1QGSA

Udp-magnesium complex of spsa from bacillus subtilis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
255
structure length
238
Chain Sequence
PKVSVIMTSYNKSDYVAKSISSILSQTFSDFELFIMDDNSNEETLNVIRPFLNDNRVRFYQSDISGVKERTEKTRYAALINQAIEMAEGEYITYATDDNIYMPDRLLKMVRELDTHPEKAVIYSASKTYHLNDIVKETVRPAAQVTWNAPCAIDHCSVMHRYSVLEKVKEKFGSYWDESPAFYRIGDARFFWRVNHFYPFYPLDEELDLNYITEFVRNLPPQRNCRELRESLKKLGMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTEIN (SPORE COAT POLYSACCHARIDE BIOSYNTHESIS PROTEIN SPSA
publication title Structure of the nucleotide-diphospho-sugar transferase, SpsA from Bacillus subtilis, in native and nucleotide-complexed forms.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 89
structure length 238
sequence length 255
ec nomenclature
pdb deposition date 1999-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1qgsA00
4EEOA 4HG6A 2V0IA 4B2XA 1YP2A 2WE9A 3R2WA 2YQHA 2APCA 4B42A 3V0PA 4DE7A 1LZ7A 1LZIA 3V0MA 3EE5A 4Y6NA 3PKPA 1NKHB 3IOJA 1G2VA 5EJZA 5C3BA 4R7PA 1ON8A 3I0LA 4E1KA 1VH3A 3ST8A 4K6RA 2O1FA 5C49A 3SXDA 2P72A 4HCQA 1HJJA 1R7XA 2FFUA 2P6WA 1GWWA 1HM8A 1TW5A 5C3DA 1TVYA 2ICXA 2W0WA 5FYEA 3ZGGA 2YQCA 1V84A 1VZTA 3U2VA 5I1FA 5CMJA 2RJ0A 4D0ZA 2RIZA 5IFYA 1INIA 4CJCA 1WT0A 3OKRA 4P02A 3SX8A 5AJPA 1H7TA 4LW3A 4XWIA 1WT1A 3OH3A 3U0XA 5C4CA 1FR8A 1YROB 4HO3A 1R81A 3T7OA 1H7GA 2FFVA 1R82A 1MP5A 2E3DA 1ZJPA 4CJ8A 1W77A 5IDTA 3CGXA 1S4PA 4FREA 5C1GA 2RJ4A 2FYAA 5EJ1A 1NMMB 1G9RA 2BO8A 1ZIZA 2AM5A 4M2AA 1QWJA 1IIMA 1H4DA 1VGZA 3I0FA 4IRQA 2I5KA 4ASYA 2V0LA 1VGUA 2Y4LA 1G23A 4HO2A 4BQHA 4DECA 3TZTA 2YQSA 1ZDFA 4DDZA 3N9WA 1G1LA 1S4NA 1G93A 1FOAA 4L41C 3E26A 4FRQA 4B5BA 4D48A 2WAWA 2Z86A 5FTSA 3BCVA 2JCJA 2OI6A 2BO4A 4Y7FA 1XZ6A 2Y6PA 4Y62A 1ZDGA 2D7RA 4EE3A 1IINA 1JVGA 3T7MA 2X5ZA 3FWWA 2BO6A 2VXLA 1V83A 5EIYA 5DDTA 2VSIA 1FO9A 1FZWA 2RJ8A 1MP3A 3HL3A 3OAMA 4AC3A 4HOCA 1FR9A 2XWLA 3JUKA 3IOHA 2PGVA 3RMVA 5FUHA 4M2BA 1FO8A 5CMHA 2BO7A 3SXEA 4JD0A 4NALA 3Q80A 4EVWA 1QGSA 1EYRA 5AJNA 3SX3A 1O7QA 1FGXA 3RMWA 4Y9XA 1MC3A 3U2UA 1VGTA 2RJ7A 3I0GA 3OH1A 4FRDA 4NANA 4EE5A 4Y7UA 1GX0A 4KNRA 3CKQA 3KIAA 3ZLLA 2PGYA 3SXAA 1I52A 1LZ0A 3DUVA 3CKVA 5FV9A 3K8DA 1NHEB 1E5KA 2YCMA 1HM0A 1Z90A 1HV9A 2FYDB 1YP4A 2RJ9A 1OMZA 3DK5A 1ZJ3A 4CJBA 4MYBA 1LVWA 1GX4A 5C4DA 3CKNA 4P00A 5CMGX 5JQQA 3SPTA 1ON6A 3O3PA 1JVDA 2V0JA 2XMHA 1ZI4A 2D0JA 1R80A 3OH4A 4JISA 4AAWA 1H7HA 3OC9A 1TZFA 1H7QA 3I0JA 4Y7GA 1H5TA 4G3PA 4EEAA 4ECMA 3CKJA 2YC3A 2OEFA 1JYKA 3USRA 1H5SA 2A8WA 2RIXA 3V0OA 5C38A 2QGIA 1WT3A 5C47A 4BMAA 1NQIB 2WEEA 2YC5A 1G3LA 4FRBA 1VZUA 2X5SA 2ZU8A 2YESA 4HO9A 2PA4A 3V90A 5CQPA 4FQWA 1VPAA 2DPWA 4HO5A 4KXOA 4B4GA 4FCUA 1FWYA 2RJ1A 3POLA 4GBPA 1HJLA 1OMXA 5FTVA 4KQLA 4B4MA 1H5SD 4D11C 1FRWA 3OH0A 4Y7TA 1QGQA 1H5SC 4M28A 3TQDA 1H5RA 1LL2A 2AESA 2RITA 1ZI5A 1FXJA 4FRLA 4ARWA 3SXGA 2RJ6A 3K8EA 4FCEA 3U0YA 1FG5N 4FRPA 3SX5A 1GQ9A 2VS4A 3V0LA 2WVLA 2Y4MA 4AYJA 2VS3A 3I0IX 4MNDA 1H5TB 1GA8A 2GGOA 1JYLA 2X65A 3PNNA 1O23B 3SX7A 1H5SB 3USQA 3JTJA 4G3SA 1VH1A 2AGDA 4KPXA 1XHBA 2AE7A 1ZCVA 1S4OA 3DJ4A 3CU0A 4HO8A 4Y63A 3SXCA 1PZTA 1LL3A 3E25A 1G8OA 5DDVA 1H4CA 2UX8A 5C4BA 1LL0A 1LZJA 1ZHJA 5C48A 3LW6A 4AYLA 1YP3A 2WVKA 5C4FA 5CMIA 2I7BA 4FRHA 5C1HA 4B4BA 2D7IA 3I0KA 2YQJA 1NF5B 2X60A 4Y7VA 3ZLKA 1H5RB 1SS9A 4UEGA 3OH2A 1JV3A 2O1HA 1MP4A 2FYBA 3FOQA 1ZI3A 4IRPA 2VFZA 2WGZA 4EEMA 1ZI1A 1ZCUA 5AJOA 2JCOA 2E8BA 3I0CA 2JCKA 2V0KA 3JUJA 1ZJOA 1H4EA 4KNXA 5C1LA 4B3UA 4B2WA 2O1GA 4FRAA 3Q7UA 3F1CA 3T7NA 5L6VA 3V0QA 2ICYA 3SXBA 1WT2A 1ZJ2A 4ASJA 2NXVA 3D98A 4J18A 3V8YA 5J49A 1VM8A 