6A 2YESA 2PGVA 1W55A 1GX0A 1WVCA 4HO2A 1ZDFA 1G2VA 1FWYA 2XWNA 2ICXA 1JVDA 2WVLA 2Y4KA 3FOQA 2QGIA 2P6WA 2VK9A 5CQLX 3JUJA 2D7IA 5D92A 5FTVA 3D98A 5FYEA 4Y6NA 1JYKA 4AAWA 2ZU7A 1WT0A 3CKQA 3PKPA 2WEEA 2RJ4A 1H7FA 4JD0A 2PGYA 1V82A 1ZDGA 1LZJA 4FREA 3V0LA 2AH9A 2BO4A 3U2TA 5L6VA 2Q4JA 1IINA 3JTJA 4G3QA 1H7GA 1H7QA 2GGQA 2X5ZA 4FCUA 4R7PA 3OC9A 4EEAA 2J0AA 2VXLA 1LL3A 4IRQA 4MNDA 2APCA 1LL2A 2RIXA 4KC1A 4DE7A 4UEGA 2YCMA 3I0CA 3I0JA 1TVYA 2Y4JA 3Q4SA 2C0NA 2PX7A 4D48A 2FYCB 1MP3A 4M28A 4P00A 3V0NA 2O1GA 4FRPA 2V0JA 4FIYA 4B2XA 1YP3A 4FQWA 2ZU9A 1W77A 1ZIZA 4HO9A 1FXOA 1G93A 2FFVA 3OGZA 5C1HA 1K4VA 5CQPA 3RSBA 1TW1A 1SS9A 1JV1A 3OAMA 1G3LA 2WVKA 3LW6A 1YROB 3SXGA 5C8RA 4AC3A 5EJZA 4AYJA 2AM3A 2VS4A 3V0MA 4ZDQA 2RJ5A 4Y7FA 1LZIA 1VZTA 5CQMX 1R80A 2PA4A 3NGWA 1GQ9A 1R7VA 4D0TA 5C49A 2XWLA 3U0XA 2BO8A 3ZGGA 3U2UA 4NAIA 2CU2A 2FYBA 4KRVA 3KIAA 3TQDA 3JUKA 4G3SA 2NXVA 2RJ6A 2JCJA 1H5RA 3V91A 3V0QA 3USRA 2D7RA 2Z87A 1FG5N 3DK5A 5C3DA 1H4EA 4B2WA 3SPTA 1ZJ2A 4ASJA 4FRQA 1O7OA 1ZJ3A 2XMEA 3E26A 1ZI4A 1PZTA 3O3PA 4DECA 3RMVA 1ZI3A 4B5BA 2QH5A 1OMXA 2GGOA 3U2WA 2V0LA 2VXMA 2X65A 2YC3A 4Q7CA 4CJBA 2A8WA 1INIA 3ST8A 1FRWA 5CMGX 1MC3A 4BMAA 1W57A 4XWIA 1NHEB 1H5SA 3SX7A 5DDVA 2AECA 1VGZA 2W0VA 4HO0A 3GUEA 2UX8A 3SX5A 1VGUA 4EEMA 3ZLKA 4Y7UA 4Y7VA 5FU8A 4J18A 4YS8A 5FU0A 2D0JA 4ASYA 1GWWA 2OI5A 5CMIA 1FO8A 1QWJA 4JISA 5J49A 2FY7A 4EVWA 1GX4A 2I7BA 3OH2A 4HO8A 1FOAA 4HG6A 1H7TA 4P02A 1FR8A 3V0PA 4ECMA 2OI7A 1G23A 2DPWA 1H5RB 1OQMB 3CKNA 2WE9A 3I0FA 5CQNX 1V83A 3IOIA 1O23B 4FRAA 2RJ0A 1ZI5A 3OKRA 2AE7A 5C4CA 2RJ8A 1WSZA 4FRLA 2YQSA 5CQOA 2YQHA 3ZLLA 1EYRA 1FO9A 2JCLA 5C4BA 3SXCA 2V0IA 4HO6A 3I0DA 1XHBA 3POLA 3SXAA 1FXJA 1VGWA 4KC4A 4FRDA 4AYLA 2RIYA 4GBPA 3T7NA 1ZCTA 1JV3A 3K8DA 5EJ1A 2Y7AA 1VH3A 1R7XA 1O0RA 3V8ZA 1QGQA 1MP5A 5FTSA 4MIXA 5FV9A 4NANA 1VH1A 1QG8A 4B4GA 2QKXA 4LW6A 3T7OA 1H5SB 3PKQA 1H5TA 5C47A 3USQA 5AJPA 4HO3A 4Y64A 1R7YA 4KC2A 1NKHB 3OH0A 5C1GA 4M2BA 3R2WA 1R81A 4M4KA 2YQJA 3SXEA 4EE5A 1FR9A 2VD4A 3OH1A 4L41C 3BCVA 4FRMA 4KQLA 4Y62A 3I0LA 4K6RA 2JCKA 3U2VA 4KXOA 2O1HA 2V0KA 4MYBA 3CGXA 4D11A 1VPAA 1JYLA 1VICA 1NF5B 1H7EA 2VSIA 4CJCA 1ZCUA 1S4PA 4Y7GA 1XZ6A 5HS2A 2A8UA 1R7UA 5FUHA 3SXBA 3CKOA 4NAKA 1VZUA 3K8EA 5D91A 2VFZA 1HJLA 5C36A 4EE3A 3V90A 4D0ZA 3I0EA 1GQCA 3CKJA 3D5NA 3N9WA 1G95A 2W0WA 1NMMB 2XMHA 1G1LA 1H5SD 1R7TA 4HCQA 1H3MA 5JQQA 1VM8A 1Z90A 2AGDA 1EZIA 4KT7A 1H7LA 3T7MA 1KWSA 3I0IX 2FYAA 1GWVA 1WT1A 1LVWA 3OH3A 5C1LA 5AJNA 1HJJA 5BXCA 1ON8A 3IOHA 4EE4A 4KPXA 1HM8A 1LL0A 3FWWA 3F1YA 2YC5A 2I5EA 3SX3A 4NALA 1HM9A 1H5TB 1WT2A 1INJA 4HO5A 3TZTA 1TZFA 3Q80A 2O1FA 2ZU8A 5C48A 5CMJA 3V0OA 3I0HA 1QGSA 4C2SA 2ICYA 3U0YA 5EIYA 5I1FA 1YP4A 1FGXA 2I5KA 3I0KA 4FRHA 5IDTA 3DJ4A 2J0BA 1S4NA 2RJ1A 4ARWA 3V8YA 4KNRA 2VSHA 1G97A 1YP2A 1JVGA 2X5SA
chains in the Genus database with same CATH topology
