4B4MA

Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
300
structure length
296
Chain Sequence
HHHMKRKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLGSASQRQTGASVFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIATLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLLTETVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
publication title Allosteric competitive inhibitors of the glucose-1-phosphate thymidylyltransferase (RmlA) from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 95
structure length 296
sequence length 300
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.74: 1L-myo-inositol 1-phosphate cytidylyltransferase.
pdb deposition date 2012-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4b4mA00
3CKNA 2FYAA 3PNNA 3I0KA 2PA4A 1HM0A 1S4PA 1MP3A 1VZUA 5FYEA 2YQCA 1R7TA 2RJ6A 1JV1A 3Q80A 4Y62A 5I1FA 3Q7UA 5C1GA 2VD4A 1H5SD 1FR8A 2XMHA 1XZ6A 2VXMA 1H7EA 2Y6PA 2OEFA 1MC3A 1VGZA 4DE7A 4EVWA 2OEGA 1YP2A 1ZJPA 1VICA 1VM8A 1NMMB 2Y4MA 5DDTA 1H7LA 4FRBA 2E3DA 2O1HA 3I0HA 2YC5A 1O7OA 3U0YA 1LL3A 1G97A 1R7UA 4B2XA 1ZCUA 4AYLA 2BO8A 4HCQA 4Y7FA 2WVLA 3HL3A 4EE5A 5IDSA 4XWIA 4AYJA 4D0ZA 1S4NA 1O23B 2GGQA 5C4CA 2D7RA 3CKQA 2ICXA 1LZ7A 2QKXA 2WE9A 4FRAA 4M4KA 3FOQA 3SPTA 1LZ0A 2OI5A 1V84A 5HS2A 1H5SB 1WT1A 1VZTA 4D11A 1I52A 2AM3A 1QGSA 2BO7A 2PX7A 4KNRA 2PGVA 4GBPA 2WEEA 3U0XA 4KPXA 3O3PA 1LZIA 3CKJA 1MP4A 1E5KA 2X5SA 3V0PA 3F1CA 3ZGGA 2X5ZA 3SXGA 1FG5N 2BO6A 3I0CA 5AJPA 1ZDGA 3USQA 5CQMX 1R7XA 5C4FA 1WVCA 2RITA 1INJA 3ZF8A 1ZI5A 2RJ0A 4D0TA 3ZLKA 4KC2A 1FO9A 2Y4JA 1PZYB 3CGXA 2AH9A 2AM4A 2E8BA 1G2VA 5CMJA 3OKRA 1R82A 4L41C 5C3BA 3DJ4A 3DK5A 2FY7A 1H7QA 4D48A 3I0LA 4ARWA 1LL0A 2MZBA 2Y4KA 2BO4A 4DECA 4EE4A 4HO0A 1Z90A 3V0NA 4HO2A 1INIA 1GX4A 5CQPA 1NQIB 1G95A 3V0LA 2VSHA 3POLA 3R2WA 1H5SC 1H4EA 1ZJOA 1HJJA 3E25A 4Y6UA 3OH1A 4ASYA 1H5TA 4HO4A 5CQOA 1GX0A 2FYBA 4FQWA 4C2SA 5C49A 2PGYA 4KPZA 2O1FA 4KC1A 5AJNA 4KT7A 2I5KA 4IRPA 1FRWA 1G0RA 2D0JA 5FU0A 4EE3A 4Y7GA 4KXOA 1NWGB 3V0MA 5J49A 3FWWA 5C4DA 2ZU9A 4FRPA 1ZI1A 5BXCA 4BQHA 1SS9A 2FFVA 3U2TA 1FXOA 1PZTA 1ZI3A 2QH5A 4HG6A 1R7YA 3T7OA 1HM8A 2P72A 3SXDA 2Q4JA 1XHBA 2APCA 1G23A 1VGTA 3F1YA 2Y7AA 3LW6A 4P00A 4Y7VA 2NXVA 1EYRA 2AM5A 5CMGX 1JVGA 1VH3A 2RJ5A 1WSZA 4M28A 5CQLX 2I7BA 2AGDA 1LVWA 2JCJA 4ECMA 1WT2A 2O1GA 2WGZA 2Z86A 4FRLA 4CVHA 1FGGA 1R80A 1R7VA 4NAKA 4B2WA 2VS3A 3SXBA 4B4GA 5C4BA 4E1KA 3I0EA 3BRKX 5JQQA 4KRVA 3IOHA 2YQHA 1W77A 3JTJA 4HO6A 4Y63A 3RMWA 3E26A 1FO8A 5FTVA 3I0GA 3V90A 1K4VA 3OH4A 2AECA 5FU8A 1W57A 1QWJA 4HO3A 5CQNX 3D5NA 3IOJA 3OH0A 2JCOA 1OMZA 1WT3A 1JYKA 4HO5A 2WVKA 4NAIA 3GUEA 5FUHA 3V0OA 3SX8A 2ICYA 2RIZA 5C38A 1LZJA 4G3PA 1H4CA 1ZJ3A 5L6VA 1VZXA 3PKQA 2Y4LA 3ZLLA 4LW6A 1O7QA 3U2XA 4AAWA 4Y64A 3SX7A 5C4EA 1ZCVA 5C1LA 1FXJA 2AE7A 1V82A 1NHEB 3EE5A 4Y9XA 3D98A 4ASJA 2XWNA 4B4MA 3SX3A 2RJ9A 5L6SA 1NF5B 4UEGA 3SX5A 1H7HA 1H7TA 2OI7A 1ZCTA 2V0JA 3RMVA 3SXCA 3I0DA 5C8RA 2X60A 1OQMB 1G8OA 4B5BA 1YP3A 1GA8A 1O0RA 1G3LA 1HJLA 4K6RA 1ZHJA 1H5TB 4MYBA 1VGUA 1TW5A 1JV3A 1HV9A 2V0IA 1TVYA 5FTSA 2OI6A 2V0LA 1QG8A 2RJ8A 