1QGSA

Udp-magnesium complex of spsa from bacillus subtilis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
255
structure length
238
Chain Sequence
PKVSVIMTSYNKSDYVAKSISSILSQTFSDFELFIMDDNSNEETLNVIRPFLNDNRVRFYQSDISGVKERTEKTRYAALINQAIEMAEGEYITYATDDNIYMPDRLLKMVRELDTHPEKAVIYSASKTYHLNDIVKETVRPAAQVTWNAPCAIDHCSVMHRYSVLEKVKEKFGSYWDESPAFYRIGDARFFWRVNHFYPFYPLDEELDLNYITEFVRNLPPQRNCRELRESLKKLGMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SPORE COAT POLYSACCHARIDE BIOSYNTHESIS PROTEIN SPSA
publication title Structure of the nucleotide-diphospho-sugar transferase, SpsA from Bacillus subtilis, in native and nucleotide-complexed forms.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 89
structure length 238
sequence length 255
ec nomenclature
pdb deposition date 1999-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1qgsA00
3V0MA 2RJ7A 4JD0A 2VD4A 1VGTA 4D11C 1FO8A 1INJA 1FGGA 4KC2A 4MYBA 1G3LA 2RJ9A 5FUHA 4NAIA 3JUKA 3OC9A 5C49A 3KIAA 4ARWA 2RJ5A 2FYBA 4HO8A 1MP5A 4EE5A 3SXGA 1VPAA 1ZJ1A 5IDSA 2XMEA 1ZJ0A 2RJ1A 1VH3A 4IRQA 1HJJA 2XWNA 3CKNA 2BO8A 5C4FA 2V0KA 2OEFA 1WSZA 2RITA 1VGZA 4DECA 5FU0A 2X60A 1ZCUA 2V0HA 1R80A 2YQHA 1QGSA 2O1HA 2OI6A 3V90A 1R7TA 2PGYA 1ZHJA 2AM4A 2V0JA 2MZBA 2Y6PA 2PX7A 2RJ0A 5CMIA 1ZCYA 2FFUA 2I7BA 3IOJA 4Y64A 1QG8A 1R7XA 4FRBA 3ZGGA 2RIXA 3OH1A 1ZI4A 1LZ0A 5HS2A 2YC5A 2AE7A 2Y4LA 4FREA 1G8OA 3BCVA 4HO3A 1FGXA 1QWJA 3JUJA 1ZJ3A 4FROA 3SXDA 3I0KA 3TZTA 1WT2A 1MP4A 2VS4A 3I0IX 2QGIA 1ZJ2A 1FXJA 4AYLA 2VS5A 5FV9A 2AGDA 1G2VA 2RJ4A 1GWVA 5C4BA 1NMMB 2Q4JA 3V0QA 3ZF8A 2O1FA 1V84A 2CU2A 5JQQA 4BMAA 5FTSA 3RMVA 3I0CA 2BO4A 1V82A 4HO5A 3I0GA 3I0DA 2VFZA 2AECA 3T7OA 1MC3A 5C3AA 4EEGA 4NANA 2WE9A 2OEGA 1NHEB 2I5EA 4Y7FA 2D7RA 3OH4A 1W55A 3E26A 5C1LA 3FOQA 4MNDA 4FRMA 1H5SD 3SX5A 4HO9A 2QH5A 2VXMA 2JCOA 1VGWA 4Y7GA 3OGZA 1VZTA 4FQWA 3U2TA 1YP3A 1VM8A 2RIZA 5C1GA 2ICYA 4FCEA 3CKQA 4B2XA 1W77A 2WVKA 3TQDA 1HV9A 1ZJOA 2GGOA 3PNNA 3U0XA 1PZTA 3I0LA 5C1HA 1S4NA 1G23A 1TZFA 2OI5A 1V83A 1ZCVA 5C4EA 1JYKA 3F1YA 5CQPA 3D8VA 1R81A 1VZXA 3F1CA 3SPTA 1H5SC 4ASYA 1MP3A 4G3QA 4B4BA 3USRA 3CU0A 4KC4A 3U2UA 1ZI5A 4NAKA 5C8RA 1INIA 1R7UA 2XMHA 3JTJA 3EE5A 1GWWA 1GX4A 3I0EA 2E8BA 4P02A 1FG5N 2V0LA 1H3MA 2I5KA 5I1FA 1HM0A 4Y62A 1FOAA 1JYLA 2JCJA 1E5KA 4YS8A 4XWIA 2RIYA 4B4MA 4KPZA 1ZDGA 4M2BA 3V0PA 2FYDB 1FR9A 2XWLA 3Q80A 1FWYA 2WGZA 3V0LA 1WT0A 1G1LA 1PZYB 3FWWA 4NALA 5L6VA 3USQA 1VH1A 3DK5A 3V8ZA 2A8UA 3POLA 2BO6A 4D48A 1NWGB 2Y4KA 4IRPA 4LW3A 5C47A 1LL3A 1ON6A 4HO2A 4Y6NA 2PGVA 5CMGX 1HM9A 3K8EA 4KPXA 3DUVA 1O7OA 4Y7UA 4FRLA 1OMZA 5IFYA 1H4EA 3BRKX 2A8WA 4CJCA 3PKQA 5IDTA 3T7NA 5CMHA 1W57A 3SX8A 3CGXA 2V0IA 4KT7A 2GGQA 1H5TA 2E3DA 3Q4SA 4B4GA 1IIMA 3SXEA 4C2SA 4EE3A 2Z86A 2YQCA 4E1KA 3V91A 4K6RA 5BXCA 5CQMX 1GX0A 1Z90A 4L41C 5C4CA 1H7LA 4AYJA 3RMWA 2Y7AA 5EJZA 1WT1A 4Y6UA 1LVWA 3RSBA 3OH3A 1FR8A 4CVHA 4B2WA 4HO4A 1H7GA 2RJ8A 3D5NA 4P00A 4B5BA 4HO6A 1G93A 1YP2A 4D0TA 2AESA 4HO0A 1H7QA 3U2VA 4FCUA 1FO9A 3V8YA 2UX8A 3O3PA 4M4KA 2RJ6A 4Y7VA 3PKPA 5AJNA 1I52A 4HOCA 3OKRA 1WT3A 1XZ6A 3ST8A 3SXCA 3SX3A 1WVCA 1S4OA 1O23B 5CQOA 1JV1A 3GUEA 5EJ1A 3V0OA 2FYAA 1H5TB 1VZUA 2W0VA 1G95A 4BQHA 1XHBA 2VSIA 2JCLA 2PA4A 1YP4A 2YESA 5C48A 2D7IA 5L6SA 1R7VA 3CKJA 3OH2A 4KXOA 2P6WA 1GA8A 1NQIB 1TVYA 4FRDA 1R7YA 4JISA 5FU8A 1OMXA 4Y7TA 3N9WA 1ZIZA 2D0JA 3T7MA 2FYCB 2AM5A 1O0RA 1TW1A 1NKHB 1JV3A 3R2WA 2Y4MA 3I0FA 4M28A 2WEEA 3U2WA 2AH9A 3R3IA 5AJOA 3CKVA 4FRHA 5EIYA 4G3SA 1ZI3A 3OH0A 4G3PA 3U2XA 5CQLX 2P72A 1JVGA 4KNXA 4AAWA 1H4CA 1ZI1A 5C3BA 2BO7A 4J18A 2WVMA 1LL0A 4ASJA 