2VSHA 4M4KA 3V8ZA 2PX7A 2W0VA 4FRMA 5C4EA 2CU2A 3I0HA 2JCLA 4EEGA 4NAKA 1VGWA 2OI7A 4YS8A 3ZGFA 3U2XA 1G0RA 5CQMX 2V0HA 2Q4JA 1OQMB 2Y7AA 4EE4A 2FYCB 1O7OA 4D11A 1WSZA 5BXCA 2GGQA 1R7VA 4KT7A 4KPZA 4HO0A 1V82A 2QKXA 1PZYB 3I0DA 1H7EA 4HO4A 2RIYA 1TW1A 1KWSA 3F1YA 2ZU9A 3D5NA 3BRKX 1H7FA 1FGGA 2FY7A 4Y6UA 2OI5A 1G95A 5C36A 1JV1A 4G3QA 1QG8A 4D0TA 2AECA 2AM4A 3QVBA 5L6SA 5HS2A 3V91A 2OEGA 1H3MA 2A8UA 2Y4JA 3GUEA 5FU0A 2I5EA 2WVMA 4Y64A 1GQCA 2VXMA 2ZU7A 3U2WA 1FXOA 3RSBA 1WVCA 3V0NA 5CMFX 4NAIA 4KRVA 1H7LA 2VD4A 1ZJ1A 1ZJ0A 4FROA 1NWGB 3NGWA 1INJA 5CQOA 3PKQA 2MZBA 2XWNA 5FU8A 1W55A 2AH9A 2AM3A 1GWVA 3D8VA 5C8RA 4CVHA 5C3AA 4KC1A 1VICA 1EZIA 3OGZA 1ZCTA 2Y4KA 1W57A 4KC4A 3U2TA 5IDSA 3Q4SA 1G97A 1HM9A 3IOIA 1O0RA 2VS5A 3CKOA 2QH5A 2Z87A 4ZDQA 1R7UA 4LW6A 2XWMA 3ZF8A 4HO6A 4C2SA 4KC2A 5CQNX 1ZCYA 2P73A 1VZXA 1K4VA 2RJ5A 1R7TA 2XMEA 1R7YA 3R3IA 5CQLX 4G87A 3I0EA
chains in the Genus database with same CATH superfamily
4EEOA 4HG6A 2V0IA 4B2XA 1YP2A 2WE9A 3R2WA 2YQHA 2APCA 4B42A 3V0PA 4DE7A 1LZ7A 1LZIA 3V0MA 3EE5A 4Y6NA 3PKPA 1NKHB 3IOJA 1G2VA 5EJZA 5C3BA 4R7PA 1ON8A 3I0LA 4E1KA 1VH3A 3ST8A 4K6RA 2O1FA 5C49A 3SXDA 2P72A 4HCQA 4O6NA 1HJJA 1R7XA 2FFUA 2P6WA 5D92A 1GWWA 1HM8A 1TW5A 5C3DA 1TVYA 2ICXA 2W0WA 5FYEA 3ZGGA 2YQCA 1V84A 1VZTA 3U2VA 5I1FA 5CMJA 2RJ0A 4D0ZA 2RIZA 5IFYA 1INIA 4CJCA 1WT0A 3OKRA 4P02A 3SX8A 5AJPA 1H7TA 4LW3A 4XWIA 1WT1A 3OH3A 3U0XA 5C4CA 1FR8A 2C0NA 1YROB 4HO3A 1R81A 3T7OA 1H7GA 2FFVA 1R82A 1MP5A 2E3DA 1ZJPA 4CJ8A 1W77A 5IDTA 3CGXA 1S4PA 4FREA 5C1GA 2RJ4A 2FYAA 5EJ1A 1NMMB 1G9RA 2BO8A 1ZIZA 2AM5A 4M2AA 1QWJA 1IIMA 1H4DA 1VGZA 3I0FA 4IRQA 2I5KA 4ASYA 2V0LA 1VGUA 2Y4LA 1G23A 4HO2A 4BQHA 4DECA 3TZTA 2YQSA 1ZDFA 4DDZA 3N9WA 1G1LA 1S4NA 1G93A 1FOAA 4L41C 3E26A 4FRQA 4B5BA 4D48A 2WAWA 2Z86A 5FTSA 3BCVA 2JCJA 2OI6A 2BO4A 4Y7FA 1XZ6A 2Y6PA 4Y62A 1ZDGA 2D7RA 4EE3A 1IINA 1JVGA 3T7MA 2X5ZA 3FWWA 2BO6A 2VXLA 1V83A 5EIYA 5DDTA 2VSIA 1FO9A 1FZWA 2RJ8A 4Q7CA 1MP3A 3HL3A 3OAMA 4AC3A 4HOCA 1FR9A 2XWLA 3JUKA 3IOHA 2PGVA 3RMVA 5FUHA 4M2BA 1FO8A 5CMHA 2BO7A 3SXEA 4JD0A 4NALA 3Q80A 4EVWA 1QGSA 1EYRA 5AJNA 3SX3A 1O7QA 1FGXA 3RMWA 4Y9XA 1MC3A 3U2UA 1VGTA 2RJ7A 2J0BA 3I0GA 3OH1A 4FRDA 4NANA 4EE5A 4Y7UA 1GX0A 4KNRA 3CKQA 3KIAA 3ZLLA 2PGYA 3SXAA 1I52A 1LZ0A 3DUVA 3CKVA 5FV9A 3K8DA 1NHEB 1E5KA 2YCMA 1HM0A 1Z90A 1HV9A 2FYDB 1YP4A 2RJ9A 1OMZA 3DK5A 1ZJ3A 4CJBA 4MYBA 1LVWA 1GX4A 5C4DA 3CKNA 4P00A 5CMGX 5JQQA 3SPTA 1ON6A 3O3PA 1JVDA 2V0JA 2XMHA 1ZI4A 2D0JA 1R80A 3OH4A 4JISA 4AAWA 1H7HA 3OC9A 1TZFA 1H7QA 3I0JA 4Y7GA 1H5TA 4G3PA 4EEAA 4ECMA 3CKJA 2YC3A 2OEFA 1JYKA 3USRA 1H5SA 2A8WA 2RIXA 3V0OA 4MIXA 2QGIA 1WT3A 5C38A 5C47A 4BMAA 1NQIB 2WEEA 2YC5A 1G3LA 4FRBA 1VZUA 2X5SA 2ZU8A 2YESA 4HO9A 2PA4A 3V90A 5CQPA 4FQWA 1VPAA 2DPWA 4HO5A 4KXOA 4B4GA 4FCUA 4FIYA 1FWYA 2RJ1A 3POLA 4GBPA 1HJLA 1OMXA 5FTVA 4KQLA 4B4MA 1H5SD 4D11C 1FRWA 3OH0A 4Y7TA 1QGQA 2J0AA 1H5SC 4M28A 3TQDA 1H5RA 1LL2A 2AESA 2RITA 1ZI5A 1FXJA 4FRLA 4ARWA 3SXGA 2RJ6A 3K8EA 4FCEA 3U0YA 1FG5N 4FRPA 3SX5A 1GQ9A 2VS4A 3V0LA 2WVLA 2Y4MA 4AYJA 2VS3A 3I0IX 4MNDA 1H5TB 1GA8A 2GGOA 1JYLA 2X65A 3PNNA 1O23B 3SX7A 1H5SB 3USQA 3JTJA 5D91A 4G3SA 1VH1A 2AGDA 4KPXA 1XHBA 2AE7A 1ZCVA 1S4OA 3DJ4A 3CU0A 4HO8A 4Y63A 3SXCA 1PZTA 1LL3A 3E25A 1G8OA 5DDVA 1H4CA 2UX8A 5C4BA 1LL0A 1LZJA 1ZHJA 5C48A 3LW6A 4AYLA 1YP3A 2WVKA 5C4FA 5CMIA 2I7BA 4FRHA 5C1HA 4B4BA 2D7IA 3I0KA 2YQJA 1NF5B 2X60A 4Y7VA 3ZLKA 1H5RB 1SS9A 4UEGA 3OH2A 1JV3A 2O1HA 1MP4A 2FYBA 3FOQA 1ZI3A 4IRPA 2VFZA 2WGZA 4EEMA 1ZI1A 1ZCUA 5AJOA 2JCOA 2E8BA 3I0CA 2JCKA 2V0KA 3JUJA 1ZJOA 1H4EA 