3Q4SA 4ZDQA 1IIMA 1EZIA 3BCVA 2GGOA 3N9WA 4EEOA 1GWWA 3NGWA 4FREA 1ZI4A 4NANA 4HO8A 1FZWA 1H3MA 1VGWA 2X65A 2ZU7A 3OH2A 4J18A 5C36A 2XWLA 3U2UA 1H5RA 2XMEA 3V8ZA 4FRQA 1ON6A 4EEMA 1ZCYA 4FRHA 5C1HA 3V8YA 1WT0A 3TZTA 4JISA 2YESA 4JD0A 5DDVA 4LW3A 2A8UA 4G87A 2FYDB 5C3AA 2RJ7A 4G3QA 2V0KA 3I0FA 3SXEA 3I0JA 4FCEA 2WAWA 1NKHB 4B3UA 4YS8A 4FROA 2FFUA 2A8WA 4BMAA 4M2BA 2P73A 3V91A 5C3DA 2W0WA 3R3IA 3U2WA 1KWSA 1GWVA 4M2AA 5IDTA 1IINA 4Y7TA 2ZU8A 4G3SA 3USRA 4R7PA 3JUJA 4P02A 2WVMA 4Y7UA 2W0VA 3SXAA 1GQ9A 2VSIA 3KIAA 4FCUA 2RIXA 2P6WA 2JCKA 3QVBA 1ZDFA 4CJBA 4KQLA 2YC3A 1H7FA 2I5EA 5CMHA 1LL2A 4B4BA 2VS5A 3K8DA 3ZGFA 1G9RA 1G93A 2AESA 5C47A 5C48A 3OGZA 2CU2A 3OAMA 1OMXA 1QGQA 3OC9A 1HM9A 4FRMA 3RSBA 2RJ4A 1TW1A 1MP5A 2RIYA 3ST8A 4EEAA 3OH3A 1H7GA 5EIYA 1S4OA 4CJ8A 3T7NA 1H5SA 1GQCA 2RJ1A 2DPWA 2UX8A 1TZFA 1H4DA 2VFZA 3V0QA 1V83A 4MNDA 4AC3A 3PKPA 5FV9A 3T7MA 4HOCA 3CKOA 2XWMA 2YQJA 3K8EA 1ZJ2A 1VH1A 5EJZA 4HO9A 1VPAA 4B42A 1FWYA 1W55A 5CMIA 1FGXA 5EJ1A 2QGIA 1JYLA 4DDZA 2YCMA 1R81A 1FR9A 3CU0A 1ON8A 1ZJ0A 3CKVA 2JCLA 2V0HA 5CMFX 1FOAA 4FRDA 4NALA 5AJOA 3IOIA 4D11C 3DUVA 4IRQA 3I0IX 4KNXA 4CJCA 5IFYA 2YQSA 2Z87A 3U2VA 1ZIZA 3TQDA 1ZJ1A 2VXLA 4Y6NA 3JUKA 4KC4A 3D8VA 1H5RB 2D7IA 1YROB 1YP4A 1G1LA 2VS4A 4EEGA 2FYCB 1JVDA
chains in the Genus database with same CATH superfamily
3CKNA 2FYAA 3PNNA 3I0KA 2PA4A 1HM0A 1S4PA 1MP3A 1VZUA 5FYEA 2YQCA 1R7TA 2RJ6A 1JV1A 3Q80A 4Y62A 5I1FA 3Q7UA 5C1GA 2VD4A 1H5SD 1FR8A 2XMHA 1XZ6A 2VXMA 1H7EA 2Y6PA 2OEFA 1MC3A 1VGZA 4DE7A 4EVWA 2OEGA 1YP2A 1ZJPA 1VICA 1VM8A 1NMMB 2Y4MA 4O6NA 5DDTA 1H7LA 4FRBA 2J0AA 2E3DA 2O1HA 3I0HA 2YC5A 5D91A 1O7OA 3U0YA 4FIYA 1LL3A 1G97A 1R7UA 4B2XA 1ZCUA 4AYLA 2BO8A 4HCQA 4Y7FA 2WVLA 3HL3A 4EE5A 5IDSA 4XWIA 4AYJA 4D0ZA 1S4NA 1O23B 2GGQA 5C4CA 2D7RA 3CKQA 2ICXA 1LZ7A 2QKXA 2WE9A 4FRAA 4M4KA 3FOQA 3SPTA 1LZ0A 2C0NA 2OI5A 1V84A 5HS2A 1H5SB 1WT1A 1VZTA 4D11A 1I52A 2AM3A 1QGSA 2BO7A 2PX7A 4KNRA 2PGVA 4GBPA 2WEEA 3U0XA 4KPXA 3O3PA 1LZIA 3CKJA 1MP4A 1E5KA 2X5SA 3V0PA 3F1CA 3ZGGA 2X5ZA 3SXGA 1FG5N 2BO6A 3I0CA 5AJPA 1ZDGA 3USQA 5CQMX 1R7XA 5C4FA 1WVCA 2RITA 1INJA 3ZF8A 1ZI5A 2RJ0A 4D0TA 3ZLKA 4KC2A 1FO9A 2Y4JA 1PZYB 3CGXA 2AH9A 2AM4A 2E8BA 1G2VA 5CMJA 3OKRA 1R82A 4L41C 5C3BA 3DJ4A 3DK5A 2FY7A 1H7QA 4D48A 3I0LA 4ARWA 2VK9A 1LL0A 2MZBA 2Y4KA 2BO4A 4DECA 4EE4A 4HO0A 2J0BA 1Z90A 3V0NA 4HO2A 1INIA 1GX4A 5CQPA 1NQIB 1G95A 3V0LA 2VSHA 3POLA 3R2WA 1H5SC 1H4EA 1ZJOA 1HJJA 3E25A 4Y6UA 3OH1A 4ASYA 1H5TA 4HO4A 5CQOA 1GX0A 2FYBA 4FQWA 4C2SA 5C49A 2PGYA 4KPZA 2O1FA 4KC1A 5AJNA 4KT7A 2I5KA 4IRPA 1FRWA 1G0RA 2D0JA 5FU0A 4EE3A 4Y7GA 4KXOA 1NWGB 3V0MA 5J49A 3FWWA 5C4DA 2ZU9A 4FIXA 4FRPA 1ZI1A 5BXCA 4BQHA 1SS9A 2FFVA 3U2TA 1FXOA 1PZTA 1ZI3A 2QH5A 4HG6A 1R7YA 3T7OA 1HM8A 2P72A 3SXDA 2Q4JA 1XHBA 2APCA 1G23A 1VGTA 3F1YA 2Y7AA 3LW6A 4P00A 4Y7VA 2NXVA 1EYRA 2AM5A 5CMGX 1JVGA 1VH3A 2RJ5A 1WSZA 4M28A 5CQLX 2I7BA 2AGDA 1LVWA 2JCJA 4ECMA 1WT2A 2O1GA 2WGZA 2Z86A 4FRLA 4CVHA 1FGGA 1R80A 1R7VA 4NAKA 4B2WA 2VS3A 3SXBA 4B4GA 5C4BA 4E1KA 3I0EA 3BRKX 5JQQA 4KRVA 3IOHA 2YQHA 1W77A 3JTJA 4HO6A 4Y63A 3RMWA 