1H5SC 5C4EA 1ZI1A 2AESA 3D8VA 2X60A 2P72A 2WAWA 3RMWA 4B3UA 4FRBA 4FROA 2MZBA 4B4MA 3QVBA 4DDZA 3ZGFA 5C4DA 1H7HA 1O7QA 1VGTA 4O6MA 1G9RA 2OEGA 5CMFX 4E1KA 1ZJ1A 2Y4LA 3CKVA 4BQHA 2RITA 2VS3A 4B4BA 4EEOA 2Y4MA 3OH4A 4B42A 4O6NA 3ZF8A 2RIZA 1WT3A 2OI6A 1IIMA 2P73A 4CJ8A 1HV9A 2VS5A 3IOJA 4Y63A 2FYDB 5C38A 1ZCYA 1ZHJA 2JCOA 1E5KA 3F1CA 5C3AA 4FCEA 2V0HA 1I52A 2WVMA 2E8BA 1H4DA 3HL3A 4LW3A 2AM5A 2RJ9A 5C4FA 4FIXA 1FGGA 1FZWA 1LZ7A 1S4OA 4M2AA 2Y6PA 1ZJOA 3SX8A 3U2XA 3E25A 1NQIB 3CU0A 4HO4A 2XWMA 5IDSA 1R82A 2BO7A 3Q7UA 4Y6UA 1ZCVA 2RJ7A 1H4CA 3PNNA 5AJOA 3EE5A 5IFYA 4KPZA 4CVHA 5CMHA 4EEGA 3I0GA 1NWGB 2Z86A 4KNXA 1GA8A 1VZXA 4Y9XA 1OMZA 1MP4A 2AM4A 2OEFA 4G87A 3DUVA 1HM0A 1G0RA 2BO6A 4IRPA 2FFUA 4Y7TA 1LZ0A 3SXDA 3R3IA 5L6SA 1V84A 1ZJPA 2YQCA 1ZJ0A 2WGZA 4HOCA 1PZYB 4G3PA 5DDTA 5C3BA 2E3DA 4D11C 1G8OA 1TW5A 3BRKX 1ON6A 2YESA 2PGVA 1W55A 1GX0A 1WVCA 4HO2A 1ZDFA 1G2VA 1FWYA 2XWNA 2ICXA 1JVDA 2WVLA 2Y4KA 3FOQA 2QGIA 2P6WA 2VK9A 5CQLX 3JUJA 2D7IA 5D92A 5FTVA 3D98A 5FYEA 4Y6NA 1JYKA 4AAWA 2ZU7A 1WT0A 3CKQA 3PKPA 2WEEA 2RJ4A 1H7FA 4JD0A 2PGYA 1V82A 1ZDGA 1LZJA 4FREA 3V0LA 2AH9A 2BO4A 3U2TA 5L6VA 2Q4JA 1IINA 3JTJA 4G3QA 1H7GA 1H7QA 2GGQA 2X5ZA 4FCUA 4R7PA 3OC9A 4EEAA 2J0AA 2VXLA 1LL3A 4IRQA 4MNDA 2APCA 1LL2A 2RIXA 4KC1A 4DE7A 4UEGA 2YCMA 3I0CA 3I0JA 1TVYA 2Y4JA 3Q4SA 2C0NA 2PX7A 4D48A 2FYCB 1MP3A 4M28A 4P00A 3V0NA 2O1GA 4FRPA 2V0JA 4FIYA 4B2XA 1YP3A 4FQWA 2ZU9A 1W77A 1ZIZA 4HO9A 1FXOA 1G93A 2FFVA 3OGZA 5C1HA 1K4VA 5CQPA 3RSBA 1TW1A 1SS9A 1JV1A 3OAMA 1G3LA 2WVKA 3LW6A 1YROB 3SXGA 5C8RA 4AC3A 5EJZA 4AYJA 2AM3A 2VS4A 3V0MA 4ZDQA 2RJ5A 4Y7FA 1LZIA 1VZTA 5CQMX 1R80A 2PA4A 3NGWA 1GQ9A 1R7VA 4D0TA 5C49A 2XWLA 3U0XA 2BO8A 3ZGGA 3U2UA 4NAIA 2CU2A 2FYBA 4KRVA 3KIAA 3TQDA 3JUKA 4G3SA 2NXVA 2RJ6A 2JCJA 1H5RA 3V91A 3V0QA 3USRA 2D7RA 2Z87A 1FG5N 3DK5A 5C3DA 1H4EA 4B2WA 3SPTA 1ZJ2A 4ASJA 4FRQA 1O7OA 1ZJ3A 2XMEA 3E26A 1ZI4A 1PZTA 3O3PA 4DECA 3RMVA 1ZI3A 4B5BA 2QH5A 1OMXA 2GGOA 3U2WA 2V0LA 2VXMA 2X65A 2YC3A 4Q7CA 4CJBA 2A8WA 1INIA 3ST8A 1FRWA 5CMGX 1MC3A 4BMAA 1W57A 4XWIA 1NHEB 1H5SA 3SX7A 5DDVA 2AECA 1VGZA 2W0VA 4HO0A 3GUEA 2UX8A 3SX5A 1VGUA 4EEMA 3ZLKA 4Y7UA 4Y7VA 5FU8A 4J18A 4YS8A 5FU0A 2D0JA 4ASYA 1GWWA 2OI5A 5CMIA 1FO8A 1QWJA 4JISA 5J49A 2FY7A 4EVWA 1GX4A 2I7BA 3OH2A 4HO8A 1FOAA 4HG6A 1H7TA 4P02A 1FR8A 3V0PA 4ECMA 2OI7A 1G23A 2DPWA 1H5RB 1OQMB 3CKNA 2WE9A 3I0FA 5CQNX 1V83A 3IOIA 1O23B 4FRAA 2RJ0A 1ZI5A 3OKRA 2AE7A 5C4CA 2RJ8A 1WSZA 4FRLA 2YQSA 5CQOA 2YQHA 3ZLLA 1EYRA 1FO9A 2JCLA 5C4BA 3SXCA 2V0IA 4HO6A 3I0DA 1XHBA 3POLA 3SXAA 1FXJA 1VGWA 4KC4A 4FRDA 4AYLA 2RIYA 4GBPA 3T7NA 1ZCTA 1JV3A 3K8DA 5EJ1A 2Y7AA 1VH3A 1R7XA 1O0RA 3V8ZA 1QGQA 1MP5A 5FTSA 4MIXA 5FV9A 4NANA 1VH1A 1QG8A 4B4GA 2QKXA 4LW6A 3T7OA 1H5SB 3PKQA 1H5TA 5C47A 3USQA 5AJPA 4HO3A 4Y64A 1R7YA 4KC2A 1NKHB 3OH0A 5C1GA 4M2BA 3R2WA 1R81A 4M4KA 2YQJA 3SXEA 4EE5A 1FR9A 2VD4A 3OH1A 4L41C 3BCVA 4FRMA 4KQLA 4Y62A 3I0LA 