4KNXA 5C1LA 4B3UA 4B2WA 2O1GA 4FRAA 3Q7UA 3F1CA 3T7NA 5L6VA 3V0QA 2ICYA 3SXBA 1WT2A 1ZJ2A 4ASJA 2NXVA 3D98A 4J18A 3V8YA 5J49A 1VM8A 2VSHA 4M4KA 3V8ZA 2PX7A 2W0VA 4FRMA 5C4EA 2CU2A 3I0HA 2JCLA 4EEGA 4NAKA 1VGWA 2OI7A 4O6MA 4YS8A 3ZGFA 3U2XA 1G0RA 5CQMX 2V0HA 2Q4JA 1OQMB 2Y7AA 4EE4A 2FYCB 1O7OA 4D11A 1WSZA 5BXCA 2GGQA 1R7VA 4KT7A 4KPZA 4HO0A 1V82A 2QKXA 1PZYB 3I0DA 1H7EA 4HO4A 2RIYA 1TW1A 1KWSA 3F1YA 2ZU9A 3D5NA 3BRKX 1H7FA 1FGGA 2FY7A 4Y6UA 2OI5A 1G95A 5C36A 1JV1A 4FIXA 4G3QA 1QG8A 4D0TA 2AECA 2AM4A 3QVBA 5L6SA 5HS2A 3V91A 2OEGA 1H3MA 2A8UA 2Y4JA 3GUEA 5FU0A 2I5EA 2WVMA 4Y64A 1GQCA 2VXMA 2ZU7A 3U2WA 1FXOA 3RSBA 1WVCA 3V0NA 5CMFX 4NAIA 4KRVA 1H7LA 2VD4A 1ZJ1A 1ZJ0A 4FROA 1NWGB 3NGWA 1INJA 5CQOA 3PKQA 2MZBA 2XWNA 5FU8A 2VK9A 1W55A 2AH9A 2AM3A 1GWVA 3D8VA 5C8RA 4CVHA 5C3AA 4KC1A 1VICA 1EZIA 3OGZA 1ZCTA 2Y4KA 1W57A 4KC4A 3U2TA 5IDSA 3Q4SA 1G97A 1HM9A 3IOIA 1O0RA 2VS5A 3CKOA 2QH5A 2Z87A 4ZDQA 1R7UA 4LW6A 2XWMA 3ZF8A 4HO6A 4C2SA 4KC2A 5CQNX 1ZCYA 2P73A 1VZXA 1K4VA 2RJ5A 1R7TA 2XMEA 1R7YA 3R3IA 5CQLX 4G87A 3I0EA
chains in the Genus database with same CATH topology
4EEOA 4HG6A 2V0IA 4B2XA 1YP2A 2WE9A 3R2WA 2YQHA 2APCA 4B42A 3V0PA 4DE7A 1LZ7A 1LZIA 3V0MA 3EE5A 4Y6NA 3PKPA 1NKHB 3IOJA 1G2VA 5EJZA 5C3BA 4R7PA 1ON8A 3I0LA 4E1KA 1VH3A 3ST8A 4K6RA 2O1FA 5C49A 3SXDA 2P72A 4HCQA 4O6NA 1HJJA 1R7XA 2FFUA 2P6WA 5D92A 1GWWA 1HM8A 1TW5A 5C3DA 1TVYA 2ICXA 2W0WA 5FYEA 3ZGGA 2YQCA 1V84A 1VZTA 3U2VA 5I1FA 5CMJA 2RJ0A 4D0ZA 2RIZA 5IFYA 1INIA 4CJCA 1WT0A 3OKRA 4P02A 3SX8A 5AJPA 1H7TA 4LW3A 4XWIA 1WT1A 3OH3A 3U0XA 5C4CA 1FR8A 2C0NA 1YROB 4HO3A 1R81A 3T7OA 1H7GA 2FFVA 1R82A 1MP5A 2E3DA 1ZJPA 4CJ8A 1W77A 5IDTA 3CGXA 1S4PA 4FREA 5C1GA 2RJ4A 2FYAA 5EJ1A 1NMMB 1G9RA 2BO8A 1ZIZA 2AM5A 4M2AA 1QWJA 1IIMA 1H4DA 1VGZA 3I0FA 4IRQA 2I5KA 4ASYA 2V0LA 1VGUA 2Y4LA 1G23A 4HO2A 4BQHA 4DECA 3TZTA 2YQSA 1ZDFA 4DDZA 3N9WA 1G1LA 1S4NA 1G93A 1FOAA 4L41C 3E26A 4FRQA 4B5BA 4D48A 2WAWA 2Z86A 5FTSA 3BCVA 2JCJA 2OI6A 2BO4A 4Y7FA 1XZ6A 2Y6PA 4Y62A 1ZDGA 2D7RA 4EE3A 1IINA 1JVGA 3T7MA 2X5ZA 3FWWA 2BO6A 2VXLA 1V83A 5EIYA 5DDTA 2VSIA 1FO9A 1FZWA 2RJ8A 4Q7CA 1MP3A 3HL3A 3OAMA 4AC3A 4HOCA 1FR9A 2XWLA 3JUKA 3IOHA 2PGVA 3RMVA 5FUHA 4M2BA 1FO8A 5CMHA 2BO7A 3SXEA 4JD0A 4NALA 3Q80A 4EVWA 1QGSA 1EYRA 5AJNA 3SX3A 1O7QA 1FGXA 3RMWA 4Y9XA 1MC3A 3U2UA 1VGTA 2RJ7A 2J0BA 3I0GA 3OH1A 4FRDA 4NANA 4EE5A 4Y7UA 1GX0A 4KNRA 3CKQA 3KIAA 3ZLLA 2PGYA 3SXAA 1I52A 1LZ0A 3DUVA 3CKVA 5FV9A 3K8DA 1NHEB 1E5KA 2YCMA 1HM0A 1Z90A 1HV9A 2FYDB 1YP4A 2RJ9A 1OMZA 3DK5A 1ZJ3A 4CJBA 4MYBA 1LVWA 1GX4A 5C4DA 3CKNA 4P00A 5CMGX 5JQQA 3SPTA 1ON6A 3O3PA 1JVDA 2V0JA 2XMHA 1ZI4A 2D0JA 1R80A 3OH4A 4JISA 4AAWA 1H7HA 3OC9A 1TZFA 1H7QA 3I0JA 4Y7GA 1H5TA 4G3PA 4EEAA 4ECMA 3CKJA 2YC3A 2OEFA 1JYKA 3USRA 1H5SA 2A8WA 2RIXA 3V0OA 4MIXA 2QGIA 1WT3A 5C38A 5C47A 4BMAA 1NQIB 2WEEA 2YC5A 1G3LA 4FRBA 1VZUA 2X5SA 2ZU8A 2YESA 4HO9A 2PA4A 3V90A 5CQPA 4FQWA 1VPAA 2DPWA 4HO5A 4KXOA 4B4GA 4FCUA 4FIYA 1FWYA 2RJ1A 3POLA 4GBPA 1HJLA 1OMXA 5FTVA 4KQLA 4B4MA 1H5SD 4D11C 1FRWA 3OH0A 4Y7TA 1QGQA 2J0AA 1H5SC 4M28A 3TQDA 1H5RA 1LL2A 2AESA 2RITA 1ZI5A 1FXJA 4FRLA 4ARWA 3SXGA 2RJ6A 3K8EA 4FCEA 3U0YA 1FG5N 4FRPA 3SX5A 1GQ9A 2VS4A 3V0LA 2WVLA 2Y4MA 4AYJA 2VS3A 3I0IX 4MNDA 1H5TB 1GA8A 2GGOA 1JYLA 2X65A 3PNNA 1O23B 3SX7A 1H5SB 3USQA 3JTJA 5D91A 4G3SA 1VH1A 2AGDA 4KPXA 1XHBA 2AE7A 1ZCVA 1S4OA 3DJ4A 3CU0A 4HO8A 4Y63A 3SXCA 1PZTA 1LL3A 3E25A 1G8OA 5DDVA 1H4CA 2UX8A 5C4BA 1LL0A 1LZJA 1ZHJA 5C48A 3LW6A 4AYLA 1YP3A 2WVKA 5C4FA 5CMIA 2I7BA 4FRHA 5C1HA 4B4BA 2D7IA 3I0KA 2YQJA 1NF5B 2X60A 4Y7VA 3ZLKA 