3E26A 1FO8A 5FTVA 3I0GA 3V90A 1K4VA 3OH4A 2AECA 5FU8A 1W57A 1QWJA 4HO3A 5CQNX 3D5NA 3IOJA 3OH0A 2JCOA 1OMZA 1WT3A 1JYKA 4HO5A 2WVKA 4NAIA 3GUEA 5FUHA 3V0OA 3SX8A 2ICYA 2RIZA 5C38A 1LZJA 4G3PA 1H4CA 1ZJ3A 5L6VA 1VZXA 3PKQA 2Y4LA 3ZLLA 4LW6A 1O7QA 3U2XA 4AAWA 4Y64A 3SX7A 5C4EA 1ZCVA 5C1LA 1FXJA 2AE7A 1V82A 1NHEB 3EE5A 4Y9XA 3D98A 4ASJA 2XWNA 4B4MA 3SX3A 2RJ9A 5L6SA 1NF5B 4UEGA 3SX5A 1H7HA 1H7TA 2OI7A 1ZCTA 2V0JA 3RMVA 3SXCA 3I0DA 5C8RA 2X60A 1OQMB 1G8OA 4B5BA 1YP3A 1GA8A 1O0RA 1G3LA 1HJLA 4K6RA 1ZHJA 1H5TB 4MYBA 1VGUA 1TW5A 1JV3A 4MIXA 2V0IA 1HV9A 1TVYA 5FTSA 2OI6A 2V0LA 1QG8A 2RJ8A 3Q4SA 4ZDQA 1IIMA 1EZIA 3BCVA 2GGOA 3N9WA 4EEOA 1GWWA 3NGWA 4FREA 1ZI4A 4NANA 4HO8A 1FZWA 1H3MA 1VGWA 2X65A 2ZU7A 3OH2A 4J18A 5C36A 2XWLA 3U2UA 1H5RA 2XMEA 5D92A 3V8ZA 4FRQA 1ON6A 4EEMA 1ZCYA 4FRHA 5C1HA 3V8YA 1WT0A 3TZTA 4JISA 2YESA 4JD0A 5DDVA 4LW3A 2A8UA 4G87A 2FYDB 5C3AA 2RJ7A 4G3QA 2V0KA 3I0FA 3SXEA 3I0JA 4FCEA 2WAWA 1NKHB 4B3UA 4YS8A 4FROA 2FFUA 2A8WA 4BMAA 4M2BA 2P73A 3V91A 5C3DA 2W0WA 3R3IA 3U2WA 1KWSA 1GWVA 4M2AA 5IDTA 1IINA 4Y7TA 4Q7CA 2ZU8A 4G3SA 3USRA 4R7PA 3JUJA 4P02A 2WVMA 4Y7UA 2W0VA 3SXAA 1GQ9A 2VSIA 3KIAA 4FCUA 2RIXA 2P6WA 2JCKA 3QVBA 1ZDFA 4CJBA 4KQLA 2YC3A 1H7FA 2I5EA 5CMHA 1LL2A 4B4BA 2VS5A 3K8DA 3ZGFA 1G9RA 1G93A 2AESA 5C47A 5C48A 3OGZA 2CU2A 3OAMA 1OMXA 1QGQA 3OC9A 1HM9A 4FRMA 3RSBA 2RJ4A 1TW1A 1MP5A 2RIYA 3ST8A 4EEAA 3OH3A 1H7GA 5EIYA 1S4OA 4CJ8A 3T7NA 1H5SA 1GQCA 2RJ1A 2DPWA 2UX8A 1TZFA 1H4DA 2VFZA 3V0QA 1V83A 4MNDA 4AC3A 3PKPA 5FV9A 3T7MA 4HOCA 3CKOA 2XWMA 2YQJA 3K8EA 1ZJ2A 1VH1A 5EJZA 4HO9A 1VPAA 4B42A 1FWYA 1W55A 5CMIA 1FGXA 5EJ1A 2QGIA 1JYLA 4DDZA 2YCMA 1R81A 1FR9A 3CU0A 1ON8A 1ZJ0A 3CKVA 2JCLA 2V0HA 5CMFX 1FOAA 4FRDA 4NALA 5AJOA 3IOIA 4D11C 3DUVA 4IRQA 3I0IX 4KNXA 4CJCA 5IFYA 2YQSA 2Z87A 3U2VA 1ZIZA 3TQDA 1ZJ1A 2VXLA 4Y6NA 3JUKA 4KC4A 3D8VA 4O6MA 1H5RB 2D7IA 1YROB 1YP4A 1G1LA 2VS4A 4EEGA 2FYCB 1JVDA
chains in the Genus database with same CATH topology
3CKNA 2FYAA 3PNNA 3I0KA 2PA4A 1HM0A 1S4PA 1MP3A 1VZUA 5FYEA 2YQCA 1R7TA 2RJ6A 1JV1A 3Q80A 4Y62A 5I1FA 3Q7UA 5C1GA 2VD4A 1H5SD 1FR8A 2XMHA 1XZ6A 2VXMA 1H7EA 2Y6PA 2OEFA 1MC3A 1VGZA 4DE7A 4EVWA 2OEGA 1YP2A 1ZJPA 1VICA 1VM8A 1NMMB 2Y4MA 4O6NA 5DDTA 1H7LA 4FRBA 2J0AA 2E3DA 2O1HA 3I0HA 2YC5A 5D91A 1O7OA 3U0YA 4FIYA 1LL3A 1G97A 1R7UA 4B2XA 1ZCUA 4AYLA 2BO8A 4HCQA 4Y7FA 2WVLA 3HL3A 4EE5A 5IDSA 4XWIA 4AYJA 4D0ZA 1S4NA 1O23B 2GGQA 5C4CA 2D7RA 3CKQA 2ICXA 1LZ7A 2QKXA 2WE9A 4FRAA 4M4KA 3FOQA 3SPTA 1LZ0A 2C0NA 2OI5A 1V84A 5HS2A 1H5SB 1WT1A 1VZTA 4D11A 1I52A 2AM3A 1QGSA 2BO7A 2PX7A 4KNRA 2PGVA 4GBPA 2WEEA 3U0XA 4KPXA 3O3PA 1LZIA 3CKJA 1MP4A 1E5KA 2X5SA 3V0PA 3F1CA 3ZGGA 2X5ZA 3SXGA 1FG5N 2BO6A 3I0CA 5AJPA 1ZDGA 3USQA 5CQMX 1R7XA 5C4FA 1WVCA 2RITA 1INJA 3ZF8A 1ZI5A 2RJ0A 4D0TA 3ZLKA 4KC2A 1FO9A 2Y4JA 1PZYB 3CGXA 2AH9A 2AM4A 2E8BA 1G2VA 5CMJA 3OKRA 1R82A 4L41C 5C3BA 3DJ4A 3DK5A 2FY7A 1H7QA 4D48A 3I0LA 4ARWA 2VK9A 1LL0A 2MZBA 2Y4KA 2BO4A 4DECA 4EE4A 4HO0A 2J0BA 1Z90A 3V0NA 4HO2A 1INIA 1GX4A 5CQPA 1NQIB 1G95A 3V0LA 2VSHA 3POLA 3R2WA 1H5SC 1H4EA 1ZJOA 1HJJA 3E25A 4Y6UA 3OH1A 