4K6RA 2JCKA 3U2VA 4KXOA 2O1HA 2V0KA 4MYBA 3CGXA 4D11A 1VPAA 1JYLA 1VICA 1NF5B 1H7EA 2VSIA 4CJCA 1ZCUA 1S4PA 4Y7GA 1XZ6A 5HS2A 2A8UA 1R7UA 5FUHA 3SXBA 3CKOA 4NAKA 1VZUA 3K8EA 5D91A 2VFZA 1HJLA 5C36A 4EE3A 3V90A 4D0ZA 3I0EA 1GQCA 3CKJA 3D5NA 3N9WA 1G95A 2W0WA 1NMMB 2XMHA 1G1LA 1H5SD 1R7TA 4HCQA 1H3MA 5JQQA 1VM8A 1Z90A 2AGDA 1EZIA 4KT7A 1H7LA 3T7MA 1KWSA 3I0IX 2FYAA 1GWVA 1WT1A 1LVWA 3OH3A 5C1LA 5AJNA 1HJJA 5BXCA 1ON8A 3IOHA 4EE4A 4KPXA 1HM8A 1LL0A 3FWWA 3F1YA 2YC5A 2I5EA 3SX3A 4NALA 1HM9A 1H5TB 1WT2A 1INJA 4HO5A 3TZTA 1TZFA 3Q80A 2O1FA 2ZU8A 5C48A 5CMJA 3V0OA 3I0HA 1QGSA 4C2SA 2ICYA 3U0YA 5EIYA 5I1FA 1YP4A 1FGXA 2I5KA 3I0KA 4FRHA 5IDTA 3DJ4A 2J0BA 1S4NA 2RJ1A 4ARWA 3V8YA 4KNRA 2VSHA 1G97A 1YP2A 1JVGA 2X5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H5S C;  5C4E A;  1ZI1 A;  2AES A;  3D8V A;  2X60 A;  2P72 A;  2WAW A;  3RMW A;  4B3U A;  4FRB A;  4FRO A;  2MZB A;  4B4M A;  3QVB A;  4DDZ A;  3ZGF A;  5C4D A;  1H7H A;  1O7Q A;  1VGT A;  1G9R A;  2OEG A;  5CMF X;  4E1K A;  1ZJ1 A;  2Y4L A;  3CKV A;  4BQH A;  2RIT A;  2VS3 A;  4B4B A;  4EEO A;  2Y4M A;  3OH4 A;  4B42 A;  3ZF8 A;  2RIZ A;  1WT3 A;  2OI6 A;  1IIM A;  2P73 A;  4CJ8 A;  1HV9 A;  2VS5 A;  3IOJ A;  4Y63 A;  2FYD B;  5C38 A;  1ZCY A;  1ZHJ A;  2JCO A;  1E5K A;  3F1C A;  5C3A A;  4FCE A;  2V0H A;  1I52 A;  2WVM A;  2E8B A;  1H4D A;  3HL3 A;  4LW3 A;  2AM5 A;  2RJ9 A;  5C4F A;  1FGG A;  1FZW A;  1LZ7 A;  1S4O A;  4M2A A;  2Y6P A;  1ZJO A;  3SX8 A;  3U2X A;  3E25 A;  1NQI B;  3CU0 A;  4HO4 A;  2XWM A;  5IDS A;  1R82 A;  2BO7 A;  3Q7U A;  4Y6U A;  1ZCV A;  2RJ7 A;  1H4C A;  3PNN A;  5AJO A;  3EE5 A;  5IFY A;  4KPZ A;  4CVH A;  5CMH A;  4EEG A;  3I0G A;  1NWG B;  2Z86 A;  4KNX A;  1GA8 A;  1VZX A;  4Y9X A;  1OMZ A;  1MP4 A;  2AM4 A;  2OEF A;  4G87 A;  3DUV A;  1HM0 A;  1G0R A;  2BO6 A;  4IRP A;  2FFU A;  4Y7T A;  1LZ0 A;  3SXD A;  3R3I A;  5L6S A;  1V84 A;  1ZJP A;  2YQC A;  1ZJ0 A;  2WGZ A;  4HOC A;  1PZY B;  4G3P A;  5DDT A;  5C3B A;  2E3D A;  4D11 C;  1G8O A;  1TW5 A;  3BRK X;  1ON6 A;  2YES A;  2PGV A;  1W55 A;  1GX0 A;  1WVC A;  4HO2 A;  1ZDF A;  1G2V A;  1FWY A;  2XWN A;  2ICX A;  1JVD A;  2WVL A;  2Y4K A;  3FOQ A;  2QGI A;  2P6W A;  5CQL X;  3JUJ A;  2D7I A;  5FTV A;  3D98 A;  5FYE A;  4Y6N A;  1JYK A;  4AAW A;  2ZU7 A;  1WT0 A;  3CKQ A;  3PKP A;  2WEE A;  2RJ4 A;  1H7F A;  4JD0 A;  2PGY A;  1V82 A;  1ZDG A;  1LZJ A;  4FRE A;  3V0L A;  2AH9 A;  2BO4 A;  3U2T A;  5L6V A;  2Q4J A;  1IIN A;  3JTJ A;  4G3Q A;  1H7G A;  1H7Q A;  2GGQ A;  2X5Z A;  4FCU A;  4R7P A;  3OC9 A;  4EEA A;  2VXL A;  1LL3 A;  4IRQ A;  4MND A;  2APC A;  1LL2 A;  2RIX A;  4KC1 A;  4DE7 A;  4UEG A;  2YCM A;  3I0C A;  3I0J A;  1TVY A;  2Y4J A;  3Q4S A;  2PX7 A;  4D48 A;  2FYC B;  1MP3 A;  4M28 A;  4P00 A;  3V0N A;  2O1G A;  4FRP A;  2V0J A;  4B2X A;  1YP3 A;  4FQW A;  2ZU9 A;  1W77 A;  1ZIZ A;  