2XWMA 5FYEA 4EEMA 1G9RA 1ZDFA 5C3DA 2QKXA 1K4VA 1QGQA 2W0WA 3NGWA 2WAWA 4GBPA 2ZU7A 5C4DA 4Y9XA 3OAMA 1OQMB 1H5RA 2WVLA 2JCKA 1H7FA 1H7EA 1HM8A 3HL3A 4KRVA 4EE4A 2ICXA 1VICA 3Q7UA 1HJLA 2X5SA 1VGUA 5FTVA 4FRAA 1G0RA 1GQCA 5CMFX 4CJBA 2VS3A 1ON8A 3DJ4A 1FZWA 5C36A 4EEOA 4R7PA 1YROB 1LL2A 2ZU9A 1G97A 4G87A 4M2AA 3SXBA 1IINA 4B3UA 4D11A 1H5SA 2YCMA 4FRQA 1H7HA 4DE7A 3I0HA 1GQ9A 2FY7A 3ZLLA 2YQSA 1LZIA 3QVBA 4Y63A 1EZIA 1FRWA 1SS9A 2YQJA 2APCA 2P73A 4EEAA 5DDVA 4D0ZA 2X65A 4B42A 4DDZA 4ECMA 1H5RB 3V0NA 1R82A 3D98A 3I0JA 3SX7A 5CQNX 5DDTA 1S4PA 2AM3A 3IOHA 1ZJPA 4KNRA 1LZ7A 3SXAA 4ZDQA 3U0YA 3ZLKA 3ZGFA 2YC3A 2X5ZA 4FRPA 3IOIA 3K8DA 3CKOA 1TW5A 4KQLA 3E25A 4UEGA 4CJ8A 2DPWA 2FFVA 4LW6A 1LZJA 1O7QA 4HG6A 5C38A 1ZCTA 2ZU8A 4AC3A 1JVDA 1H7TA 2Y4JA 1H5SB 1NF5B 5AJPA 2NXVA 4EVWA 3LW6A 1KWSA 2OI7A 2Z87A 4HCQA 1EYRA 2VSHA 1FXOA 5J49A 1H4DA 2O1GA 5CMJA 2VXLA 4KC1A
chains in the Genus database with same CATH superfamily
3V0MA 2RJ7A 4JD0A 2VD4A 1VGTA 4D11C 1FO8A 1INJA 1FGGA 4KC2A 4MYBA 1G3LA 2RJ9A 5FUHA 4NAIA 3JUKA 3OC9A 5C49A 3KIAA 4ARWA 2RJ5A 2FYBA 4HO8A 1MP5A 4EE5A 3SXGA 1VPAA 1ZJ1A 5IDSA 2XMEA 1ZJ0A 2RJ1A 4Q7CA 1VH3A 4IRQA 1HJJA 2XWNA 3CKNA 2BO8A 2J0BA 5C4FA 2V0KA 2OEFA 1WSZA 2RITA 1VGZA 4DECA 5FU0A 2X60A 1ZCUA 2V0HA 1R80A 2YQHA 1QGSA 2O1HA 2OI6A 3V90A 1R7TA 2PGYA 1ZHJA 2AM4A 2V0JA 2MZBA 2Y6PA 2PX7A 2RJ0A 5CMIA 1ZCYA 2FFUA 2I7BA 3IOJA 4Y64A 1QG8A 1R7XA 4FRBA 3ZGGA 2RIXA 3OH1A 1ZI4A 1LZ0A 5HS2A 2YC5A 2AE7A 2Y4LA 4FREA 1G8OA 3BCVA 4HO3A 1FGXA 1QWJA 3JUJA 1ZJ3A 4FROA 3SXDA 3I0KA 3TZTA 1WT2A 1MP4A 2VS4A 3I0IX 2QGIA 1ZJ2A 1FXJA 4AYLA 2VS5A 5FV9A 2AGDA 1G2VA 2RJ4A 1GWVA 5C4BA 1NMMB 2Q4JA 3V0QA 3ZF8A 4O6MA 2O1FA 1V84A 2CU2A 5JQQA 4BMAA 5FTSA 3RMVA 3I0CA 2BO4A 1V82A 4HO5A 3I0GA 3I0DA 2VFZA 2AECA 3T7OA 1MC3A 5C3AA 4EEGA 4NANA 2WE9A 2OEGA 1NHEB 2I5EA 4Y7FA 2D7RA 3OH4A 1W55A 3E26A 5C1LA 3FOQA 4MNDA 4FRMA 1H5SD 3SX5A 4HO9A 2QH5A 2VXMA 2JCOA 1VGWA 4Y7GA 3OGZA 1VZTA 4FQWA 3U2TA 1YP3A 1VM8A 2RIZA 5C1GA 2ICYA 4FCEA 3CKQA 4B2XA 1W77A 2WVKA 3TQDA 1HV9A 1ZJOA 2GGOA 3PNNA 3U0XA 1PZTA 3I0LA 5C1HA 1S4NA 1G23A 1TZFA 2OI5A 1V83A 1ZCVA 5C4EA 1JYKA 3F1YA 5CQPA 3D8VA 1R81A 1VZXA 3F1CA 5D92A 3SPTA 1H5SC 4ASYA 1MP3A 4G3QA 4B4BA 3USRA 3CU0A 4KC4A 3U2UA 1ZI5A 4NAKA 5C8RA 1INIA 1R7UA 2XMHA 3JTJA 4FIXA 3EE5A 1GWWA 1GX4A 3I0EA 2E8BA 4P02A 1FG5N 2V0LA 1H3MA 2I5KA 5I1FA 1HM0A 4Y62A 1FOAA 1JYLA 2JCJA 1E5KA 4YS8A 4XWIA 2RIYA 4B4MA 4KPZA 1ZDGA 4M2BA 3V0PA 2FYDB 1FR9A 2XWLA 3Q80A 1FWYA 2WGZA 3V0LA 1WT0A 1G1LA 1PZYB 3FWWA 4NALA 5L6VA 3USQA 1VH1A 3DK5A 3V8ZA 2A8UA 3POLA 2BO6A 4D48A 1NWGB 2J0AA 2Y4KA 4IRPA 4LW3A 5C47A 1LL3A 1ON6A 4HO2A 4Y6NA 2PGVA 5CMGX 1HM9A 3K8EA 4KPXA 3DUVA 1O7OA 4Y7UA 4FRLA 1OMZA 5IFYA 1H4EA 3BRKX 2A8WA 4CJCA 3PKQA 5IDTA 3T7NA 5CMHA 1W57A 3SX8A 3CGXA 2V0IA 4KT7A 2GGQA 1H5TA 2E3DA 3Q4SA 4B4GA 1IIMA 3SXEA 4C2SA 4EE3A 2Z86A 2YQCA 4E1KA 3V91A 4K6RA 5BXCA 5CQMX 1GX0A 1Z90A 4L41C 5C4CA 1H7LA 4MIXA 4AYJA 3RMWA 2Y7AA 5EJZA 1WT1A 4Y6UA 1LVWA 2VK9A 3RSBA 3OH3A 1FR8A 4CVHA 4B2WA 4HO4A 1H7GA 2RJ8A 3D5NA 4P00A 4B5BA 4HO6A 1G93A 1YP2A 4D0TA 2AESA 4HO0A 1H7QA 3U2VA 4FCUA 1FO9A 3V8YA 2UX8A 3O3PA 4M4KA 2RJ6A 4Y7VA 3PKPA 5AJNA 1I52A 4HOCA 3OKRA 1WT3A 1XZ6A 3ST8A 3SXCA 3SX3A 1WVCA 4FIYA 1S4OA 1O23B 5CQOA 1JV1A 3GUEA 5EJ1A 3V0OA 2FYAA 1H5TB 1VZUA 2W0VA 1G95A 4BQHA 1XHBA 2VSIA 2JCLA 2PA4A 1YP4A 2YESA 5C48A 2D7IA 5L6SA 1R7VA 3CKJA 3OH2A 4KXOA 2P6WA 1GA8A 1NQIB 1TVYA 4FRDA 1R7YA 4JISA 5FU8A 1OMXA 4Y7TA 3N9WA 1ZIZA 2D0JA 3T7MA 2FYCB 2AM5A 1O0RA 1TW1A 1NKHB 1JV3A 3R2WA 2Y4MA 3I0FA 4M28A 2WEEA 3U2WA 2AH9A 