4ASYA 1H5TA 4HO4A 5CQOA 1GX0A 2FYBA 4FQWA 4C2SA 5C49A 2PGYA 4KPZA 2O1FA 4KC1A 5AJNA 4KT7A 2I5KA 4IRPA 1FRWA 1G0RA 2D0JA 5FU0A 4EE3A 4Y7GA 4KXOA 1NWGB 3V0MA 5J49A 3FWWA 5C4DA 2ZU9A 4FIXA 4FRPA 1ZI1A 5BXCA 4BQHA 1SS9A 2FFVA 3U2TA 1FXOA 1PZTA 1ZI3A 2QH5A 4HG6A 1R7YA 3T7OA 1HM8A 2P72A 3SXDA 2Q4JA 1XHBA 2APCA 1G23A 1VGTA 3F1YA 2Y7AA 3LW6A 4P00A 4Y7VA 2NXVA 1EYRA 2AM5A 5CMGX 1JVGA 1VH3A 2RJ5A 1WSZA 4M28A 5CQLX 2I7BA 2AGDA 1LVWA 2JCJA 4ECMA 1WT2A 2O1GA 2WGZA 2Z86A 4FRLA 4CVHA 1FGGA 1R80A 1R7VA 4NAKA 4B2WA 2VS3A 3SXBA 4B4GA 5C4BA 4E1KA 3I0EA 3BRKX 5JQQA 4KRVA 3IOHA 2YQHA 1W77A 3JTJA 4HO6A 4Y63A 3RMWA 3E26A 1FO8A 5FTVA 3I0GA 3V90A 1K4VA 3OH4A 2AECA 5FU8A 1W57A 1QWJA 4HO3A 5CQNX 3D5NA 3IOJA 3OH0A 2JCOA 1OMZA 1WT3A 1JYKA 4HO5A 2WVKA 4NAIA 3GUEA 5FUHA 3V0OA 3SX8A 2ICYA 2RIZA 5C38A 1LZJA 4G3PA 1H4CA 1ZJ3A 5L6VA 1VZXA 3PKQA 2Y4LA 3ZLLA 4LW6A 1O7QA 3U2XA 4AAWA 4Y64A 3SX7A 5C4EA 1ZCVA 5C1LA 1FXJA 2AE7A 1V82A 1NHEB 3EE5A 4Y9XA 3D98A 4ASJA 2XWNA 4B4MA 3SX3A 2RJ9A 5L6SA 1NF5B 4UEGA 3SX5A 1H7HA 1H7TA 2OI7A 1ZCTA 2V0JA 3RMVA 3SXCA 3I0DA 5C8RA 2X60A 1OQMB 1G8OA 4B5BA 1YP3A 1GA8A 1O0RA 1G3LA 1HJLA 4K6RA 1ZHJA 1H5TB 4MYBA 1VGUA 1TW5A 1JV3A 4MIXA 2V0IA 1HV9A 1TVYA 5FTSA 2OI6A 2V0LA 1QG8A 2RJ8A 3Q4SA 4ZDQA 1IIMA 1EZIA 3BCVA 2GGOA 3N9WA 4EEOA 1GWWA 3NGWA 4FREA 1ZI4A 4NANA 4HO8A 1FZWA 1H3MA 1VGWA 2X65A 2ZU7A 3OH2A 4J18A 5C36A 2XWLA 3U2UA 1H5RA 2XMEA 5D92A 3V8ZA 4FRQA 1ON6A 4EEMA 1ZCYA 4FRHA 5C1HA 3V8YA 1WT0A 3TZTA 4JISA 2YESA 4JD0A 5DDVA 4LW3A 2A8UA 4G87A 2FYDB 5C3AA 2RJ7A 4G3QA 2V0KA 3I0FA 3SXEA 3I0JA 4FCEA 2WAWA 1NKHB 4B3UA 4YS8A 4FROA 2FFUA 2A8WA 4BMAA 4M2BA 2P73A 3V91A 5C3DA 2W0WA 3R3IA 3U2WA 1KWSA 1GWVA 4M2AA 5IDTA 1IINA 4Y7TA 4Q7CA 2ZU8A 4G3SA 3USRA 4R7PA 3JUJA 4P02A 2WVMA 4Y7UA 2W0VA 3SXAA 1GQ9A 2VSIA 3KIAA 4FCUA 2RIXA 2P6WA 2JCKA 3QVBA 1ZDFA 4CJBA 4KQLA 2YC3A 1H7FA 2I5EA 5CMHA 1LL2A 4B4BA 2VS5A 3K8DA 3ZGFA 1G9RA 1G93A 2AESA 5C47A 5C48A 3OGZA 2CU2A 3OAMA 1OMXA 1QGQA 3OC9A 1HM9A 4FRMA 3RSBA 2RJ4A 1TW1A 1MP5A 2RIYA 3ST8A 4EEAA 3OH3A 1H7GA 5EIYA 1S4OA 4CJ8A 3T7NA 1H5SA 1GQCA 2RJ1A 2DPWA 2UX8A 1TZFA 1H4DA 2VFZA 3V0QA 1V83A 4MNDA 4AC3A 3PKPA 5FV9A 3T7MA 4HOCA 3CKOA 2XWMA 2YQJA 3K8EA 1ZJ2A 1VH1A 5EJZA 4HO9A 1VPAA 4B42A 1FWYA 1W55A 5CMIA 1FGXA 5EJ1A 2QGIA 1JYLA 4DDZA 2YCMA 1R81A 1FR9A 3CU0A 1ON8A 1ZJ0A 3CKVA 2JCLA 2V0HA 5CMFX 1FOAA 4FRDA 4NALA 5AJOA 3IOIA 4D11C 3DUVA 4IRQA 3I0IX 4KNXA 4CJCA 5IFYA 2YQSA 2Z87A 3U2VA 1ZIZA 3TQDA 1ZJ1A 2VXLA 4Y6NA 3JUKA 4KC4A 3D8VA 4O6MA 1H5RB 2D7IA 1YROB 1YP4A 1G1LA 2VS4A 4EEGA 2FYCB 1JVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CKN A;  2FYA A;  3PNN A;  3I0K A;  2PA4 A;  1HM0 A;  1S4P A;  1MP3 A;  1VZU A;  5FYE A;  2YQC A;  1R7T A;  2RJ6 A;  1JV1 A;  3Q80 A;  4Y62 A;  5I1F A;  3Q7U A;  5C1G A;  2VD4 A;  1H5S D;  1FR8 A;  2XMH A;  1XZ6 A;  2VXM A;  1H7E A;  2Y6P A;  2OEF A;  1MC3 A;  1VGZ A;  4DE7 A;  4EVW A;  2OEG A;  1YP2 A;  1ZJP A;  1VIC A;  1VM8 A;  1NMM B;  2Y4M A;  5DDT A;  1H7L A;  4FRB A;  2E3D A;  2O1H A;  3I0H A;  2YC5 A;  1O7O A;  3U0Y A;  1LL3 A;  1G97 A;  1R7U A;  4B2X A;  1ZCU