4HO9 A;  1FXO A;  1G93 A;  2FFV A;  3OGZ A;  5C1H A;  1K4V A;  5CQP A;  3RSB A;  1TW1 A;  1SS9 A;  1JV1 A;  3OAM A;  1G3L A;  2WVK A;  3LW6 A;  1YRO B;  3SXG A;  5C8R A;  4AC3 A;  5EJZ A;  4AYJ A;  2AM3 A;  2VS4 A;  3V0M A;  4ZDQ A;  2RJ5 A;  4Y7F A;  1LZI A;  1VZT A;  5CQM X;  1R80 A;  2PA4 A;  3NGW A;  1GQ9 A;  1R7V A;  4D0T A;  5C49 A;  2XWL A;  3U0X A;  2BO8 A;  3ZGG A;  3U2U A;  4NAI A;  2CU2 A;  2FYB A;  4KRV A;  3KIA A;  3TQD A;  3JUK A;  4G3S A;  2NXV A;  2RJ6 A;  2JCJ A;  1H5R A;  3V91 A;  3V0Q A;  3USR A;  2D7R A;  2Z87 A;  1FG5 N;  3DK5 A;  5C3D A;  1H4E A;  4B2W A;  3SPT A;  1ZJ2 A;  4ASJ A;  4FRQ A;  1O7O A;  1ZJ3 A;  2XME A;  3E26 A;  1ZI4 A;  1PZT A;  3O3P A;  4DEC A;  3RMV A;  1ZI3 A;  4B5B A;  2QH5 A;  1OMX A;  2GGO A;  3U2W A;  2V0L A;  2VXM A;  2X65 A;  2YC3 A;  4CJB A;  2A8W A;  1INI A;  3ST8 A;  1FRW A;  5CMG X;  1MC3 A;  4BMA A;  1W57 A;  4XWI A;  1NHE B;  1H5S A;  3SX7 A;  5DDV A;  2AEC A;  1VGZ A;  2W0V A;  4HO0 A;  3GUE A;  2UX8 A;  3SX5 A;  1VGU A;  4EEM A;  3ZLK A;  4Y7U A;  4Y7V A;  5FU8 A;  4J18 A;  4YS8 A;  5FU0 A;  2D0J A;  4ASY A;  1GWW A;  2OI5 A;  5CMI A;  1FO8 A;  1QWJ A;  4JIS A;  5J49 A;  2FY7 A;  4EVW A;  1GX4 A;  2I7B A;  3OH2 A;  4HO8 A;  1FOA A;  4HG6 A;  1H7T A;  4P02 A;  1FR8 A;  3V0P A;  4ECM A;  2OI7 A;  1G23 A;  2DPW A;  1H5R B;  1OQM B;  3CKN A;  2WE9 A;  3I0F A;  5CQN X;  1V83 A;  3IOI A;  1O23 B;  4FRA A;  2RJ0 A;  1ZI5 A;  3OKR A;  2AE7 A;  5C4C A;  2RJ8 A;  1WSZ A;  4FRL A;  2YQS A;  5CQO A;  2YQH A;  3ZLL A;  1EYR A;  1FO9 A;  2JCL A;  5C4B A;  3SXC A;  2V0I A;  4HO6 A;  3I0D A;  1XHB A;  3POL A;  3SXA A;  1FXJ A;  1VGW A;  4KC4 A;  4FRD A;  4AYL A;  2RIY A;  4GBP A;  3T7N A;  1ZCT A;  1JV3 A;  3K8D A;  5EJ1 A;  2Y7A A;  1VH3 A;  1R7X A;  1O0R A;  3V8Z A;  1QGQ A;  1MP5 A;  5FTS A;  5FV9 A;  4NAN A;  1VH1 A;  1QG8 A;  4B4G A;  2QKX A;  4LW6 A;  3T7O A;  1H5S B;  3PKQ A;  1H5T A;  5C47 A;  3USQ A;  5AJP A;  4HO3 A;  4Y64 A;  1R7Y A;  4KC2 A;  1NKH B;  3OH0 A;  5C1G A;  4M2B A;  3R2W A;  1R81 A;  4M4K A;  2YQJ A;  3SXE A;  4EE5 A;  1FR9 A;  2VD4 A;  3OH1 A;  4L41 C;  3BCV A;  4FRM A;  4KQL A;  4Y62 A;  3I0L A;  4K6R A;  2JCK A;  3U2V A;  4KXO A;  2O1H A;  2V0K A;  4MYB A;  3CGX A;  4D11 A;  1VPA A;  1JYL A;  1VIC A;  1NF5 B;  1H7E A;  2VSI A;  4CJC A;  1ZCU A;  1S4P A;  4Y7G A;  1XZ6 A;  5HS2 A;  2A8U A;  1R7U A;  5FUH A;  3SXB A;  3CKO A;  4NAK A;  1VZU A;  3K8E A;  2VFZ A;  1HJL A;  5C36 A;  4EE3 A;  3V90 A;  4D0Z A;  3I0E A;  1GQC A;  3CKJ A;  3D5N A;  3N9W A;  1G95 A;  2W0W A;  1NMM B;  2XMH A;  1G1L A;  1H5S D;  1R7T A;  4HCQ A;  1H3M A;  5JQQ A;  1VM8 A;  1Z90 A;  2AGD A;  1EZI A;  4KT7 A;  1H7L A;  3T7M A;  1KWS A;  3I0I X;  2FYA A;  1GWV A;  1WT1 A;  1LVW A;  3OH3 A;  5C1L A;  5AJN A;  1HJJ A;  5BXC A;  1ON8 A;  3IOH A;  4EE4 A;  4KPX A;  1HM8 A;  1LL0 A;  3FWW A;  3F1Y A;  2YC5 A;  2I5E A;  3SX3 A;  4NAL A;  1HM9 A;  1H5T B;  1WT2 A;  1INJ A;  4HO5 A;  3TZT A;  1TZF A;  3Q80 A;  2O1F A;  2ZU8 A;  5C48 A;  5CMJ A;  3V0O A;  3I0H A;  1QGS A;  4C2S A;  2ICY A;  3U0Y A;  5EIY A;  5I1F A;  1YP4 A;  1FGX A;  2I5K A;  3I0K A;  4FRH A;  5IDT A;  3DJ4 A;  1S4N A;  2RJ1 A;  4ARW A;  3V8Y A;  4KNR A;  2VSH A;  1G97 A;  1YP2 A;  1JVG A;  2X5S A; 