1H5RB 1SS9A 4UEGA 3OH2A 1JV3A 2O1HA 1MP4A 2FYBA 3FOQA 1ZI3A 4IRPA 2VFZA 2WGZA 4EEMA 1ZI1A 1ZCUA 5AJOA 2JCOA 2E8BA 3I0CA 2JCKA 2V0KA 3JUJA 1ZJOA 1H4EA 4KNXA 5C1LA 4B3UA 4B2WA 2O1GA 4FRAA 3Q7UA 3F1CA 3T7NA 5L6VA 3V0QA 2ICYA 3SXBA 1WT2A 1ZJ2A 4ASJA 2NXVA 3D98A 4J18A 3V8YA 5J49A 1VM8A 2VSHA 4M4KA 3V8ZA 2PX7A 2W0VA 4FRMA 5C4EA 2CU2A 3I0HA 2JCLA 4EEGA 4NAKA 1VGWA 2OI7A 4O6MA 4YS8A 3ZGFA 3U2XA 1G0RA 5CQMX 2V0HA 2Q4JA 1OQMB 2Y7AA 4EE4A 2FYCB 1O7OA 4D11A 1WSZA 5BXCA 2GGQA 1R7VA 4KT7A 4KPZA 4HO0A 1V82A 2QKXA 1PZYB 3I0DA 1H7EA 4HO4A 2RIYA 1TW1A 1KWSA 3F1YA 2ZU9A 3D5NA 3BRKX 1H7FA 1FGGA 2FY7A 4Y6UA 2OI5A 1G95A 5C36A 1JV1A 4FIXA 4G3QA 1QG8A 4D0TA 2AECA 2AM4A 3QVBA 5L6SA 5HS2A 3V91A 2OEGA 1H3MA 2A8UA 2Y4JA 3GUEA 5FU0A 2I5EA 2WVMA 4Y64A 1GQCA 2VXMA 2ZU7A 3U2WA 1FXOA 3RSBA 1WVCA 3V0NA 5CMFX 4NAIA 4KRVA 1H7LA 2VD4A 1ZJ1A 1ZJ0A 4FROA 1NWGB 3NGWA 1INJA 5CQOA 3PKQA 2MZBA 2XWNA 5FU8A 2VK9A 1W55A 2AH9A 2AM3A 1GWVA 3D8VA 5C8RA 4CVHA 5C3AA 4KC1A 1VICA 1EZIA 3OGZA 1ZCTA 2Y4KA 1W57A 4KC4A 3U2TA 5IDSA 3Q4SA 1G97A 1HM9A 3IOIA 1O0RA 2VS5A 3CKOA 2QH5A 2Z87A 4ZDQA 1R7UA 4LW6A 2XWMA 3ZF8A 4HO6A 4C2SA 4KC2A 5CQNX 1ZCYA 2P73A 1VZXA 1K4VA 2RJ5A 1R7TA 2XMEA 1R7YA 3R3IA 5CQLX 4G87A 3I0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EEO A;  4HG6 A;  2V0I A;  4B2X A;  1YP2 A;  2WE9 A;  3R2W A;  2YQH A;  2APC A;  4B42 A;  3V0P A;  4DE7 A;  1LZ7 A;  1LZI A;  3V0M A;  3EE5 A;  4Y6N A;  3PKP A;  1NKH B;  3IOJ A;  1G2V A;  5EJZ A;  5C3B A;  4R7P A;  1ON8 A;  3I0L A;  4E1K A;  1VH3 A;  3ST8 A;  4K6R A;  2O1F A;  5C49 A;  3SXD A;  2P72 A;  4HCQ A;  1HJJ A;  1R7X A;  2FFU A;  2P6W A;  1GWW A;  1HM8 A;  1TW5 A;  5C3D A;  1TVY A;  2ICX A;  2W0W A;  5FYE A;  3ZGG A;  2YQC A;  1V84 A;  1VZT A;  3U2V A;  5I1F A;  5CMJ A;  2RJ0 A;  4D0Z A;  2RIZ A;  5IFY A;  1INI A;  4CJC A;  1WT0 A;  3OKR A;  4P02 A;  3SX8 A;  5AJP A;  1H7T A;  4LW3 A;  4XWI A;  1WT1 A;  3OH3 A;  3U0X A;  5C4C A;  1FR8 A;  1YRO B;  4HO3 A;  1R81 A;  3T7O A;  1H7G A;  2FFV A;  1R82 A;  1MP5 A;  2E3D A;  1ZJP A;  4CJ8 A;  1W77 A;  5IDT A;  3CGX A;  1S4P A;  4FRE A;  5C1G A;  2RJ4 A;  2FYA A;  5EJ1 A;  1NMM B;  1G9R A;  2BO8 A;  1ZIZ A;  2AM5 A;  4M2A A;  1QWJ A;  1IIM A;  1H4D A;  1VGZ A;  3I0F A;  4IRQ A;  2I5K A;  4ASY A;  2V0L A;  1VGU A;  2Y4L A;  1G23 A;  4HO2 A;  4BQH A;  4DEC A;  3TZT A;  2YQS A;  1ZDF A;  4DDZ A;  3N9W A;  1G1L A;  1S4N A;  1G93 A;  1FOA A;  4L41 C;  3E26 A;  4FRQ A;  4B5B A;  4D48 A;  2WAW A;  2Z86 A;  5FTS A;  3BCV A;  2JCJ A;  2OI6 A;  2BO4 A;  4Y7F A;  1XZ6 A;  2Y6P A;  4Y62 A;  1ZDG A;  2D7R A;  4EE3 A;  1IIN A;  1JVG A;  3T7M A;  2X5Z A;  3FWW A;  2BO6 A;  2VXL A;  1V83 A;  5EIY A;  5DDT A;  2VSI A;  1FO9 A;  1FZW A;  2RJ8 A;  1MP3 A;  3HL3 A;  3OAM A;  4AC3 A;  4HOC A;  1FR9 A;  2XWL A;  3JUK A;  3IOH A;  2PGV A;  3RMV A;  5FUH A;  4M2B A;  1FO8 A;  5CMH A;  2BO7 A;  3SXE A;  4JD0 A;  4NAL A;  3Q80 A;  4EVW A;  1QGS A;  1EYR A;  5AJN A;  3SX3 A;  1O7Q A;  1FGX A;  3RMW A;  4Y9X A;  1MC3 A;  3U2U A;  1VGT A;  2RJ7 A;  3I0G A;  3OH1 A;  4FRD A;  4NAN A;  4EE5 A;  4Y7U A;  1GX0 A;  4KNR A;  3CKQ A;  3KIA A;  3ZLL A;  2PGY A;  3SXA A;  1I52 A;  1LZ0 A;  3DUV A;  3CKV A;  5FV9 A;  3K8D A;  1NHE B;  1E5K A;  2YCM A;  1HM0 A;  1Z90 A;  1HV9 A;  2FYD B;  1YP4 A;  2RJ9 A;  1OMZ A;  3DK5 A;  1ZJ3 A;  4CJB A;  4MYB A;  1LVW A;  1GX4 A;  5C4D A;  3CKN A;  4P00 A;  5CMG X;  5JQQ A;  3SPT A;  1ON6 A;  3O3P A;  1JVD A;  2V0J A;  2XMH A;  1ZI4 A;  2D0J A;  1R80 A;  3OH4 A;  4JIS A;  4AAW A;  1H7H A;  3OC9 A;  1TZF