A;  4AYL A;  2BO8 A;  4HCQ A;  4Y7F A;  2WVL A;  3HL3 A;  4EE5 A;  5IDS A;  4XWI A;  4AYJ A;  4D0Z A;  1S4N A;  1O23 B;  2GGQ A;  5C4C A;  2D7R A;  3CKQ A;  2ICX A;  1LZ7 A;  2QKX A;  2WE9 A;  4FRA A;  4M4K A;  3FOQ A;  3SPT A;  1LZ0 A;  2OI5 A;  1V84 A;  5HS2 A;  1H5S B;  1WT1 A;  1VZT A;  4D11 A;  1I52 A;  2AM3 A;  1QGS A;  2BO7 A;  2PX7 A;  4KNR A;  2PGV A;  4GBP A;  2WEE A;  3U0X A;  4KPX A;  3O3P A;  1LZI A;  3CKJ A;  1MP4 A;  1E5K A;  2X5S A;  3V0P A;  3F1C A;  3ZGG A;  2X5Z A;  3SXG A;  1FG5 N;  2BO6 A;  3I0C A;  5AJP A;  1ZDG A;  3USQ A;  5CQM X;  1R7X A;  5C4F A;  1WVC A;  2RIT A;  1INJ A;  3ZF8 A;  1ZI5 A;  2RJ0 A;  4D0T A;  3ZLK A;  4KC2 A;  1FO9 A;  2Y4J A;  1PZY B;  3CGX A;  2AH9 A;  2AM4 A;  2E8B A;  1G2V A;  5CMJ A;  3OKR A;  1R82 A;  4L41 C;  5C3B A;  3DJ4 A;  3DK5 A;  2FY7 A;  1H7Q A;  4D48 A;  3I0L A;  4ARW A;  1LL0 A;  2MZB A;  2Y4K A;  2BO4 A;  4DEC A;  4EE4 A;  4HO0 A;  1Z90 A;  3V0N A;  4HO2 A;  1INI A;  1GX4 A;  5CQP A;  1NQI B;  1G95 A;  3V0L A;  2VSH A;  3POL A;  3R2W A;  1H5S C;  1H4E A;  1ZJO A;  1HJJ A;  3E25 A;  4Y6U A;  3OH1 A;  4ASY A;  1H5T A;  4HO4 A;  5CQO A;  1GX0 A;  2FYB A;  4FQW A;  4C2S A;  5C49 A;  2PGY A;  4KPZ A;  2O1F A;  4KC1 A;  5AJN A;  4KT7 A;  2I5K A;  4IRP A;  1FRW A;  1G0R A;  2D0J A;  5FU0 A;  4EE3 A;  4Y7G A;  4KXO A;  1NWG B;  3V0M A;  5J49 A;  3FWW A;  5C4D A;  2ZU9 A;  4FRP A;  1ZI1 A;  5BXC A;  4BQH A;  1SS9 A;  2FFV A;  3U2T A;  1FXO A;  1PZT A;  1ZI3 A;  2QH5 A;  4HG6 A;  1R7Y A;  3T7O A;  1HM8 A;  2P72 A;  3SXD A;  2Q4J A;  1XHB A;  2APC A;  1G23 A;  1VGT A;  3F1Y A;  2Y7A A;  3LW6 A;  4P00 A;  4Y7V A;  2NXV A;  1EYR A;  2AM5 A;  5CMG X;  1JVG A;  1VH3 A;  2RJ5 A;  1WSZ A;  4M28 A;  5CQL X;  2I7B A;  2AGD A;  1LVW A;  2JCJ A;  4ECM A;  1WT2 A;  2O1G A;  2WGZ A;  2Z86 A;  4FRL A;  4CVH A;  1FGG A;  1R80 A;  1R7V A;  4NAK A;  4B2W A;  2VS3 A;  3SXB A;  4B4G A;  5C4B A;  4E1K A;  3I0E A;  3BRK X;  5JQQ A;  4KRV A;  3IOH A;  2YQH A;  1W77 A;  3JTJ A;  4HO6 A;  4Y63 A;  3RMW A;  3E26 A;  1FO8 A;  5FTV A;  3I0G A;  3V90 A;  1K4V A;  3OH4 A;  2AEC A;  5FU8 A;  1W57 A;  1QWJ A;  4HO3 A;  5CQN X;  3D5N A;  3IOJ A;  3OH0 A;  2JCO A;  1OMZ A;  1WT3 A;  1JYK A;  4HO5 A;  2WVK A;  4NAI A;  3GUE A;  5FUH A;  3V0O A;  3SX8 A;  2ICY A;  2RIZ A;  5C38 A;  1LZJ A;  4G3P A;  1H4C A;  1ZJ3 A;  5L6V A;  1VZX A;  3PKQ A;  2Y4L A;  3ZLL A;  4LW6 A;  1O7Q A;  3U2X A;  4AAW A;  4Y64 A;  3SX7 A;  5C4E A;  1ZCV A;  5C1L A;  1FXJ A;  2AE7 A;  1V82 A;  1NHE B;  3EE5 A;  4Y9X A;  3D98 A;  4ASJ A;  2XWN A;  4B4M A;  3SX3 A;  2RJ9 A;  5L6S A;  1NF5 B;  4UEG A;  3SX5 A;  1H7H A;  1H7T A;  2OI7 A;  1ZCT A;  2V0J A;  3RMV A;  3SXC A;  3I0D A;  5C8R A;  2X60 A;  1OQM B;  1G8O A;  4B5B A;  1YP3 A;  1GA8 A;  1O0R A;  1G3L A;  1HJL A;  4K6R A;  1ZHJ A;  1H5T B;  4MYB A;  1VGU A;  1TW5 A;  1JV3 A;  1HV9 A;  2V0I A;  1TVY A;  5FTS A;  2OI6 A;  2V0L A;  1QG8 A;  2RJ8 A;  3Q4S A;  4ZDQ A;  1IIM A;  1EZI A;  3BCV A;  2GGO A;  3N9W A;  4EEO A;  1GWW A;  3NGW A;  4FRE A;  1ZI4 A;  4NAN A;  4HO8 