#chains in the Genus database with same CATH topology
 1H5S C;  5C4E A;  1ZI1 A;  2AES A;  3D8V A;  2X60 A;  2P72 A;  2WAW A;  3RMW A;  4B3U A;  4FRB A;  4FRO A;  2MZB A;  4B4M A;  3QVB A;  4DDZ A;  3ZGF A;  5C4D A;  1H7H A;  1O7Q A;  1VGT A;  4O6M A;  1G9R A;  2OEG A;  5CMF X;  4E1K A;  1ZJ1 A;  2Y4L A;  3CKV A;  4BQH A;  2RIT A;  2VS3 A;  4B4B A;  4EEO A;  2Y4M A;  3OH4 A;  4B42 A;  4O6N A;  3ZF8 A;  2RIZ A;  1WT3 A;  2OI6 A;  1IIM A;  2P73 A;  4CJ8 A;  1HV9 A;  2VS5 A;  3IOJ A;  4Y63 A;  2FYD B;  5C38 A;  1ZCY A;  1ZHJ A;  2JCO A;  1E5K A;  3F1C A;  5C3A A;  4FCE A;  2V0H A;  1I52 A;  2WVM A;  2E8B A;  1H4D A;  3HL3 A;  4LW3 A;  2AM5 A;  2RJ9 A;  5C4F A;  4FIX A;  1FGG A;  1FZW A;  1LZ7 A;  1S4O A;  4M2A A;  2Y6P A;  1ZJO A;  3SX8 A;  3U2X A;  3E25 A;  1NQI B;  3CU0 A;  4HO4 A;  2XWM A;  5IDS A;  1R82 A;  2BO7 A;  3Q7U A;  4Y6U A;  1ZCV A;  2RJ7 A;  1H4C A;  3PNN A;  5AJO A;  3EE5 A;  5IFY A;  4KPZ A;  4CVH A;  5CMH A;  4EEG A;  3I0G A;  1NWG B;  2Z86 A;  4KNX A;  1GA8 A;  1VZX A;  4Y9X A;  1OMZ A;  1MP4 A;  2AM4 A;  2OEF A;  4G87 A;  3DUV A;  1HM0 A;  1G0R A;  2BO6 A;  4IRP A;  2FFU A;  4Y7T A;  1LZ0 A;  3SXD A;  3R3I A;  5L6S A;  1V84 A;  1ZJP A;  2YQC A;  1ZJ0 A;  2WGZ A;  4HOC A;  1PZY B;  4G3P A;  5DDT A;  5C3B A;  2E3D A;  4D11 C;  1G8O A;  1TW5 A;  3BRK X;  1ON6 A;  2YES A;  2PGV A;  1W55 A;  1GX0 A;  1WVC A;  4HO2 A;  1ZDF A;  1G2V A;  1FWY A;  2XWN A;  2ICX A;  1JVD A;  2WVL A;  2Y4K A;  3FOQ A;  2QGI A;  2P6W A;  2VK9 A;  5CQL X;  3JUJ A;  2D7I A;  5D92 A;  5FTV A;  3D98 A;  5FYE A;  4Y6N A;  1JYK A;  4AAW A;  2ZU7 A;  1WT0 A;  3CKQ A;  3PKP A;  2WEE A;  2RJ4 A;  1H7F A;  4JD0 A;  2PGY A;  1V82 A;  1ZDG A;  1LZJ A;  4FRE A;  3V0L A;  2AH9 A;  2BO4 A;  3U2T A;  5L6V A;  2Q4J A;  1IIN A;  3JTJ A;  4G3Q A;  1H7G A;  1H7Q A;  2GGQ A;  2X5Z A;  4FCU A;  4R7P A;  3OC9 A;  4EEA A;  2J0A A;  2VXL A;  1LL3 A;  4IRQ A;  4MND A;  2APC A;  1LL2 A;  2RIX A;  4KC1 A;  4DE7 A;  4UEG A;  2YCM A;  3I0C A;  3I0J A;  1TVY A;  2Y4J A;  3Q4S A;  2C0N A;  2PX7 A;  4D48 A;  2FYC B;  1MP3 A;  4M28 A;  4P00 A;  3V0N A;  2O1G A;  4FRP A;  2V0J A;  4FIY A;  4B2X A;  1YP3 A;  4FQW A;  2ZU9 A;  1W77 A;  1ZIZ A;  4HO9 A;  1FXO A;  1G93 A;  2FFV A;  3OGZ A;  5C1H A;  1K4V A;  5CQP A;  3RSB A;  1TW1 A;  1SS9 A;  1JV1 A;  3OAM A;  1G3L A;  2WVK A;  3LW6 A;  1YRO B;  3SXG A;  5C8R A;  4AC3 A;  5EJZ A;  4AYJ A;  2AM3 A;  2VS4 A;  3V0M A;  4ZDQ A;  2RJ5 A;  4Y7F A;  