A;  1H7Q A;  3I0J A;  4Y7G A;  1H5T A;  4G3P A;  4EEA A;  4ECM A;  3CKJ A;  2YC3 A;  2OEF A;  1JYK A;  3USR A;  1H5S A;  2A8W A;  2RIX A;  3V0O A;  5C38 A;  2QGI A;  1WT3 A;  5C47 A;  4BMA A;  1NQI B;  2WEE A;  2YC5 A;  1G3L A;  4FRB A;  1VZU A;  2X5S A;  2ZU8 A;  2YES A;  4HO9 A;  2PA4 A;  3V90 A;  5CQP A;  4FQW A;  1VPA A;  2DPW A;  4HO5 A;  4KXO A;  4B4G A;  4FCU A;  1FWY A;  2RJ1 A;  3POL A;  4GBP A;  1HJL A;  1OMX A;  5FTV A;  4KQL A;  4B4M A;  1H5S D;  4D11 C;  1FRW A;  3OH0 A;  4Y7T A;  1QGQ A;  1H5S C;  4M28 A;  3TQD A;  1H5R A;  1LL2 A;  2AES A;  2RIT A;  1ZI5 A;  1FXJ A;  4FRL A;  4ARW A;  3SXG A;  2RJ6 A;  3K8E A;  4FCE A;  3U0Y A;  1FG5 N;  4FRP A;  3SX5 A;  1GQ9 A;  2VS4 A;  3V0L A;  2WVL A;  2Y4M A;  4AYJ A;  2VS3 A;  3I0I X;  4MND A;  1H5T B;  1GA8 A;  2GGO A;  1JYL A;  2X65 A;  3PNN A;  1O23 B;  3SX7 A;  1H5S B;  3USQ A;  3JTJ A;  4G3S A;  1VH1 A;  2AGD A;  4KPX A;  1XHB A;  2AE7 A;  1ZCV A;  1S4O A;  3DJ4 A;  3CU0 A;  4HO8 A;  4Y63 A;  3SXC A;  1PZT A;  1LL3 A;  3E25 A;  1G8O A;  5DDV A;  1H4C A;  2UX8 A;  5C4B A;  1LL0 A;  1LZJ A;  1ZHJ A;  5C48 A;  3LW6 A;  4AYL A;  1YP3 A;  2WVK A;  5C4F A;  5CMI A;  2I7B A;  4FRH A;  5C1H A;  4B4B A;  2D7I A;  3I0K A;  2YQJ A;  1NF5 B;  2X60 A;  4Y7V A;  3ZLK A;  1H5R B;  1SS9 A;  4UEG A;  3OH2 A;  1JV3 A;  2O1H A;  1MP4 A;  2FYB A;  3FOQ A;  1ZI3 A;  4IRP A;  2VFZ A;  2WGZ A;  4EEM A;  1ZI1 A;  1ZCU A;  5AJO A;  2JCO A;  2E8B A;  3I0C A;  2JCK A;  2V0K A;  3JUJ A;  1ZJO A;  1H4E A;  4KNX A;  5C1L A;  4B3U A;  4B2W A;  2O1G A;  4FRA A;  3Q7U A;  3F1C A;  3T7N A;  5L6V A;  3V0Q A;  2ICY A;  3SXB A;  1WT2 A;  1ZJ2 A;  4ASJ A;  2NXV A;  3D98 A;  4J18 A;  3V8Y A;  5J49 A;  1VM8 A;  2VSH A;  4M4K A;  3V8Z A;  2PX7 A;  2W0V A;  4FRM A;  5C4E A;  2CU2 A;  3I0H A;  2JCL A;  4EEG A;  4NAK A;  1VGW A;  2OI7 A;  4YS8 A;  3ZGF A;  3U2X A;  1G0R A;  5CQM X;  2V0H A;  2Q4J A;  1OQM B;  2Y7A A;  4EE4 A;  2FYC B;  1O7O A;  4D11 A;  1WSZ A;  5BXC A;  2GGQ A;  1R7V A;  4KT7 A;  4KPZ A;  4HO0 A;  1V82 A;  2QKX A;  1PZY B;  3I0D A;  1H7E A;  4HO4 A;  2RIY A;  1TW1 A;  1KWS A;  3F1Y A;  2ZU9 A;  3D5N A;  3BRK X;  1H7F A;  1FGG A;  2FY7 A;  4Y6U A;  2OI5 A;  1G95 A;  5C36 A;  1JV1 A;  4G3Q A;  1QG8 A;  4D0T A;  2AEC A;  2AM4 A;  3QVB A;  5L6S A;  5HS2 A;  3V91 A;  2OEG A;  1H3M A;  2A8U A;  2Y4J A;  3GUE A;  5FU0 A;  2I5E A;  2WVM A;  4Y64 A;  1GQC A;  2VXM A;  2ZU7 A;  3U2W A;  1FXO A;  3RSB A;  1WVC A;  3V0N A;  5CMF X;  4NAI A;  4KRV A;  1H7L A;  2VD4 A;  1ZJ1 A;  1ZJ0 A;  4FRO A;  1NWG B;  3NGW A;  1INJ A;  5CQO A;  3PKQ A;  2MZB A;  2XWN A;  5FU8 A;  1W55 A;  2AH9 A;  2AM3 A;  1GWV A;  3D8V A;  5C8R A;  4CVH A;  5C3A A;  4KC1 A;  1VIC A;  1EZI A;  3OGZ A;  1ZCT A;  2Y4K A;  1W57 A;  4KC4 A;  3U2T A;  5IDS A;  3Q4S A;  1G97 A;  1HM9 A;  3IOI A;  1O0R A;  2VS5 A;  3CKO A;  2QH5 A;  2Z87 A;  4ZDQ A;  1R7U A;  4LW6 A;  2XWM A;  3ZF8 A;  4HO6 A;  4C2S A;  4KC2 A;  5CQN X;  1ZCY A;  2P73 A;  1VZX A;  1K4V A;  2RJ5 A;  1R7T A;  2XME A;  1R7Y A;  3R3I A;  5CQL X;  4G87 A;  3I0E A; 
#chains in the Genus database with same CATH topology