3R3IA 5AJOA 3CKVA 4FRHA 5EIYA 4O6NA 4G3SA 1ZI3A 3OH0A 4G3PA 3U2XA 5CQLX 2P72A 1JVGA 4KNXA 4AAWA 1H4CA 1ZI1A 5C3BA 2BO7A 4J18A 2WVMA 1LL0A 4ASJA 2XWMA 5FYEA 4EEMA 1G9RA 1ZDFA 5C3DA 2QKXA 1K4VA 1QGQA 2W0WA 3NGWA 2WAWA 4GBPA 2ZU7A 5C4DA 4Y9XA 3OAMA 1OQMB 1H5RA 2WVLA 2JCKA 1H7FA 1H7EA 1HM8A 3HL3A 4KRVA 4EE4A 2ICXA 1VICA 3Q7UA 1HJLA 2X5SA 1VGUA 5FTVA 4FRAA 1G0RA 1GQCA 5CMFX 4CJBA 2VS3A 1ON8A 3DJ4A 1FZWA 5C36A 4EEOA 4R7PA 1YROB 1LL2A 2ZU9A 1G97A 4G87A 4M2AA 3SXBA 1IINA 4B3UA 4D11A 1H5SA 2YCMA 4FRQA 1H7HA 4DE7A 3I0HA 1GQ9A 2FY7A 3ZLLA 2YQSA 1LZIA 3QVBA 4Y63A 1EZIA 1FRWA 1SS9A 2YQJA 2APCA 2C0NA 2P73A 4EEAA 5DDVA 4D0ZA 2X65A 4B42A 4DDZA 4ECMA 1H5RB 3V0NA 1R82A 3D98A 3I0JA 3SX7A 5CQNX 5DDTA 1S4PA 2AM3A 3IOHA 5D91A 1ZJPA 4KNRA 1LZ7A 3SXAA 4ZDQA 3U0YA 3ZLKA 3ZGFA 2YC3A 2X5ZA 4FRPA 3IOIA 3K8DA 3CKOA 1TW5A 4KQLA 3E25A 4UEGA 4CJ8A 2DPWA 2FFVA 4LW6A 1LZJA 1O7QA 4HG6A 5C38A 1ZCTA 2ZU8A 4AC3A 1JVDA 1H7TA 2Y4JA 1H5SB 1NF5B 5AJPA 2NXVA 4EVWA 3LW6A 1KWSA 2OI7A 2Z87A 4HCQA 1EYRA 2VSHA 1FXOA 5J49A 1H4DA 2O1GA 5CMJA 2VXLA 4KC1A
chains in the Genus database with same CATH topology
3V0MA 2RJ7A 4JD0A 2VD4A 1VGTA 4D11C 1FO8A 1INJA 1FGGA 4KC2A 4MYBA 1G3LA 2RJ9A 5FUHA 4NAIA 3JUKA 3OC9A 5C49A 3KIAA 4ARWA 2RJ5A 2FYBA 4HO8A 1MP5A 4EE5A 3SXGA 1VPAA 1ZJ1A 5IDSA 2XMEA 1ZJ0A 2RJ1A 4Q7CA 1VH3A 4IRQA 1HJJA 2XWNA 3CKNA 2BO8A 2J0BA 5C4FA 2V0KA 2OEFA 1WSZA 2RITA 1VGZA 4DECA 5FU0A 2X60A 1ZCUA 2V0HA 1R80A 2YQHA 1QGSA 2O1HA 2OI6A 3V90A 1R7TA 2PGYA 1ZHJA 2AM4A 2V0JA 2MZBA 2Y6PA 2PX7A 2RJ0A 5CMIA 1ZCYA 2FFUA 2I7BA 3IOJA 4Y64A 1QG8A 1R7XA 4FRBA 3ZGGA 2RIXA 3OH1A 1ZI4A 1LZ0A 5HS2A 2YC5A 2AE7A 2Y4LA 4FREA 1G8OA 3BCVA 4HO3A 1FGXA 1QWJA 3JUJA 1ZJ3A 4FROA 3SXDA 3I0KA 3TZTA 1WT2A 1MP4A 2VS4A 3I0IX 2QGIA 1ZJ2A 1FXJA 4AYLA 2VS5A 5FV9A 2AGDA 1G2VA 2RJ4A 1GWVA 5C4BA 1NMMB 2Q4JA 3V0QA 3ZF8A 4O6MA 2O1FA 1V84A 2CU2A 5JQQA 4BMAA 5FTSA 3RMVA 3I0CA 2BO4A 1V82A 4HO5A 3I0GA 3I0DA 2VFZA 2AECA 3T7OA 1MC3A 5C3AA 4EEGA 4NANA 2WE9A 2OEGA 1NHEB 2I5EA 4Y7FA 2D7RA 3OH4A 1W55A 3E26A 5C1LA 3FOQA 4MNDA 4FRMA 1H5SD 3SX5A 4HO9A 2QH5A 2VXMA 2JCOA 1VGWA 4Y7GA 3OGZA 1VZTA 4FQWA 3U2TA 1YP3A 1VM8A 2RIZA 5C1GA 2ICYA 4FCEA 3CKQA 4B2XA 1W77A 2WVKA 3TQDA 1HV9A 1ZJOA 2GGOA 3PNNA 3U0XA 1PZTA 3I0LA 5C1HA 1S4NA 1G23A 1TZFA 2OI5A 1V83A 1ZCVA 5C4EA 1JYKA 3F1YA 5CQPA 3D8VA 1R81A 1VZXA 3F1CA 5D92A 3SPTA 1H5SC 4ASYA 1MP3A 4G3QA 4B4BA 3USRA 3CU0A 4KC4A 3U2UA 1ZI5A 4NAKA 5C8RA 1INIA 1R7UA 2XMHA 3JTJA 4FIXA 3EE5A 1GWWA 1GX4A 3I0EA 2E8BA 4P02A 1FG5N 2V0LA 1H3MA 2I5KA 5I1FA 1HM0A 4Y62A 1FOAA 1JYLA 2JCJA 1E5KA 4YS8A 4XWIA 2RIYA 4B4MA 4KPZA 1ZDGA 4M2BA 3V0PA 2FYDB 1FR9A 2XWLA 3Q80A 1FWYA 2WGZA 3V0LA 1WT0A 1G1LA 1PZYB 3FWWA 4NALA 5L6VA 3USQA 1VH1A 3DK5A 3V8ZA 2A8UA 3POLA 2BO6A 4D48A 1NWGB 2J0AA 2Y4KA 4IRPA 4LW3A 5C47A 1LL3A 1ON6A 4HO2A 4Y6NA 2PGVA 5CMGX 1HM9A 3K8EA 4KPXA 3DUVA 1O7OA 4Y7UA 4FRLA 1OMZA 5IFYA 1H4EA 3BRKX 2A8WA 4CJCA 3PKQA 5IDTA 3T7NA 5CMHA 1W57A 3SX8A 3CGXA 2V0IA 4KT7A 2GGQA 1H5TA 2E3DA 3Q4SA 4B4GA 1IIMA 3SXEA 4C2SA 4EE3A 2Z86A 2YQCA 4E1KA 3V91A 4K6RA 5BXCA 5CQMX 1GX0A 1Z90A 4L41C 5C4CA 1H7LA 4MIXA 4AYJA 3RMWA 2Y7AA 5EJZA 1WT1A 4Y6UA 1LVWA 2VK9A 3RSBA 3OH3A 1FR8A 4CVHA 4B2WA 4HO4A 1H7GA 2RJ8A 3D5NA 4P00A 4B5BA 4HO6A 1G93A 1YP2A 4D0TA 2AESA 4HO0A 1H7QA 3U2VA 4FCUA 1FO9A 3V8YA 2UX8A 3O3PA 4M4KA 2RJ6A 4Y7VA 3PKPA 5AJNA 1I52A 4HOCA 3OKRA 1WT3A 1XZ6A 3ST8A 3SXCA 3SX3A 1WVCA 4FIYA 1S4OA 1O23B 5CQOA 1JV1A 3GUEA 5EJ1A 3V0OA 2FYAA 1H5TB 1VZUA 2W0VA 1G95A 4BQHA 1XHBA 2VSIA 2JCLA 2PA4A 1YP4A 2YESA 5C48A 2D7IA 5L6SA 1R7VA 3CKJA 3OH2A 4KXOA 2P6WA 1GA8A 