1LZI A;  1VZT A;  5CQM X;  1R80 A;  2PA4 A;  3NGW A;  1GQ9 A;  1R7V A;  4D0T A;  5C49 A;  2XWL A;  3U0X A;  2BO8 A;  3ZGG A;  3U2U A;  4NAI A;  2CU2 A;  2FYB A;  4KRV A;  3KIA A;  3TQD A;  3JUK A;  4G3S A;  2NXV A;  2RJ6 A;  2JCJ A;  1H5R A;  3V91 A;  3V0Q A;  3USR A;  2D7R A;  2Z87 A;  1FG5 N;  3DK5 A;  5C3D A;  1H4E A;  4B2W A;  3SPT A;  1ZJ2 A;  4ASJ A;  4FRQ A;  1O7O A;  1ZJ3 A;  2XME A;  3E26 A;  1ZI4 A;  1PZT A;  3O3P A;  4DEC A;  3RMV A;  1ZI3 A;  4B5B A;  2QH5 A;  1OMX A;  2GGO A;  3U2W A;  2V0L A;  2VXM A;  2X65 A;  2YC3 A;  4Q7C A;  4CJB A;  2A8W A;  1INI A;  3ST8 A;  1FRW A;  5CMG X;  1MC3 A;  4BMA A;  1W57 A;  4XWI A;  1NHE B;  1H5S A;  3SX7 A;  5DDV A;  2AEC A;  1VGZ A;  2W0V A;  4HO0 A;  3GUE A;  2UX8 A;  3SX5 A;  1VGU A;  4EEM A;  3ZLK A;  4Y7U A;  4Y7V A;  5FU8 A;  4J18 A;  4YS8 A;  5FU0 A;  2D0J A;  4ASY A;  1GWW A;  2OI5 A;  5CMI A;  1FO8 A;  1QWJ A;  4JIS A;  5J49 A;  2FY7 A;  4EVW A;  1GX4 A;  2I7B A;  3OH2 A;  4HO8 A;  1FOA A;  4HG6 A;  1H7T A;  4P02 A;  1FR8 A;  3V0P A;  4ECM A;  2OI7 A;  1G23 A;  2DPW A;  1H5R B;  1OQM B;  3CKN A;  2WE9 A;  3I0F A;  5CQN X;  1V83 A;  3IOI A;  1O23 B;  4FRA A;  2RJ0 A;  1ZI5 A;  3OKR A;  2AE7 A;  5C4C A;  2RJ8 A;  1WSZ A;  4FRL A;  2YQS A;  5CQO A;  2YQH A;  3ZLL A;  1EYR A;  1FO9 A;  2JCL A;  5C4B A;  3SXC A;  2V0I A;  4HO6 A;  3I0D A;  1XHB A;  3POL A;  3SXA A;  1FXJ A;  1VGW A;  4KC4 A;  4FRD A;  4AYL A;  2RIY A;  4GBP A;  3T7N A;  1ZCT A;  1JV3 A;  3K8D A;  5EJ1 A;  2Y7A A;  1VH3 A;  1R7X A;  1O0R A;  3V8Z A;  1QGQ A;  1MP5 A;  5FTS A;  4MIX A;  5FV9 A;  4NAN A;  1VH1 A;  1QG8 A;  4B4G A;  2QKX A;  4LW6 A;  3T7O A;  1H5S B;  3PKQ A;  1H5T A;  5C47 A;  3USQ A;  5AJP A;  4HO3 A;  4Y64 A;  1R7Y A;  4KC2 A;  1NKH B;  3OH0 A;  5C1G A;  4M2B A;  3R2W A;  1R81 A;  4M4K A;  2YQJ A;  3SXE A;  4EE5 A;  1FR9 A;  2VD4 A;  3OH1 A;  4L41 C;  3BCV A;  4FRM A;  4KQL A;  4Y62 A;  3I0L A;  4K6R A;  2JCK A;  3U2V A;  4KXO A;  2O1H A;  2V0K A;  4MYB A;  3CGX A;  4D11 A;  1VPA A;  1JYL A;  1VIC A;  1NF5 B;  1H7E A;  2VSI A;  4CJC A;  1ZCU A;  1S4P A;  4Y7G A;  1XZ6 A;  5HS2 A;  2A8U A;  1R7U A;  5FUH A;  3SXB A;  3CKO A;  4NAK A;  1VZU A;  3K8E A;  5D91 A;  2VFZ A;  1HJL A;  5C36 A;  4EE3 A;  3V90 A;  4D0Z A;  3I0E A;  1GQC A;  3CKJ A;  3D5N A;  3N9W A;  1G95 A;  2W0W A;  1NMM B;  2XMH A;  1G1L A;  1H5S D;  1R7T A;  4HCQ A;  1H3M A;  5JQQ A;  1VM8 A;  1Z90 A;  2AGD A;  1EZI A;  4KT7 A;  1H7L A;  3T7M A;  1KWS A;  3I0I X;  2FYA A;  1GWV A;  1WT1 A;  1LVW A;  3OH3 A;  5C1L A;  5AJN A;  1HJJ A;  5BXC A;  1ON8 A;  3IOH A;  4EE4 A;  4KPX A;  1HM8 A;  1LL0 A;  3FWW A;  3F1Y A;  2YC5 A;  2I5E A;  3SX3 A;  4NAL A;  1HM9 A;  1H5T B;  1WT2 A;  1INJ A;  4HO5 A;  3TZT A;  1TZF A;  3Q80 A;  2O1F A;  2ZU8 A;  5C48 A;  5CMJ A;  3V0O A;  3I0H A;  1QGS A;  4C2S A;  2ICY A;  3U0Y A;  5EIY A;  5I1F A;  1YP4 A;  1FGX A;  2I5K A;  3I0K A;  4FRH A;  5IDT A;  3DJ4 A;  2J0B A;  1S4N A;  2RJ1 A;  4ARW A;  3V8Y A;  4KNR A;  2VSH A;  1G97 A;  1YP2 A;  1JVG A;  2X5S A; 