A;  1FZW A;  1H3M A;  1VGW A;  2X65 A;  2ZU7 A;  3OH2 A;  4J18 A;  5C36 A;  2XWL A;  3U2U A;  1H5R A;  2XME A;  3V8Z A;  4FRQ A;  1ON6 A;  4EEM A;  1ZCY A;  4FRH A;  5C1H A;  3V8Y A;  1WT0 A;  3TZT A;  4JIS A;  2YES A;  4JD0 A;  5DDV A;  4LW3 A;  2A8U A;  4G87 A;  2FYD B;  5C3A A;  2RJ7 A;  4G3Q A;  2V0K A;  3I0F A;  3SXE A;  3I0J A;  4FCE A;  2WAW A;  1NKH B;  4B3U A;  4YS8 A;  4FRO A;  2FFU A;  2A8W A;  4BMA A;  4M2B A;  2P73 A;  3V91 A;  5C3D A;  2W0W A;  3R3I A;  3U2W A;  1KWS A;  1GWV A;  4M2A A;  5IDT A;  1IIN A;  4Y7T A;  2ZU8 A;  4G3S A;  3USR A;  4R7P A;  3JUJ A;  4P02 A;  2WVM A;  4Y7U A;  2W0V A;  3SXA A;  1GQ9 A;  2VSI A;  3KIA A;  4FCU A;  2RIX A;  2P6W A;  2JCK A;  3QVB A;  1ZDF A;  4CJB A;  4KQL A;  2YC3 A;  1H7F A;  2I5E A;  5CMH A;  1LL2 A;  4B4B A;  2VS5 A;  3K8D A;  3ZGF A;  1G9R A;  1G93 A;  2AES A;  5C47 A;  5C48 A;  3OGZ A;  2CU2 A;  3OAM A;  1OMX A;  1QGQ A;  3OC9 A;  1HM9 A;  4FRM A;  3RSB A;  2RJ4 A;  1TW1 A;  1MP5 A;  2RIY A;  3ST8 A;  4EEA A;  3OH3 A;  1H7G A;  5EIY A;  1S4O A;  4CJ8 A;  3T7N A;  1H5S A;  1GQC A;  2RJ1 A;  2DPW A;  2UX8 A;  1TZF A;  1H4D A;  2VFZ A;  3V0Q A;  1V83 A;  4MND A;  4AC3 A;  3PKP A;  5FV9 A;  3T7M A;  4HOC A;  3CKO A;  2XWM A;  2YQJ A;  3K8E A;  1ZJ2 A;  1VH1 A;  5EJZ A;  4HO9 A;  1VPA A;  4B42 A;  1FWY A;  1W55 A;  5CMI A;  1FGX A;  5EJ1 A;  2QGI A;  1JYL A;  4DDZ A;  2YCM A;  1R81 A;  1FR9 A;  3CU0 A;  1ON8 A;  1ZJ0 A;  3CKV A;  2JCL A;  2V0H A;  5CMF X;  1FOA A;  4FRD A;  4NAL A;  5AJO A;  3IOI A;  4D11 C;  3DUV A;  4IRQ A;  3I0I X;  4KNX A;  4CJC A;  5IFY A;  2YQS A;  2Z87 A;  3U2V A;  1ZIZ A;  3TQD A;  1ZJ1 A;  2VXL A;  4Y6N A;  3JUK A;  4KC4 A;  3D8V A;  1H5R B;  2D7I A;  1YRO B;  1YP4 A;  1G1L A;  2VS4 A;  4EEG A;  2FYC B;  1JVD A; 
#chains in the Genus database with same CATH topology
 3CKN A;  2FYA A;  3PNN A;  3I0K A;  2PA4 A;  1HM0 A;  1S4P A;  1MP3 A;  1VZU A;  5FYE A;  2YQC A;  1R7T A;  2RJ6 A;  1JV1 A;  3Q80 A;  4Y62 A;  5I1F A;  3Q7U A;  5C1G A;  2VD4 A;  1H5S D;  1FR8 A;  2XMH A;  1XZ6 A;  2VXM A;  1H7E A;  2Y6P A;  2OEF A;  1MC3 A;  1VGZ A;  4DE7 A;  4EVW A;  2OEG A;  1YP2 A;  1ZJP A;  1VIC A;  1VM8 A;  1NMM B;  2Y4M A;  4O6N A;  5DDT A;  1H7L A;  4FRB A;  2J0A A;  2E3D A;  2O1H A;  3I0H A;  2YC5 A;  5D91 A;  1O7O A;  3U0Y A;  4FIY A;  1LL3 A;  1G97 A;  1R7U A;  4B2X A;  1ZCU A;  4AYL A;  2BO8 A;  4HCQ A;  4Y7F A;  2WVL A;  3HL3 A;  4EE5 A;  5IDS A;  4XWI A;  4AYJ A;  4D0Z A;  1S4N A;  1O23 B;  2GGQ A;  5C4C A;  2D7R A;  3CKQ A;  2ICX A;  1LZ7 A;  2QKX A;  2WE9 A;  4FRA A;  4M4K A;  3FOQ A;  3SPT A;  1LZ0 A;  2C0N A;  2OI5 A;  1V84 A;  5HS2 A;  1H5S B;  1WT1 A;  1VZT A;  4D11 A;  1I52 A;  2AM3 A;  1QGS A;  2BO7 A;  2PX7 A;  4KNR A;  2PGV A;  4GBP A;  2WEE A;  3U0X A;  4KPX A;  3O3P A;  1LZI A;  3CKJ A;  1MP4 A;  1E5K A;  2X5S A;  3V0P A;  3F1C A;  3ZGG A;  2X5Z A;  3SXG A;  1FG5 N;  2BO6 A;  3I0C A;  5AJP A;  1ZDG A;  3USQ A;  5CQM X;  1R7X A;  5C4F A;  1WVC A;  2RIT A;  1INJ A;  3ZF8 A;  1ZI5 A;  2RJ0 A;  4D0T A;  3ZLK A;  4KC2 A;  1FO9 