1NQIB 1TVYA 4FRDA 1R7YA 4JISA 5FU8A 1OMXA 4Y7TA 3N9WA 1ZIZA 2D0JA 3T7MA 2FYCB 2AM5A 1O0RA 1TW1A 1NKHB 1JV3A 3R2WA 2Y4MA 3I0FA 4M28A 2WEEA 3U2WA 2AH9A 3R3IA 5AJOA 3CKVA 4FRHA 5EIYA 4O6NA 4G3SA 1ZI3A 3OH0A 4G3PA 3U2XA 5CQLX 2P72A 1JVGA 4KNXA 4AAWA 1H4CA 1ZI1A 5C3BA 2BO7A 4J18A 2WVMA 1LL0A 4ASJA 2XWMA 5FYEA 4EEMA 1G9RA 1ZDFA 5C3DA 2QKXA 1K4VA 1QGQA 2W0WA 3NGWA 2WAWA 4GBPA 2ZU7A 5C4DA 4Y9XA 3OAMA 1OQMB 1H5RA 2WVLA 2JCKA 1H7FA 1H7EA 1HM8A 3HL3A 4KRVA 4EE4A 2ICXA 1VICA 3Q7UA 1HJLA 2X5SA 1VGUA 5FTVA 4FRAA 1G0RA 1GQCA 5CMFX 4CJBA 2VS3A 1ON8A 3DJ4A 1FZWA 5C36A 4EEOA 4R7PA 1YROB 1LL2A 2ZU9A 1G97A 4G87A 4M2AA 3SXBA 1IINA 4B3UA 4D11A 1H5SA 2YCMA 4FRQA 1H7HA 4DE7A 3I0HA 1GQ9A 2FY7A 3ZLLA 2YQSA 1LZIA 3QVBA 4Y63A 1EZIA 1FRWA 1SS9A 2YQJA 2APCA 2C0NA 2P73A 4EEAA 5DDVA 4D0ZA 2X65A 4B42A 4DDZA 4ECMA 1H5RB 3V0NA 1R82A 3D98A 3I0JA 3SX7A 5CQNX 5DDTA 1S4PA 2AM3A 3IOHA 5D91A 1ZJPA 4KNRA 1LZ7A 3SXAA 4ZDQA 3U0YA 3ZLKA 3ZGFA 2YC3A 2X5ZA 4FRPA 3IOIA 3K8DA 3CKOA 1TW5A 4KQLA 3E25A 4UEGA 4CJ8A 2DPWA 2FFVA 4LW6A 1LZJA 1O7QA 4HG6A 5C38A 1ZCTA 2ZU8A 4AC3A 1JVDA 1H7TA 2Y4JA 1H5SB 1NF5B 5AJPA 2NXVA 4EVWA 3LW6A 1KWSA 2OI7A 2Z87A 4HCQA 1EYRA 2VSHA 1FXOA 5J49A 1H4DA 2O1GA 5CMJA 2VXLA 4KC1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V0M A;  2RJ7 A;  4JD0 A;  2VD4 A;  1VGT A;  4D11 C;  1FO8 A;  1INJ A;  1FGG A;  4KC2 A;  4MYB A;  1G3L A;  2RJ9 A;  5FUH A;  4NAI A;  3JUK A;  3OC9 A;  5C49 A;  3KIA A;  4ARW A;  2RJ5 A;  2FYB A;  4HO8 A;  1MP5 A;  4EE5 A;  3SXG A;  1VPA A;  1ZJ1 A;  5IDS A;  2XME A;  1ZJ0 A;  2RJ1 A;  1VH3 A;  4IRQ A;  1HJJ A;  2XWN A;  3CKN A;  2BO8 A;  5C4F A;  2V0K A;  2OEF A;  1WSZ A;  2RIT A;  1VGZ A;  4DEC A;  5FU0 A;  2X60 A;  1ZCU A;  2V0H A;  1R80 A;  2YQH A;  1QGS A;  2O1H A;  2OI6 A;  3V90 A;  1R7T A;  2PGY A;  1ZHJ A;  2AM4 A;  2V0J A;  2MZB A;  2Y6P A;  2PX7 A;  2RJ0 A;  5CMI A;  1ZCY A;  2FFU A;  2I7B A;  3IOJ A;  4Y64 A;  1QG8 A;  1R7X A;  4FRB A;  3ZGG A;  2RIX A;  3OH1 A;  1ZI4 A;  1LZ0 A;  5HS2 A;  2YC5 A;  2AE7 A;  2Y4L A;  4FRE A;  1G8O A;  3BCV A;  4HO3 A;  1FGX A;  1QWJ A;  3JUJ A;  1ZJ3 A;  4FRO A;  3SXD A;  3I0K A;  3TZT A;  1WT2 A;  1MP4 A;  2VS4 A;  3I0I X;  2QGI A;  1ZJ2 A;  1FXJ A;  4AYL A;  2VS5 A;  5FV9 A;  2AGD A;  1G2V A;  2RJ4 A;  1GWV A;  5C4B A;  1NMM B;  2Q4J A;  3V0Q A;  3ZF8 A;  2O1F A;  1V84 A;  2CU2 A;  5JQQ A;  4BMA A;  5FTS A;  3RMV A;  3I0C A;  2BO4 A;  1V82 A;  4HO5 A;  3I0G A;  3I0D A;  2VFZ A;  2AEC A;  3T7O A;  1MC3 A;  5C3A A;  4EEG A;  4NAN A;  2WE9 A;  2OEG A;  1NHE B;  2I5E A;  4Y7F A;  2D7R A;  3OH4 A;  1W55 A;  3E26 A;  5C1L A;  3FOQ A;  4MND A;  4FRM A;  1H5S D;  3SX5 A;  4HO9 A;  2QH5 A;  2VXM A;  2JCO A;  1VGW A;  4Y7G A;  3OGZ A;  1VZT A;  4FQW A;  3U2T A;  1YP3 A;  1VM8 A;  2RIZ A;  5C1G A;  2ICY A;  4FCE A;  3CKQ A;  4B2X A;  1W77 A;  2WVK A;  3TQD A;  1HV9 A;  1ZJO A;  2GGO A;  3PNN A;  3U0X A;  1PZT A;  3I0L A;  5C1H A;  1S4N A;  1G23 A;  1TZF A;  2OI5 A;  1V83 A;  1ZCV A;  5C4E A;  1JYK A;  3F1Y A;  5CQP A;  3D8V A;  1R81 A;  1VZX A;  3F1C A;  3SPT A;  1H5S C;  4ASY A;  1MP3 A;  4G3Q A;  4B4B A;  3USR A;  3CU0 A;  4KC4 A;  3U2U A;  1ZI5 A;  4NAK A;  5C8R A;  1INI A;  1R7U A;  2XMH A;  3JTJ A;  3EE5 A;  1GWW A;  1GX4 A;  3I0E A;  2E8B A;  4P02 A;  1FG5 N;  2V0L A;  1H3M A;  2I5K A;  5I1F A;  1HM0 A;  4Y62 A;  1FOA A;  1JYL A;  2JCJ A;  1E5K A;  4YS8 A;  4XWI A;  2RIY A;  4B4M A;  4KPZ A;  1ZDG A;  4M2B A;  3V0P A;  2FYD B;  1FR9 A;  2XWL A;  3Q80 A;  1FWY A;  2WGZ A;  3V0L A;  1WT0 A;  1G1L A;  1PZY B;  3FWW A;  