#chains in the Genus database with same CATH homology
 1H5S C;  5C4E A;  1ZI1 A;  2AES A;  3D8V A;  2X60 A;  2P72 A;  2WAW A;  3RMW A;  4B3U A;  4FRB A;  4FRO A;  2MZB A;  4B4M A;  3QVB A;  4DDZ A;  3ZGF A;  5C4D A;  1H7H A;  1O7Q A;  1VGT A;  4O6M A;  1G9R A;  2OEG A;  5CMF X;  4E1K A;  1ZJ1 A;  2Y4L A;  3CKV A;  4BQH A;  2RIT A;  2VS3 A;  4B4B A;  4EEO A;  2Y4M A;  3OH4 A;  4B42 A;  4O6N A;  3ZF8 A;  2RIZ A;  1WT3 A;  2OI6 A;  1IIM A;  2P73 A;  4CJ8 A;  1HV9 A;  2VS5 A;  3IOJ A;  4Y63 A;  2FYD B;  5C38 A;  1ZCY A;  1ZHJ A;  2JCO A;  1E5K A;  3F1C A;  5C3A A;  4FCE A;  2V0H A;  1I52 A;  2WVM A;  2E8B A;  1H4D A;  3HL3 A;  4LW3 A;  2AM5 A;  2RJ9 A;  5C4F A;  4FIX A;  1FGG A;  1FZW A;  1LZ7 A;  1S4O A;  4M2A A;  2Y6P A;  1ZJO A;  3SX8 A;  3U2X A;  3E25 A;  1NQI B;  3CU0 A;  4HO4 A;  2XWM A;  5IDS A;  1R82 A;  2BO7 A;  3Q7U A;  4Y6U A;  1ZCV A;  2RJ7 A;  1H4C A;  3PNN A;  5AJO A;  3EE5 A;  5IFY A;  4KPZ A;  4CVH A;  5CMH A;  4EEG A;  3I0G A;  1NWG B;  2Z86 A;  4KNX A;  1GA8 A;  1VZX A;  4Y9X A;  1OMZ A;  1MP4 A;  2AM4 A;  2OEF A;  4G87 A;  3DUV A;  1HM0 A;  1G0R A;  2BO6 A;  4IRP A;  2FFU A;  4Y7T A;  1LZ0 A;  3SXD A;  3R3I A;  5L6S A;  1V84 A;  1ZJP A;  2YQC A;  1ZJ0 A;  2WGZ A;  4HOC A;  1PZY B;  4G3P A;  5DDT A;  5C3B A;  2E3D A;  4D11 C;  1G8O A;  1TW5 A;  3BRK X;  1ON6 A;  2YES A;  2PGV A;  1W55 A;  1GX0 A;  1WVC A;  4HO2 A;  1ZDF A;  1G2V A;  1FWY A;  2XWN A;  2ICX A;  1JVD A;  2WVL A;  2Y4K A;  3FOQ A;  2QGI A;  2P6W A;  2VK9 A;  5CQL X;  3JUJ A;  2D7I A;  5D92 A;  5FTV A;  3D98 A;  5FYE A;  4Y6N A;  1JYK A;  4AAW A;  2ZU7 A;  1WT0 A;  3CKQ A;  3PKP A;  2WEE A;  2RJ4 A;  1H7F A;  4JD0 A;  2PGY A;  1V82 A;  1ZDG A;  1LZJ A;  4FRE A;  3V0L A;  2AH9 A;  2BO4 A;  3U2T A;  5L6V A;  2Q4J A;  1IIN A;  3JTJ A;  4G3Q A;  1H7G A;  1H7Q A;  2GGQ A;  2X5Z A;  4FCU A;  4R7P A;  3OC9 A;  4EEA A;  2J0A A;  2VXL A;  1LL3 A;  4IRQ A;  4MND A;  2APC A;  1LL2 A;  2RIX A;  4KC1 A;  4DE7 A;  4UEG A;  2YCM A;  3I0C A;  3I0J A;  1TVY A;  2Y4J A;  3Q4S A;  2C0N A;  2PX7 A;  4D48 A;  2FYC B;  1MP3 A;  4M28 A;  4P00 A;  3V0N A;  2O1G A;  4FRP A;  2V0J A;  4FIY A;  4B2X A;  1YP3 A;  4FQW A;  2ZU9 A;  1W77 A;  1ZIZ A;  4HO9 A;  1FXO A;  1G93 A;  2FFV A;  3OGZ A;  5C1H A;  1K4V A;  5CQP A;  3RSB A;  1TW1 A;  1SS9 A;  1JV1 A;  3OAM A;  1G3L A;  2WVK A;  3LW6 A;  1YRO B;  3SXG A;  5C8R A;  4AC3 A;  5EJZ A;  4AYJ A;  2AM3 A;  2VS4 A;  3V0M A;  4ZDQ A;  2RJ5 A;  4Y7F A;  1LZI A;  1VZT A;  5CQM X;  1R80 A;  2PA4 A;  3NGW A;  1GQ9 A;  1R7V A;  4D0T A;  5C49 A;  2XWL A;  3U0X A;  2BO8 A;  3ZGG A;  3U2U A;  4NAI A;  2CU2 A;  2FYB A;  4KRV A;  3KIA A;  3TQD A;  3JUK A;  4G3S A;  2NXV A;  