 4EEO A;  4HG6 A;  2V0I A;  4B2X A;  1YP2 A;  2WE9 A;  3R2W A;  2YQH A;  2APC A;  4B42 A;  3V0P A;  4DE7 A;  1LZ7 A;  1LZI A;  3V0M A;  3EE5 A;  4Y6N A;  3PKP A;  1NKH B;  3IOJ A;  1G2V A;  5EJZ A;  5C3B A;  4R7P A;  1ON8 A;  3I0L A;  4E1K A;  1VH3 A;  3ST8 A;  4K6R A;  2O1F A;  5C49 A;  3SXD A;  2P72 A;  4HCQ A;  4O6N A;  1HJJ A;  1R7X A;  2FFU A;  2P6W A;  5D92 A;  1GWW A;  1HM8 A;  1TW5 A;  5C3D A;  1TVY A;  2ICX A;  2W0W A;  5FYE A;  3ZGG A;  2YQC A;  1V84 A;  1VZT A;  3U2V A;  5I1F A;  5CMJ A;  2RJ0 A;  4D0Z A;  2RIZ A;  5IFY A;  1INI A;  4CJC A;  1WT0 A;  3OKR A;  4P02 A;  3SX8 A;  5AJP A;  1H7T A;  4LW3 A;  4XWI A;  1WT1 A;  3OH3 A;  3U0X A;  5C4C A;  1FR8 A;  2C0N A;  1YRO B;  4HO3 A;  1R81 A;  3T7O A;  1H7G A;  2FFV A;  1R82 A;  1MP5 A;  2E3D A;  1ZJP A;  4CJ8 A;  1W77 A;  5IDT A;  3CGX A;  1S4P A;  4FRE A;  5C1G A;  2RJ4 A;  2FYA A;  5EJ1 A;  1NMM B;  1G9R A;  2BO8 A;  1ZIZ A;  2AM5 A;  4M2A A;  1QWJ A;  1IIM A;  1H4D A;  1VGZ A;  3I0F A;  4IRQ A;  2I5K A;  4ASY A;  2V0L A;  1VGU A;  2Y4L A;  1G23 A;  4HO2 A;  4BQH A;  4DEC A;  3TZT A;  2YQS A;  1ZDF A;  4DDZ A;  3N9W A;  1G1L A;  1S4N A;  1G93 A;  1FOA A;  4L41 C;  3E26 A;  4FRQ A;  4B5B A;  4D48 A;  2WAW A;  2Z86 A;  5FTS A;  3BCV A;  2JCJ A;  2OI6 A;  2BO4 A;  4Y7F A;  1XZ6 A;  2Y6P A;  4Y62 A;  1ZDG A;  2D7R A;  4EE3 A;  1IIN A;  1JVG A;  3T7M A;  2X5Z A;  3FWW A;  2BO6 A;  2VXL A;  1V83 A;  5EIY A;  5DDT A;  2VSI A;  1FO9 A;  1FZW A;  2RJ8 A;  4Q7C A;  1MP3 A;  3HL3 A;  3OAM A;  4AC3 A;  4HOC A;  1FR9 A;  2XWL A;  3JUK A;  3IOH A;  2PGV A;  3RMV A;  5FUH A;  4M2B A;  1FO8 A;  5CMH A;  2BO7 A;  3SXE A;  4JD0 A;  4NAL A;  3Q80 A;  4EVW A;  1QGS A;  1EYR A;  5AJN A;  3SX3 A;  1O7Q A;  1FGX A;  3RMW A;  4Y9X A;  1MC3 A;  3U2U A;  1VGT A;  2RJ7 A;  2J0B A;  3I0G A;  3OH1 A;  4FRD A;  4NAN A;  4EE5 A;  4Y7U A;  1GX0 A;  4KNR A;  3CKQ A;  3KIA A;  3ZLL A;  2PGY A;  3SXA A;  1I52 A;  1LZ0 A;  3DUV A;  3CKV A;  5FV9 A;  3K8D A;  1NHE B;  1E5K A;  2YCM A;  1HM0 A;  1Z90 A;  1HV9 A;  2FYD B;  1YP4 A;  2RJ9 A;  1OMZ A;  3DK5 A;  1ZJ3 A;  4CJB A;  4MYB A;  1LVW A;  1GX4 A;  5C4D A;  3CKN A;  4P00 A;  5CMG X;  5JQQ A;  3SPT A;  1ON6 A;  3O3P A;  1JVD A;  2V0J A;  2XMH A;  1ZI4 A;  2D0J A;  1R80 A;  3OH4 A;  4JIS A;  4AAW A;  1H7H A;  3OC9 A;  1TZF A;  1H7Q A;  3I0J A;  4Y7G A;  1H5T A;  4G3P A;  4EEA A;  4ECM A;  3CKJ A;  2YC3 A;  2OEF A;  1JYK A;  3USR A;  1H5S A;  2A8W A;  2RIX A;  3V0O A;  4MIX A;  2QGI A;  1WT3 A;  5C38 A;  5C47 A;  4BMA A;  1NQI B;  2WEE A;  2YC5 A;  1G3L A;  4FRB A;  1VZU A;  2X5S A;  2ZU8 A;  2YES A;  4HO9 A;  2PA4 A;  3V90 A;  5CQP A;  4FQW A;  1VPA A;  2DPW A;  4HO5 A;  4KXO A;  4B4G A;  4FCU A;  4FIY A;  1FWY A;  2RJ1 A;  3POL A;  4GBP A;  1HJL A;  1OMX A;  5FTV A;  4KQL A;  4B4M A;  1H5S D;  4D11 C;  1FRW A;  3OH0 A;  4Y7T A;  1QGQ A;  2J0A A;  1H5S C;  4M28 A;  3TQD A;  1H5R A;  1LL2 A;  2AES A;  2RIT A;  1ZI5 A;  1FXJ A;  4FRL A;  4ARW A;  3SXG A;  2RJ6 A;  3K8E A;  4FCE A;  3U0Y A;  1FG5 N;  4FRP A;  3SX5 A;  1GQ9 A;  2VS4 A;  3V0L A;  2WVL A;  2Y4M A;  4AYJ A;  2VS3 A;  3I0I X;  4MND A;  1H5T B;  1GA8 A;  2GGO A;  1JYL A;  2X65 A;  3PNN A;  1O23 B;  3SX7 A;  1H5S B;  3USQ A;  3JTJ A;  5D91 A;  4G3S A;  1VH1 A;  2AGD A;  4KPX A;  1XHB A;  2AE7 A;  1ZCV A;  1S4O A;  3DJ4 A;  3CU0 A;  4HO8 A;  4Y63 A;  3SXC A;  1PZT A;  1LL3 A;  3E25 A;  1G8O A;  5DDV A;  1H4C A;  2UX8 A;  5C4B A;  1LL0 A;  1LZJ A;  1ZHJ A;  5C48 A;  3LW6 A;  4AYL A;  1YP3 A;  2WVK A;  5C4F A;  5CMI A;  2I7B A;  4FRH A;  5C1H A;  4B4B A;  2D7I A;  3I0K A;  2YQJ A;  1NF5 B;  2X60 A;  4Y7V A;  3ZLK A;  1H5R B;  1SS9 A;  4UEG A;  3OH2 A;  1JV3 A;  2O1H A;  1MP4 A;  2FYB A;  3FOQ A;  1ZI3 A;  4IRP A;  2VFZ A;  2WGZ A;  4EEM A;  1ZI1 A;  1ZCU A;  5AJO A;  2JCO A;  2E8B A;  3I0C A;  2JCK A;  2V0K A;  3JUJ A;  1ZJO A;  1H4E A;  4KNX A;  5C1L A;  4B3U A;  4B2W A;  2O1G A;  4FRA A;  3Q7U A;  3F1C A;  