4NAL A;  5L6V A;  3USQ A;  1VH1 A;  3DK5 A;  3V8Z A;  2A8U A;  3POL A;  2BO6 A;  4D48 A;  1NWG B;  2Y4K A;  4IRP A;  4LW3 A;  5C47 A;  1LL3 A;  1ON6 A;  4HO2 A;  4Y6N A;  2PGV A;  5CMG X;  1HM9 A;  3K8E A;  4KPX A;  3DUV A;  1O7O A;  4Y7U A;  4FRL A;  1OMZ A;  5IFY A;  1H4E A;  3BRK X;  2A8W A;  4CJC A;  3PKQ A;  5IDT A;  3T7N A;  5CMH A;  1W57 A;  3SX8 A;  3CGX A;  2V0I A;  4KT7 A;  2GGQ A;  1H5T A;  2E3D A;  3Q4S A;  4B4G A;  1IIM A;  3SXE A;  4C2S A;  4EE3 A;  2Z86 A;  2YQC A;  4E1K A;  3V91 A;  4K6R A;  5BXC A;  5CQM X;  1GX0 A;  1Z90 A;  4L41 C;  5C4C A;  1H7L A;  4AYJ A;  3RMW A;  2Y7A A;  5EJZ A;  1WT1 A;  4Y6U A;  1LVW A;  3RSB A;  3OH3 A;  1FR8 A;  4CVH A;  4B2W A;  4HO4 A;  1H7G A;  2RJ8 A;  3D5N A;  4P00 A;  4B5B A;  4HO6 A;  1G93 A;  1YP2 A;  4D0T A;  2AES A;  4HO0 A;  1H7Q A;  3U2V A;  4FCU A;  1FO9 A;  3V8Y A;  2UX8 A;  3O3P A;  4M4K A;  2RJ6 A;  4Y7V A;  3PKP A;  5AJN A;  1I52 A;  4HOC A;  3OKR A;  1WT3 A;  1XZ6 A;  3ST8 A;  3SXC A;  3SX3 A;  1WVC A;  1S4O A;  1O23 B;  5CQO A;  1JV1 A;  3GUE A;  5EJ1 A;  3V0O A;  2FYA A;  1H5T B;  1VZU A;  2W0V A;  1G95 A;  4BQH A;  1XHB A;  2VSI A;  2JCL A;  2PA4 A;  1YP4 A;  2YES A;  5C48 A;  2D7I A;  5L6S A;  1R7V A;  3CKJ A;  3OH2 A;  4KXO A;  2P6W A;  1GA8 A;  1NQI B;  1TVY A;  4FRD A;  1R7Y A;  4JIS A;  5FU8 A;  1OMX A;  4Y7T A;  3N9W A;  1ZIZ A;  2D0J A;  3T7M A;  2FYC B;  2AM5 A;  1O0R A;  1TW1 A;  1NKH B;  1JV3 A;  3R2W A;  2Y4M A;  3I0F A;  4M28 A;  2WEE A;  3U2W A;  2AH9 A;  3R3I A;  5AJO A;  3CKV A;  4FRH A;  5EIY A;  4G3S A;  1ZI3 A;  3OH0 A;  4G3P A;  3U2X A;  5CQL X;  2P72 A;  1JVG A;  4KNX A;  4AAW A;  1H4C A;  1ZI1 A;  5C3B A;  2BO7 A;  4J18 A;  2WVM A;  1LL0 A;  4ASJ A;  2XWM A;  5FYE A;  4EEM A;  1G9R A;  1ZDF A;  5C3D A;  2QKX A;  1K4V A;  1QGQ A;  2W0W A;  3NGW A;  2WAW A;  4GBP A;  2ZU7 A;  5C4D A;  4Y9X A;  3OAM A;  1OQM B;  1H5R A;  2WVL A;  2JCK A;  1H7F A;  1H7E A;  1HM8 A;  3HL3 A;  4KRV A;  4EE4 A;  2ICX A;  1VIC A;  3Q7U A;  1HJL A;  2X5S A;  1VGU A;  5FTV A;  4FRA A;  1G0R A;  1GQC A;  5CMF X;  4CJB A;  2VS3 A;  1ON8 A;  3DJ4 A;  1FZW A;  5C36 A;  4EEO A;  4R7P A;  1YRO B;  1LL2 A;  2ZU9 A;  1G97 A;  4G87 A;  4M2A A;  3SXB A;  1IIN A;  4B3U A;  4D11 A;  1H5S A;  2YCM A;  4FRQ A;  1H7H A;  4DE7 A;  3I0H A;  1GQ9 A;  2FY7 A;  3ZLL A;  2YQS A;  1LZI A;  3QVB A;  4Y63 A;  1EZI A;  1FRW A;  1SS9 A;  2YQJ A;  2APC A;  2P73 A;  4EEA A;  5DDV A;  4D0Z A;  2X65 A;  4B42 A;  4DDZ A;  4ECM A;  1H5R B;  3V0N A;  1R82 A;  3D98 A;  3I0J A;  3SX7 A;  5CQN X;  5DDT A;  1S4P A;  2AM3 A;  3IOH A;  1ZJP A;  4KNR A;  1LZ7 A;  3SXA A;  4ZDQ A;  3U0Y A;  3ZLK A;  3ZGF A;  2YC3 A;  2X5Z A;  4FRP A;  3IOI A;  3K8D A;  3CKO A;  1TW5 A;  4KQL A;  3E25 A;  4UEG A;  4CJ8 A;  2DPW A;  2FFV A;  4LW6 A;  1LZJ A;  1O7Q A;  4HG6 A;  5C38 A;  1ZCT A;  2ZU8 A;  4AC3 A;  1JVD A;  1H7T A;  2Y4J A;  1H5S B;  1NF5 B;  5AJP A;  2NXV A;  4EVW A;  3LW6 A;  1KWS A;  2OI7 A;  2Z87 A;  4HCQ A;  1EYR A;  2VSH A;  1FXO A;  5J49 A;  1H4D A;  2O1G A;  5CMJ A;  2VXL A;  4KC1 A; 
#chains in the Genus database with same CATH topology