2RJ6 A;  2JCJ A;  1H5R A;  3V91 A;  3V0Q A;  3USR A;  2D7R A;  2Z87 A;  1FG5 N;  3DK5 A;  5C3D A;  1H4E A;  4B2W A;  3SPT A;  1ZJ2 A;  4ASJ A;  4FRQ A;  1O7O A;  1ZJ3 A;  2XME A;  3E26 A;  1ZI4 A;  1PZT A;  3O3P A;  4DEC A;  3RMV A;  1ZI3 A;  4B5B A;  2QH5 A;  1OMX A;  2GGO A;  3U2W A;  2V0L A;  2VXM A;  2X65 A;  2YC3 A;  4Q7C A;  4CJB A;  2A8W A;  1INI A;  3ST8 A;  1FRW A;  5CMG X;  1MC3 A;  4BMA A;  1W57 A;  4XWI A;  1NHE B;  1H5S A;  3SX7 A;  5DDV A;  2AEC A;  1VGZ A;  2W0V A;  4HO0 A;  3GUE A;  2UX8 A;  3SX5 A;  1VGU A;  4EEM A;  3ZLK A;  4Y7U A;  4Y7V A;  5FU8 A;  4J18 A;  4YS8 A;  5FU0 A;  2D0J A;  4ASY A;  1GWW A;  2OI5 A;  5CMI A;  1FO8 A;  1QWJ A;  4JIS A;  5J49 A;  2FY7 A;  4EVW A;  1GX4 A;  2I7B A;  3OH2 A;  4HO8 A;  1FOA A;  4HG6 A;  1H7T A;  4P02 A;  1FR8 A;  3V0P A;  4ECM A;  2OI7 A;  1G23 A;  2DPW A;  1H5R B;  1OQM B;  3CKN A;  2WE9 A;  3I0F A;  5CQN X;  1V83 A;  3IOI A;  1O23 B;  4FRA A;  2RJ0 A;  1ZI5 A;  3OKR A;  2AE7 A;  5C4C A;  2RJ8 A;  1WSZ A;  4FRL A;  2YQS A;  5CQO A;  2YQH A;  3ZLL A;  1EYR A;  1FO9 A;  2JCL A;  5C4B A;  3SXC A;  2V0I A;  4HO6 A;  3I0D A;  1XHB A;  3POL A;  3SXA A;  1FXJ A;  1VGW A;  4KC4 A;  4FRD A;  4AYL A;  2RIY A;  4GBP A;  3T7N A;  1ZCT A;  1JV3 A;  3K8D A;  5EJ1 A;  2Y7A A;  1VH3 A;  1R7X A;  1O0R A;  3V8Z A;  1QGQ A;  1MP5 A;  5FTS A;  4MIX A;  5FV9 A;  4NAN A;  1VH1 A;  1QG8 A;  4B4G A;  2QKX A;  4LW6 A;  3T7O A;  1H5S B;  3PKQ A;  1H5T A;  5C47 A;  3USQ A;  5AJP A;  4HO3 A;  4Y64 A;  1R7Y A;  4KC2 A;  1NKH B;  3OH0 A;  5C1G A;  4M2B A;  3R2W A;  1R81 A;  4M4K A;  2YQJ A;  3SXE A;  4EE5 A;  1FR9 A;  2VD4 A;  3OH1 A;  4L41 C;  3BCV A;  4FRM A;  4KQL A;  4Y62 A;  3I0L A;  4K6R A;  2JCK A;  3U2V A;  4KXO A;  2O1H A;  2V0K A;  4MYB A;  3CGX A;  4D11 A;  1VPA A;  1JYL A;  1VIC A;  1NF5 B;  1H7E A;  2VSI A;  4CJC A;  1ZCU A;  1S4P A;  4Y7G A;  1XZ6 A;  5HS2 A;  2A8U A;  1R7U A;  5FUH A;  3SXB A;  3CKO A;  4NAK A;  1VZU A;  3K8E A;  5D91 A;  2VFZ A;  1HJL A;  5C36 A;  4EE3 A;  3V90 A;  4D0Z A;  3I0E A;  1GQC A;  3CKJ A;  3D5N A;  3N9W A;  1G95 A;  2W0W A;  1NMM B;  2XMH A;  1G1L A;  1H5S D;  1R7T A;  4HCQ A;  1H3M A;  5JQQ A;  1VM8 A;  1Z90 A;  2AGD A;  1EZI A;  4KT7 A;  1H7L A;  3T7M A;  1KWS A;  3I0I X;  2FYA A;  1GWV A;  1WT1 A;  1LVW A;  3OH3 A;  5C1L A;  5AJN A;  1HJJ A;  5BXC A;  1ON8 A;  3IOH A;  4EE4 A;  4KPX A;  1HM8 A;  1LL0 A;  3FWW A;  3F1Y A;  2YC5 A;  2I5E A;  3SX3 A;  4NAL A;  1HM9 A;  1H5T B;  1WT2 A;  1INJ A;  4HO5 A;  3TZT A;  1TZF A;  3Q80 A;  2O1F A;  2ZU8 A;  5C48 A;  5CMJ A;  3V0O A;  3I0H A;  1QGS A;  4C2S A;  2ICY A;  3U0Y A;  5EIY A;  5I1F A;  1YP4 A;  1FGX A;  2I5K A;  3I0K A;  4FRH A;  5IDT A;  3DJ4 A;  2J0B A;  1S4N A;  2RJ1 A;  4ARW A;  3V8Y A;  4KNR A;  2VSH A;  1G97 A;  1YP2 A;  1JVG A;  2X5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...