A;  2Y4J A;  1PZY B;  3CGX A;  2AH9 A;  2AM4 A;  2E8B A;  1G2V A;  5CMJ A;  3OKR A;  1R82 A;  4L41 C;  5C3B A;  3DJ4 A;  3DK5 A;  2FY7 A;  1H7Q A;  4D48 A;  3I0L A;  4ARW A;  2VK9 A;  1LL0 A;  2MZB A;  2Y4K A;  2BO4 A;  4DEC A;  4EE4 A;  4HO0 A;  2J0B A;  1Z90 A;  3V0N A;  4HO2 A;  1INI A;  1GX4 A;  5CQP A;  1NQI B;  1G95 A;  3V0L A;  2VSH A;  3POL A;  3R2W A;  1H5S C;  1H4E A;  1ZJO A;  1HJJ A;  3E25 A;  4Y6U A;  3OH1 A;  4ASY A;  1H5T A;  4HO4 A;  5CQO A;  1GX0 A;  2FYB A;  4FQW A;  4C2S A;  5C49 A;  2PGY A;  4KPZ A;  2O1F A;  4KC1 A;  5AJN A;  4KT7 A;  2I5K A;  4IRP A;  1FRW A;  1G0R A;  2D0J A;  5FU0 A;  4EE3 A;  4Y7G A;  4KXO A;  1NWG B;  3V0M A;  5J49 A;  3FWW A;  5C4D A;  2ZU9 A;  4FIX A;  4FRP A;  1ZI1 A;  5BXC A;  4BQH A;  1SS9 A;  2FFV A;  3U2T A;  1FXO A;  1PZT A;  1ZI3 A;  2QH5 A;  4HG6 A;  1R7Y A;  3T7O A;  1HM8 A;  2P72 A;  3SXD A;  2Q4J A;  1XHB A;  2APC A;  1G23 A;  1VGT A;  3F1Y A;  2Y7A A;  3LW6 A;  4P00 A;  4Y7V A;  2NXV A;  1EYR A;  2AM5 A;  5CMG X;  1JVG A;  1VH3 A;  2RJ5 A;  1WSZ A;  4M28 A;  5CQL X;  2I7B A;  2AGD A;  1LVW A;  2JCJ A;  4ECM A;  1WT2 A;  2O1G A;  2WGZ A;  2Z86 A;  4FRL A;  4CVH A;  1FGG A;  1R80 A;  1R7V A;  4NAK A;  4B2W A;  2VS3 A;  3SXB A;  4B4G A;  5C4B A;  4E1K A;  3I0E A;  3BRK X;  5JQQ A;  4KRV A;  3IOH A;  2YQH A;  1W77 A;  3JTJ A;  4HO6 A;  4Y63 A;  3RMW A;  3E26 A;  1FO8 A;  5FTV A;  3I0G A;  3V90 A;  1K4V A;  3OH4 A;  2AEC A;  5FU8 A;  1W57 A;  1QWJ A;  4HO3 A;  5CQN X;  3D5N A;  3IOJ A;  3OH0 A;  2JCO A;  1OMZ A;  1WT3 A;  1JYK A;  4HO5 A;  2WVK A;  4NAI A;  3GUE A;  5FUH A;  3V0O A;  3SX8 A;  2ICY A;  2RIZ A;  5C38 A;  1LZJ A;  4G3P A;  1H4C A;  1ZJ3 A;  5L6V A;  1VZX A;  3PKQ A;  2Y4L A;  3ZLL A;  4LW6 A;  1O7Q A;  3U2X A;  4AAW A;  4Y64 A;  3SX7 A;  5C4E A;  1ZCV A;  5C1L A;  1FXJ A;  2AE7 A;  1V82 A;  1NHE B;  3EE5 A;  4Y9X A;  3D98 A;  4ASJ A;  2XWN A;  4B4M A;  3SX3 A;  2RJ9 A;  5L6S A;  1NF5 B;  4UEG A;  3SX5 A;  1H7H A;  1H7T A;  2OI7 A;  1ZCT A;  2V0J A;  3RMV A;  3SXC A;  3I0D A;  5C8R A;  2X60 A;  1OQM B;  1G8O A;  4B5B A;  1YP3 A;  1GA8 A;  1O0R A;  1G3L A;  1HJL A;  4K6R A;  1ZHJ A;  1H5T B;  4MYB A;  1VGU A;  1TW5 A;  1JV3 A;  4MIX A;  2V0I A;  1HV9 A;  1TVY A;  5FTS A;  2OI6 A;  2V0L A;  1QG8 A;  2RJ8 A;  3Q4S A;  4ZDQ A;  1IIM A;  1EZI A;  3BCV A;  2GGO A;  3N9W A;  4EEO A;  1GWW A;  3NGW A;  4FRE A;  1ZI4 A;  4NAN A;  4HO8 A;  1FZW A;  1H3M A;  1VGW A;  2X65 A;  2ZU7 A;  3OH2 A;  4J18 A;  5C36 A;  2XWL A;  3U2U A;  1H5R A;  2XME A;  5D92 A;  3V8Z A;  4FRQ A;  1ON6 A;  4EEM A;  1ZCY A;  4FRH A;  5C1H A;  3V8Y A;  1WT0 A;  3TZT A;  4JIS A;  2YES A;  4JD0 A;  5DDV A;  4LW3 A;  2A8U A;  4G87 A;  2FYD B;  5C3A A;  2RJ7 A;  4G3Q A;  2V0K A;  3I0F A;  3SXE A;  3I0J A;  4FCE A;  2WAW A;  1NKH B;  4B3U A;  4YS8 A;  4FRO A;  2FFU A;  2A8W A;  4BMA A;  4M2B A;  2P73 A;  3V91 A;  5C3D A;  2W0W A;  3R3I A;  3U2W A;  1KWS A;  1GWV A;  4M2A A;  5IDT A;  1IIN A;  4Y7T A;  4Q7C A;  2ZU8 A;  4G3S A;  3USR A;  4R7P A;  3JUJ A;  4P02 A;  2WVM A;  4Y7U A;  2W0V