 3V0M A;  2RJ7 A;  4JD0 A;  2VD4 A;  1VGT A;  4D11 C;  1FO8 A;  1INJ A;  1FGG A;  4KC2 A;  4MYB A;  1G3L A;  2RJ9 A;  5FUH A;  4NAI A;  3JUK A;  3OC9 A;  5C49 A;  3KIA A;  4ARW A;  2RJ5 A;  2FYB A;  4HO8 A;  1MP5 A;  4EE5 A;  3SXG A;  1VPA A;  1ZJ1 A;  5IDS A;  2XME A;  1ZJ0 A;  2RJ1 A;  4Q7C A;  1VH3 A;  4IRQ A;  1HJJ A;  2XWN A;  3CKN A;  2BO8 A;  2J0B A;  5C4F A;  2V0K A;  2OEF A;  1WSZ A;  2RIT A;  1VGZ A;  4DEC A;  5FU0 A;  2X60 A;  1ZCU A;  2V0H A;  1R80 A;  2YQH A;  1QGS A;  2O1H A;  2OI6 A;  3V90 A;  1R7T A;  2PGY A;  1ZHJ A;  2AM4 A;  2V0J A;  2MZB A;  2Y6P A;  2PX7 A;  2RJ0 A;  5CMI A;  1ZCY A;  2FFU A;  2I7B A;  3IOJ A;  4Y64 A;  1QG8 A;  1R7X A;  4FRB A;  3ZGG A;  2RIX A;  3OH1 A;  1ZI4 A;  1LZ0 A;  5HS2 A;  2YC5 A;  2AE7 A;  2Y4L A;  4FRE A;  1G8O A;  3BCV A;  4HO3 A;  1FGX A;  1QWJ A;  3JUJ A;  1ZJ3 A;  4FRO A;  3SXD A;  3I0K A;  3TZT A;  1WT2 A;  1MP4 A;  2VS4 A;  3I0I X;  2QGI A;  1ZJ2 A;  1FXJ A;  4AYL A;  2VS5 A;  5FV9 A;  2AGD A;  1G2V A;  2RJ4 A;  1GWV A;  5C4B A;  1NMM B;  2Q4J A;  3V0Q A;  3ZF8 A;  4O6M A;  2O1F A;  1V84 A;  2CU2 A;  5JQQ A;  4BMA A;  5FTS A;  3RMV A;  3I0C A;  2BO4 A;  1V82 A;  4HO5 A;  3I0G A;  3I0D A;  2VFZ A;  2AEC A;  3T7O A;  1MC3 A;  5C3A A;  4EEG A;  4NAN A;  2WE9 A;  2OEG A;  1NHE B;  2I5E A;  4Y7F A;  2D7R A;  3OH4 A;  1W55 A;  3E26 A;  5C1L A;  3FOQ A;  4MND A;  4FRM A;  1H5S D;  3SX5 A;  4HO9 A;  2QH5 A;  2VXM A;  2JCO A;  1VGW A;  4Y7G A;  3OGZ A;  1VZT A;  4FQW A;  3U2T A;  1YP3 A;  1VM8 A;  2RIZ A;  5C1G A;  2ICY A;  4FCE A;  3CKQ A;  4B2X A;  1W77 A;  2WVK A;  3TQD A;  1HV9 A;  1ZJO A;  2GGO A;  3PNN A;  3U0X A;  1PZT A;  3I0L A;  5C1H A;  1S4N A;  1G23 A;  1TZF A;  2OI5 A;  1V83 A;  1ZCV A;  5C4E A;  1JYK A;  3F1Y A;  5CQP A;  3D8V A;  1R81 A;  1VZX A;  3F1C A;  5D92 A;  3SPT A;  1H5S C;  4ASY A;  1MP3 A;  4G3Q A;  4B4B A;  3USR A;  3CU0 A;  4KC4 A;  3U2U A;  1ZI5 A;  4NAK A;  5C8R A;  1INI A;  1R7U A;  2XMH A;  3JTJ A;  4FIX A;  3EE5 A;  1GWW A;  1GX4 A;  3I0E A;  2E8B A;  4P02 A;  1FG5 N;  2V0L A;  1H3M A;  2I5K A;  5I1F A;  1HM0 A;  4Y62 A;  1FOA A;  1JYL A;  2JCJ A;  1E5K A;  4YS8 A;  4XWI A;  2RIY A;  4B4M A;  4KPZ A;  1ZDG A;  4M2B A;  3V0P A;  2FYD B;  1FR9 A;  2XWL A;  3Q80 A;  1FWY A;  2WGZ A;  3V0L A;  1WT0 A;  1G1L A;  1PZY B;  3FWW A;  4NAL A;  5L6V A;  3USQ A;  1VH1 A;  3DK5 A;  3V8Z A;  2A8U A;  3POL A;  2BO6 A;  4D48 A;  1NWG B;  2J0A A;  2Y4K A;  4IRP A;  4LW3 A;  5C47 A;  1LL3 A;  1ON6 A;  4HO2 A;  4Y6N A;  2PGV A;  5CMG X;  1HM9 A;  3K8E A;  4KPX A;  3DUV A;  1O7O A;  4Y7U A;  4FRL A;  1OMZ A;  5IFY A;  1H4E A;  3BRK X;  2A8W A;  4CJC A;  3PKQ A;  5IDT A;  3T7N A;  5CMH A;  1W57 A;  3SX8 A;  3CGX A;  2V0I A;  4KT7 A;  2GGQ A;  1H5T A;  2E3D A;  3Q4S A;  4B4G A;  1IIM A;  3SXE A;  4C2S A;  4EE3 A;  2Z86 A;  2YQC A;  4E1K A;  3V91 A;  4K6R A;  5BXC A;  5CQM X;  1GX0 A;  1Z90 A;  4L41 C;  5C4C A;  1H7L A;  4MIX A;  4AYJ A;  3RMW A;  2Y7A A;  5EJZ A;  1WT1 A;  4Y6U A;  1LVW A;  2VK9 A;  3RSB A;  3OH3 A;  1FR8 A;  4CVH A;  4B2W A;  4HO4 A;  1H7G A;  2RJ8 A;  3D5N A;  4P00 A;  4B5B A;  4HO6 A;  1G93 A;  1YP2 A;  4D0T A;  2AES A;  4HO0 A;  1H7Q A;  3U2V A;  4FCU A;  1FO9 A;  3V8Y A;  2UX8 A;  3O3P A;  4M4K A;  2RJ6 A;  4Y7V A;  3PKP A;  5AJN A;  1I52 A;  4HOC A;  3OKR A;  1WT3 A;  1XZ6 A;  3ST8 A;  3SXC A;  3SX3 A;  1WVC A;  4FIY A;  1S4O A;  1O23 B;  5CQO A;  1JV1 A;  3GUE A;  5EJ1 A;  3V0O A;  2FYA A;  1H5T B;  1VZU A;  2W0V A;  1G95 A;  4BQH A;  1XHB A;  2VSI A;  2JCL A;  2PA4 A;  1YP4 A;  2YES A;  5C48 A;  2D7I A;  5L6S A;  1R7V A;  3CKJ A;  3OH2 A;  4KXO A;  2P6W A;  1GA8 A;  1NQI B;  1TVY A;  4FRD A;  1R7Y A;  4JIS A;  5FU8 A;  1OMX A;  4Y7T A;  3N9W A;  1ZIZ A;  2D0J A;  3T7M A;  2FYC B;  2AM5 A;  1O0R A;  1TW1 A;  1NKH B;  1JV3 A;  3R2W A;  2Y4M A;  3I0F A;  4M28 A;  2WEE A;  3U2W A;  2AH9 A;  3R3I A;  5AJO A;  3CKV A;  4FRH A;  5EIY A;  4O6N A;  4G3S A;  1ZI3 A;  3OH0 