3T7N A;  5L6V A;  3V0Q A;  2ICY A;  3SXB A;  1WT2 A;  1ZJ2 A;  4ASJ A;  2NXV A;  3D98 A;  4J18 A;  3V8Y A;  5J49 A;  1VM8 A;  2VSH A;  4M4K A;  3V8Z A;  2PX7 A;  2W0V A;  4FRM A;  5C4E A;  2CU2 A;  3I0H A;  2JCL A;  4EEG A;  4NAK A;  1VGW A;  2OI7 A;  4O6M A;  4YS8 A;  3ZGF A;  3U2X A;  1G0R A;  5CQM X;  2V0H A;  2Q4J A;  1OQM B;  2Y7A A;  4EE4 A;  2FYC B;  1O7O A;  4D11 A;  1WSZ A;  5BXC A;  2GGQ A;  1R7V A;  4KT7 A;  4KPZ A;  4HO0 A;  1V82 A;  2QKX A;  1PZY B;  3I0D A;  1H7E A;  4HO4 A;  2RIY A;  1TW1 A;  1KWS A;  3F1Y A;  2ZU9 A;  3D5N A;  3BRK X;  1H7F A;  1FGG A;  2FY7 A;  4Y6U A;  2OI5 A;  1G95 A;  5C36 A;  1JV1 A;  4FIX A;  4G3Q A;  1QG8 A;  4D0T A;  2AEC A;  2AM4 A;  3QVB A;  5L6S A;  5HS2 A;  3V91 A;  2OEG A;  1H3M A;  2A8U A;  2Y4J A;  3GUE A;  5FU0 A;  2I5E A;  2WVM A;  4Y64 A;  1GQC A;  2VXM A;  2ZU7 A;  3U2W A;  1FXO A;  3RSB A;  1WVC A;  3V0N A;  5CMF X;  4NAI A;  4KRV A;  1H7L A;  2VD4 A;  1ZJ1 A;  1ZJ0 A;  4FRO A;  1NWG B;  3NGW A;  1INJ A;  5CQO A;  3PKQ A;  2MZB A;  2XWN A;  5FU8 A;  2VK9 A;  1W55 A;  2AH9 A;  2AM3 A;  1GWV A;  3D8V A;  5C8R A;  4CVH A;  5C3A A;  4KC1 A;  1VIC A;  1EZI A;  3OGZ A;  1ZCT A;  2Y4K A;  1W57 A;  4KC4 A;  3U2T A;  5IDS A;  3Q4S A;  1G97 A;  1HM9 A;  3IOI A;  1O0R A;  2VS5 A;  3CKO A;  2QH5 A;  2Z87 A;  4ZDQ A;  1R7U A;  4LW6 A;  2XWM A;  3ZF8 A;  4HO6 A;  4C2S A;  4KC2 A;  5CQN X;  1ZCY A;  2P73 A;  1VZX A;  1K4V A;  2RJ5 A;  1R7T A;  2XME A;  1R7Y A;  3R3I A;  5CQL X;  4G87 A;  3I0E A; 
#chains in the Genus database with same CATH homology
 4EEO A;  4HG6 A;  2V0I A;  4B2X A;  1YP2 A;  2WE9 A;  3R2W A;  2YQH A;  2APC A;  4B42 A;  3V0P A;  4DE7 A;  1LZ7 A;  1LZI A;  3V0M A;  3EE5 A;  4Y6N A;  3PKP A;  1NKH B;  3IOJ A;  1G2V A;  5EJZ A;  5C3B A;  4R7P A;  1ON8 A;  3I0L A;  4E1K A;  1VH3 A;  3ST8 A;  4K6R A;  2O1F A;  5C49 A;  3SXD A;  2P72 A;  4HCQ A;  4O6N A;  1HJJ A;  1R7X A;  2FFU A;  2P6W A;  5D92 A;  1GWW A;  1HM8 A;  1TW5 A;  5C3D A;  1TVY A;  2ICX A;  2W0W A;  5FYE A;  3ZGG A;  2YQC A;  1V84 A;  1VZT A;  3U2V A;  5I1F A;  5CMJ A;  2RJ0 A;  4D0Z A;  2RIZ A;  5IFY A;  1INI A;  4CJC A;  1WT0 A;  3OKR A;  4P02 A;  3SX8 A;  5AJP A;  1H7T A;  4LW3 A;  4XWI A;  1WT1 A;  3OH3 A;  3U0X A;  5C4C A;  1FR8 A;  2C0N A;  1YRO B;  4HO3 A;  1R81 A;  3T7O A;  1H7G A;  2FFV A;  1R82 A;  1MP5 A;  2E3D A;  1ZJP A;  4CJ8 A;  1W77 A;  5IDT A;  3CGX A;  1S4P A;  4FRE A;  5C1G A;  2RJ4 A;  2FYA A;  5EJ1 A;  1NMM B;  1G9R A;  2BO8 A;  1ZIZ A;  2AM5 A;  4M2A A;  1QWJ A;  1IIM A;  1H4D A;  1VGZ A;  3I0F A;  4IRQ A;  2I5K A;  4ASY A;  2V0L A;  1VGU A;  2Y4L A;  1G23 A;  4HO2 A;  4BQH A;  4DEC A;  3TZT A;  2YQS A;  1ZDF A;  4DDZ A;  3N9W A;  1G1L A;  1S4N A;  1G93 A;  1FOA A;  4L41 C;  3E26 A;  4FRQ A;  4B5B A;  4D48 A;  2WAW A;  2Z86 A;  5FTS A;  3BCV A;  2JCJ A;  2OI6 A;  2BO4 A;  4Y7F A;  1XZ6 A;  2Y6P A;  4Y62 A;  1ZDG A;  2D7R A;  4EE3 A;  1IIN A;  1JVG A;  3T7M A;  2X5Z A;  3FWW A;  2BO6 A;  2VXL A;  1V83 A;  5EIY A;  5DDT A;  2VSI A;  1FO9 A;  1FZW A;  2RJ8 A;  4Q7C A;  1MP3 A;  3HL3 A;  3OAM A;  4AC3 A;  4HOC A;  1FR9 A;  2XWL A;  3JUK A;  3IOH A;  2PGV A;  3RMV A;  5FUH A;  4M2B A;  1FO8 A;  5CMH A;  2BO7 A;  3SXE A;  4JD0 A;  4NAL A;  3Q80 A;  4EVW A;  1QGS A;  1EYR A;  5AJN A;  3SX3 A;  1O7Q A;  1FGX A;  3RMW A;  4Y9X A;  1MC3 A;  3U2U A;  1VGT A;  2RJ7 A;  2J0B A;  3I0G A;  3OH1 A;  4FRD A;  4NAN A;  4EE5 A;  4Y7U A;  1GX0 A;  4KNR A;  3CKQ A;  3KIA A;  3ZLL A;  2PGY A;  3SXA A;  1I52 A;  1LZ0 A;  3DUV A;  3CKV A;  