A;  4G3P A;  3U2X A;  5CQL X;  2P72 A;  1JVG A;  4KNX A;  4AAW A;  1H4C A;  1ZI1 A;  5C3B A;  2BO7 A;  4J18 A;  2WVM A;  1LL0 A;  4ASJ A;  2XWM A;  5FYE A;  4EEM A;  1G9R A;  1ZDF A;  5C3D A;  2QKX A;  1K4V A;  1QGQ A;  2W0W A;  3NGW A;  2WAW A;  4GBP A;  2ZU7 A;  5C4D A;  4Y9X A;  3OAM A;  1OQM B;  1H5R A;  2WVL A;  2JCK A;  1H7F A;  1H7E A;  1HM8 A;  3HL3 A;  4KRV A;  4EE4 A;  2ICX A;  1VIC A;  3Q7U A;  1HJL A;  2X5S A;  1VGU A;  5FTV A;  4FRA A;  1G0R A;  1GQC A;  5CMF X;  4CJB A;  2VS3 A;  1ON8 A;  3DJ4 A;  1FZW A;  5C36 A;  4EEO A;  4R7P A;  1YRO B;  1LL2 A;  2ZU9 A;  1G97 A;  4G87 A;  4M2A A;  3SXB A;  1IIN A;  4B3U A;  4D11 A;  1H5S A;  2YCM A;  4FRQ A;  1H7H A;  4DE7 A;  3I0H A;  1GQ9 A;  2FY7 A;  3ZLL A;  2YQS A;  1LZI A;  3QVB A;  4Y63 A;  1EZI A;  1FRW A;  1SS9 A;  2YQJ A;  2APC A;  2C0N A;  2P73 A;  4EEA A;  5DDV A;  4D0Z A;  2X65 A;  4B42 A;  4DDZ A;  4ECM A;  1H5R B;  3V0N A;  1R82 A;  3D98 A;  3I0J A;  3SX7 A;  5CQN X;  5DDT A;  1S4P A;  2AM3 A;  3IOH A;  5D91 A;  1ZJP A;  4KNR A;  1LZ7 A;  3SXA A;  4ZDQ A;  3U0Y A;  3ZLK A;  3ZGF A;  2YC3 A;  2X5Z A;  4FRP A;  3IOI A;  3K8D A;  3CKO A;  1TW5 A;  4KQL A;  3E25 A;  4UEG A;  4CJ8 A;  2DPW A;  2FFV A;  4LW6 A;  1LZJ A;  1O7Q A;  4HG6 A;  5C38 A;  1ZCT A;  2ZU8 A;  4AC3 A;  1JVD A;  1H7T A;  2Y4J A;  1H5S B;  1NF5 B;  5AJP A;  2NXV A;  4EVW A;  3LW6 A;  1KWS A;  2OI7 A;  2Z87 A;  4HCQ A;  1EYR A;  2VSH A;  1FXO A;  5J49 A;  1H4D A;  2O1G A;  5CMJ A;  2VXL A;  4KC1 A; 
#chains in the Genus database with same CATH homology
 3V0M A;  2RJ7 A;  4JD0 A;  2VD4 A;  1VGT A;  4D11 C;  1FO8 A;  1INJ A;  1FGG A;  4KC2 A;  4MYB A;  1G3L A;  2RJ9 A;  5FUH A;  4NAI A;  3JUK A;  3OC9 A;  5C49 A;  3KIA A;  4ARW A;  2RJ5 A;  2FYB A;  4HO8 A;  1MP5 A;  4EE5 A;  3SXG A;  1VPA A;  1ZJ1 A;  5IDS A;  2XME A;  1ZJ0 A;  2RJ1 A;  4Q7C A;  1VH3 A;  4IRQ A;  1HJJ A;  2XWN A;  3CKN A;  2BO8 A;  2J0B A;  5C4F A;  2V0K A;  2OEF A;  1WSZ A;  2RIT A;  1VGZ A;  4DEC A;  5FU0 A;  2X60 A;  1ZCU A;  2V0H A;  1R80 A;  2YQH A;  1QGS A;  2O1H A;  2OI6 A;  3V90 A;  1R7T A;  2PGY A;  1ZHJ A;  2AM4 A;  2V0J A;  2MZB A;  2Y6P A;  2PX7 A;  2RJ0 A;  5CMI A;  1ZCY A;  2FFU A;  2I7B A;  3IOJ A;  4Y64 A;  1QG8 A;  1R7X A;  4FRB A;  3ZGG A;  2RIX A;  3OH1 A;  1ZI4 A;  1LZ0 A;  5HS2 A;  2YC5 A;  2AE7 A;  2Y4L A;  4FRE A;  1G8O A;  3BCV A;  4HO3 A;  1FGX A;  1QWJ A;  3JUJ A;  1ZJ3 A;  4FRO A;  3SXD A;  3I0K A;  3TZT A;  1WT2 A;  1MP4 A;  2VS4 A;  3I0I X;  2QGI A;  1ZJ2 A;  1FXJ A;  4AYL A;  2VS5 A;  5FV9 A;  2AGD A;  1G2V A;  2RJ4 A;  1GWV A;  5C4B A;  1NMM B;  2Q4J A;  3V0Q A;  3ZF8 A;  4O6M A;  2O1F A;  1V84 A;  2CU2 A;  5JQQ A;  4BMA A;  5FTS A;  3RMV A;  3I0C A;  2BO4 A;  1V82 A;  4HO5 A;  3I0G A;  3I0D A;  2VFZ A;  2AEC A;  3T7O A;  1MC3 A;  5C3A A;  4EEG A;  4NAN A;  2WE9 A;  2OEG A;  1NHE B;  2I5E A;  4Y7F A;  2D7R A;  3OH4 A;  1W55 A;  3E26 A;  5C1L A;  3FOQ A;  4MND A;  4FRM A;  1H5S D;  3SX5 A;  4HO9 A;  2QH5 A;  2VXM A;  2JCO A;  1VGW A;  4Y7G A;  3OGZ A;  1VZT A;  4FQW A;  3U2T A;  1YP3 A;  1VM8 A;  2RIZ A;  5C1G A;  2ICY A;  4FCE A;  3CKQ A;  4B2X A;  1W77 A;  2WVK A;  3TQD A;  1HV9 A;  1ZJO A;  2GGO A;  3PNN A;  3U0X A;  1PZT A;  3I0L A;  5C1H A;  1S4N A;  1G23 A;  1TZF A;  2OI5 A;  1V83 A;  1ZCV A;  5C4E A;  1JYK A;  3F1Y A;  5CQP A;  3D8V A;  1R81 A;  1VZX A;  3F1C A;  5D92 A;  3SPT A;  1H5S C;  4ASY A;  1MP3 A;  4G3Q A;  4B4B A;  3USR A;  3CU0 A;  4KC4 A;  3U2U A;  1ZI5 A;  4NAK A;  5C8R A;  1INI A;  1R7U A;  2XMH A;  3JTJ A;  4FIX A;  3EE5 A;  1GWW A;  1GX4 A;  3I0E A;  2E8B A;  4P02 A;  1FG5 N;  2V0L A;  1H3M A;  2I5K A;  5I1F A;  1HM0 A;  4Y62 A;  1FOA A;  1JYL A;  2JCJ A;  1E5K A;  4YS8 A;  4XWI A;  2RIY A;  4B4M A;  4KPZ A;  1ZDG A;  4M2B A;  3V0P A;  2FYD B;  1FR9 A;  2XWL A;  3Q80 A;  1FWY A;  2WGZ A;  3V0L A;  1WT0 A;  1G1L A;  1PZY B;  3FWW A;  4NAL A;  5L6V A;  3USQ A;  1VH1 A;  3DK5 A;  3V8Z A;  2A8U A;  3POL A;  2BO6 A;  4D48 A;  1NWG B;  2J0A A;  2Y4K A;  4IRP A;  4LW3 A;  5C47 A;  1LL3 A;  1ON6 A;  4HO2 A;  4Y6N A;  2PGV A;  5CMG X;  1HM9 A;  3K8E A;  4KPX A;  3DUV A;  1O7O A;  4Y7U A;  4FRL A;  1OMZ A;  5IFY A;  1H4E A;  3BRK X;  2A8W A;  4CJC A;  3PKQ A;  5IDT A;  3T7N A;  5CMH A;  1W57 A;  3SX8 A;  3CGX A;  2V0I A;  4KT7 A;  2GGQ A;  1H5T A;  2E3D A;  3Q4S A;  4B4G A;  1IIM A;  3SXE A;  4C2S A;  4EE3 A;  2Z86 A;  2YQC A;  4E1K A;  3V91 A;  4K6R A;  5BXC A;  5CQM X;  1GX0 A;  1Z90 A;  4L41 C;  5C4C A;  1H7L A;  4MIX A;  4AYJ A;  3RMW A;  2Y7A A;  5EJZ A;  1WT1 A;  4Y6U A;  1LVW A;  2VK9 A;  3RSB A;  3OH3 A;  1FR8 A;  4CVH A;  4B2W A;  4HO4 A;  1H7G A;  2RJ8 A;  3D5N A;  4P00 A;  4B5B A;  4HO6 A;  1G93 A;  1YP2 A;  4D0T A;  2AES A;  4HO0 A;  1H7Q A;  3U2V A;  4FCU A;  1FO9 A;  3V8Y A;  2UX8 A;  3O3P A;  4M4K A;  2RJ6 A;  4Y7V A;  3PKP A;  5AJN A;  1I52 A;  4HOC A;  3OKR A;  1WT3 A;  1XZ6 A;  3ST8 A;  3SXC A;  3SX3 A;  1WVC A;  4FIY A;  1S4O A;  1O23 B;  5CQO A;  1JV1 A;  3GUE A;  5EJ1 A;  3V0O A;  2FYA A;  1H5T B;  1VZU A;  2W0V A;  1G95 A;  4BQH A;  1XHB A;  2VSI A;  2JCL A;  2PA4 A;  1YP4 A;  2YES A;  5C48 A;  2D7I A;  5L6S A;  1R7V A;  3CKJ A;  3OH2 A;  4KXO A;  2P6W A;  1GA8 A;  1NQI B;  1TVY A;  4FRD A;  1R7Y A;  4JIS A;  5FU8 A;  1OMX A;  4Y7T A;  3N9W A;  1ZIZ A;  2D0J A;  3T7M A;  2FYC B;  2AM5 A;  1O0R A;  1TW1 A;  1NKH B;  1JV3 A;  3R2W A;  2Y4M A;  3I0F A;  4M28 A;  2WEE A;  3U2W A;  2AH9 A;  3R3I A;  5AJO A;  3CKV A;  4FRH A;  5EIY A;  4O6N A;  4G3S A;  1ZI3 A;  3OH0 A;  4G3P A;  3U2X A;  5CQL X;  2P72 A;  1JVG A;  4KNX A;  4AAW A;  1H4C A;  1ZI1 A;  5C3B A;  2BO7 A;  4J18 A;  2WVM A;  1LL0 A;  4ASJ A;  2XWM A;  5FYE A;  4EEM A;  1G9R A;  1ZDF A;  5C3D A;  2QKX A;  1K4V A;  1QGQ A;  2W0W A;  3NGW A;  2WAW A;  4GBP A;  2ZU7 A;  5C4D A;  4Y9X A;  3OAM A;  1OQM B;  1H5R A;  2WVL A;  2JCK A;  1H7F A;  1H7E A;  1HM8 A;  3HL3 A;  4KRV A;  4EE4 A;  2ICX A;  1VIC A;  3Q7U A;  1HJL A;  2X5S A;  1VGU A;  5FTV A;  4FRA A;  1G0R A;  1GQC A;  5CMF X;  4CJB A;  2VS3 A;  1ON8 A;  3DJ4 A;  1FZW A;  5C36 A;  4EEO A;  4R7P A;  1YRO B;  1LL2 A;  2ZU9 A;  1G97 A;  4G87 A;  4M2A A;  3SXB A;  1IIN A;  4B3U A;  4D11 A;  1H5S A;  2YCM A;  4FRQ A;  1H7H A;  4DE7 A;  3I0H A;  1GQ9 A;  2FY7 A;  3ZLL A;  2YQS A;  1LZI A;  3QVB A;  4Y63 A;  1EZI A;  1FRW A;  1SS9 A;  2YQJ A;  2APC A;  2C0N A;  2P73 A;  4EEA A;  5DDV A;  4D0Z A;  2X65 A;  4B42 A;  4DDZ A;  4ECM A;  1H5R B;  3V0N A;  1R82 A;  3D98 A;  3I0J A;  3SX7 A;  5CQN X;  5DDT A;  1S4P A;  2AM3 A;  3IOH A;  5D91 A;  1ZJP A;  4KNR A;  1LZ7 A;  3SXA A;  4ZDQ A;  3U0Y A;  3ZLK A;  3ZGF A;  2YC3 A;  2X5Z A;  4FRP A;  3IOI A;  3K8D A;  3CKO A;  1TW5 A;  4KQL A;  3E25 A;  4UEG A;  4CJ8 A;  2DPW A;  2FFV A;  4LW6 A;  1LZJ A;  1O7Q A;  4HG6 A;  5C38 A;  1ZCT A;  2ZU8 A;  4AC3 A;  1JVD A;  1H7T A;  2Y4J A;  1H5S B;  1NF5 B;  5AJP A;  2NXV A;  4EVW A;  3LW6 A;  1KWS A;  2OI7 A;  2Z87 A;  4HCQ A;  1EYR A;  2VSH A;  1FXO A;  5J49 A;  1H4D A;  2O1G A;  5CMJ A;  2VXL A;  4KC1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...