5FV9 A;  3K8D A;  1NHE B;  1E5K A;  2YCM A;  1HM0 A;  1Z90 A;  1HV9 A;  2FYD B;  1YP4 A;  2RJ9 A;  1OMZ A;  3DK5 A;  1ZJ3 A;  4CJB A;  4MYB A;  1LVW A;  1GX4 A;  5C4D A;  3CKN A;  4P00 A;  5CMG X;  5JQQ A;  3SPT A;  1ON6 A;  3O3P A;  1JVD A;  2V0J A;  2XMH A;  1ZI4 A;  2D0J A;  1R80 A;  3OH4 A;  4JIS A;  4AAW A;  1H7H A;  3OC9 A;  1TZF A;  1H7Q A;  3I0J A;  4Y7G A;  1H5T A;  4G3P A;  4EEA A;  4ECM A;  3CKJ A;  2YC3 A;  2OEF A;  1JYK A;  3USR A;  1H5S A;  2A8W A;  2RIX A;  3V0O A;  4MIX A;  2QGI A;  1WT3 A;  5C38 A;  5C47 A;  4BMA A;  1NQI B;  2WEE A;  2YC5 A;  1G3L A;  4FRB A;  1VZU A;  2X5S A;  2ZU8 A;  2YES A;  4HO9 A;  2PA4 A;  3V90 A;  5CQP A;  4FQW A;  1VPA A;  2DPW A;  4HO5 A;  4KXO A;  4B4G A;  4FCU A;  4FIY A;  1FWY A;  2RJ1 A;  3POL A;  4GBP A;  1HJL A;  1OMX A;  5FTV A;  4KQL A;  4B4M A;  1H5S D;  4D11 C;  1FRW A;  3OH0 A;  4Y7T A;  1QGQ A;  2J0A A;  1H5S C;  4M28 A;  3TQD A;  1H5R A;  1LL2 A;  2AES A;  2RIT A;  1ZI5 A;  1FXJ A;  4FRL A;  4ARW A;  3SXG A;  2RJ6 A;  3K8E A;  4FCE A;  3U0Y A;  1FG5 N;  4FRP A;  3SX5 A;  1GQ9 A;  2VS4 A;  3V0L A;  2WVL A;  2Y4M A;  4AYJ A;  2VS3 A;  3I0I X;  4MND A;  1H5T B;  1GA8 A;  2GGO A;  1JYL A;  2X65 A;  3PNN A;  1O23 B;  3SX7 A;  1H5S B;  3USQ A;  3JTJ A;  5D91 A;  4G3S A;  1VH1 A;  2AGD A;  4KPX A;  1XHB A;  2AE7 A;  1ZCV A;  1S4O A;  3DJ4 A;  3CU0 A;  4HO8 A;  4Y63 A;  3SXC A;  1PZT A;  1LL3 A;  3E25 A;  1G8O A;  5DDV A;  1H4C A;  2UX8 A;  5C4B A;  1LL0 A;  1LZJ A;  1ZHJ A;  5C48 A;  3LW6 A;  4AYL A;  1YP3 A;  2WVK A;  5C4F A;  5CMI A;  2I7B A;  4FRH A;  5C1H A;  4B4B A;  2D7I A;  3I0K A;  2YQJ A;  1NF5 B;  2X60 A;  4Y7V A;  3ZLK A;  1H5R B;  1SS9 A;  4UEG A;  3OH2 A;  1JV3 A;  2O1H A;  1MP4 A;  2FYB A;  3FOQ A;  1ZI3 A;  4IRP A;  2VFZ A;  2WGZ A;  4EEM A;  1ZI1 A;  1ZCU A;  5AJO A;  2JCO A;  2E8B A;  3I0C A;  2JCK A;  2V0K A;  3JUJ A;  1ZJO A;  1H4E A;  4KNX A;  5C1L A;  4B3U A;  4B2W A;  2O1G A;  4FRA A;  3Q7U A;  3F1C A;  3T7N A;  5L6V A;  3V0Q A;  2ICY A;  3SXB A;  1WT2 A;  1ZJ2 A;  4ASJ A;  2NXV A;  3D98 A;  4J18 A;  3V8Y A;  5J49 A;  1VM8 A;  2VSH A;  4M4K A;  3V8Z A;  2PX7 A;  2W0V A;  4FRM A;  5C4E A;  2CU2 A;  3I0H A;  2JCL A;  4EEG A;  4NAK A;  1VGW A;  2OI7 A;  4O6M A;  4YS8 A;  3ZGF A;  3U2X A;  1G0R A;  5CQM X;  2V0H A;  2Q4J A;  1OQM B;  2Y7A A;  4EE4 A;  2FYC B;  1O7O A;  4D11 A;  1WSZ A;  5BXC A;  2GGQ A;  1R7V A;  4KT7 A;  4KPZ A;  4HO0 A;  1V82 A;  2QKX A;  1PZY B;  3I0D A;  1H7E A;  4HO4 A;  2RIY A;  1TW1 A;  1KWS A;  3F1Y A;  2ZU9 A;  3D5N A;  3BRK X;  1H7F A;  1FGG A;  2FY7 A;  4Y6U A;  2OI5 A;  1G95 A;  5C36 A;  1JV1 A;  4FIX A;  4G3Q A;  1QG8 A;  4D0T A;  2AEC A;  2AM4 A;  3QVB A;  5L6S A;  5HS2 A;  3V91 A;  2OEG A;  1H3M A;  2A8U A;  2Y4J A;  3GUE A;  5FU0 A;  2I5E A;  2WVM A;  4Y64 A;  1GQC A;  2VXM A;  2ZU7 A;  3U2W A;  1FXO A;  3RSB A;  1WVC A;  3V0N A;  5CMF X;  4NAI A;  4KRV A;  1H7L A;  2VD4 A;  1ZJ1 A;  1ZJ0 A;  4FRO A;  1NWG B;  3NGW A;  1INJ A;  5CQO A;  3PKQ A;  2MZB A;  2XWN A;  5FU8 A;  2VK9 A;  1W55 A;  2AH9 A;  2AM3 A;  1GWV A;  3D8V A;  5C8R A;  4CVH A;  5C3A A;  4KC1 A;  1VIC A;  1EZI A;  3OGZ A;  1ZCT A;  2Y4K A;  1W57 A;  4KC4 A;  3U2T A;  5IDS A;  3Q4S A;  1G97 A;  1HM9 A;  3IOI A;  1O0R A;  2VS5 A;  3CKO A;  2QH5 A;  2Z87 A;  4ZDQ A;  1R7U A;  4LW6 A;  2XWM A;  3ZF8 A;  4HO6 A;  4C2S A;  4KC2 A;  5CQN X;  1ZCY A;  2P73 A;  1VZX A;  1K4V A;  2RJ5 A;  1R7T A;  2XME A;  1R7Y A;  3R3I A;  5CQL X;  4G87 A;  3I0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...