A;  3SXA A;  1GQ9 A;  2VSI A;  3KIA A;  4FCU A;  2RIX A;  2P6W A;  2JCK A;  3QVB A;  1ZDF A;  4CJB A;  4KQL A;  2YC3 A;  1H7F A;  2I5E A;  5CMH A;  1LL2 A;  4B4B A;  2VS5 A;  3K8D A;  3ZGF A;  1G9R A;  1G93 A;  2AES A;  5C47 A;  5C48 A;  3OGZ A;  2CU2 A;  3OAM A;  1OMX A;  1QGQ A;  3OC9 A;  1HM9 A;  4FRM A;  3RSB A;  2RJ4 A;  1TW1 A;  1MP5 A;  2RIY A;  3ST8 A;  4EEA A;  3OH3 A;  1H7G A;  5EIY A;  1S4O A;  4CJ8 A;  3T7N A;  1H5S A;  1GQC A;  2RJ1 A;  2DPW A;  2UX8 A;  1TZF A;  1H4D A;  2VFZ A;  3V0Q A;  1V83 A;  4MND A;  4AC3 A;  3PKP A;  5FV9 A;  3T7M A;  4HOC A;  3CKO A;  2XWM A;  2YQJ A;  3K8E A;  1ZJ2 A;  1VH1 A;  5EJZ A;  4HO9 A;  1VPA A;  4B42 A;  1FWY A;  1W55 A;  5CMI A;  1FGX A;  5EJ1 A;  2QGI A;  1JYL A;  4DDZ A;  2YCM A;  1R81 A;  1FR9 A;  3CU0 A;  1ON8 A;  1ZJ0 A;  3CKV A;  2JCL A;  2V0H A;  5CMF X;  1FOA A;  4FRD A;  4NAL A;  5AJO A;  3IOI A;  4D11 C;  3DUV A;  4IRQ A;  3I0I X;  4KNX A;  4CJC A;  5IFY A;  2YQS A;  2Z87 A;  3U2V A;  1ZIZ A;  3TQD A;  1ZJ1 A;  2VXL A;  4Y6N A;  3JUK A;  4KC4 A;  3D8V A;  4O6M A;  1H5R B;  2D7I A;  1YRO B;  1YP4 A;  1G1L A;  2VS4 A;  4EEG A;  2FYC B;  1JVD A; 
#chains in the Genus database with same CATH homology
 3CKN A;  2FYA A;  3PNN A;  3I0K A;  2PA4 A;  1HM0 A;  1S4P A;  1MP3 A;  1VZU A;  5FYE A;  2YQC A;  1R7T A;  2RJ6 A;  1JV1 A;  3Q80 A;  4Y62 A;  5I1F A;  3Q7U A;  5C1G A;  2VD4 A;  1H5S D;  1FR8 A;  2XMH A;  1XZ6 A;  2VXM A;  1H7E A;  2Y6P A;  2OEF A;  1MC3 A;  1VGZ A;  4DE7 A;  4EVW A;  2OEG A;  1YP2 A;  1ZJP A;  1VIC A;  1VM8 A;  1NMM B;  2Y4M A;  4O6N A;  5DDT A;  1H7L A;  4FRB A;  2J0A A;  2E3D A;  2O1H A;  3I0H A;  2YC5 A;  5D91 A;  1O7O A;  3U0Y A;  4FIY A;  1LL3 A;  1G97 A;  1R7U A;  4B2X A;  1ZCU A;  4AYL A;  2BO8 A;  4HCQ A;  4Y7F A;  2WVL A;  3HL3 A;  4EE5 A;  5IDS A;  4XWI A;  4AYJ A;  4D0Z A;  1S4N A;  1O23 B;  2GGQ A;  5C4C A;  2D7R A;  3CKQ A;  2ICX A;  1LZ7 A;  2QKX A;  2WE9 A;  4FRA A;  4M4K A;  3FOQ A;  3SPT A;  1LZ0 A;  2C0N A;  2OI5 A;  1V84 A;  5HS2 A;  1H5S B;  1WT1 A;  1VZT A;  4D11 A;  1I52 A;  2AM3 A;  1QGS A;  2BO7 A;  2PX7 A;  4KNR A;  2PGV A;  4GBP A;  2WEE A;  3U0X A;  4KPX A;  3O3P A;  1LZI A;  3CKJ A;  1MP4 A;  1E5K A;  2X5S A;  3V0P A;  3F1C A;  3ZGG A;  2X5Z A;  3SXG A;  1FG5 N;  2BO6 A;  3I0C A;  5AJP A;  1ZDG A;  3USQ A;  5CQM X;  1R7X A;  5C4F A;  1WVC A;  2RIT A;  1INJ A;  3ZF8 A;  1ZI5 A;  2RJ0 A;  4D0T A;  3ZLK A;  4KC2 A;  1FO9 A;  2Y4J A;  1PZY B;  3CGX A;  2AH9 A;  2AM4 A;  2E8B A;  1G2V A;  5CMJ A;  3OKR A;  1R82 A;  4L41 C;  5C3B A;  3DJ4 A;  3DK5 A;  2FY7 A;  1H7Q A;  4D48 A;  3I0L A;  4ARW A;  2VK9 A;  1LL0 A;  2MZB A;  2Y4K A;  2BO4 A;  4DEC A;  4EE4 A;  4HO0 A;  2J0B A;  1Z90 A;  3V0N A;  4HO2 A;  1INI A;  1GX4 A;  5CQP A;  1NQI B;  1G95 A;  3V0L A;  2VSH A;  3POL A;  3R2W A;  1H5S C;  1H4E A;  1ZJO A;  1HJJ A;  3E25 A;  4Y6U A;  3OH1 A;  4ASY A;  1H5T A;  4HO4 A;  5CQO A;  1GX0 A;  2FYB A;  4FQW A;  4C2S A;  5C49 A;  2PGY A;  4KPZ A;  2O1F A;  4KC1 A;  5AJN A;  4KT7 A;  2I5K A;  4IRP A;  1FRW A;  1G0R A;  2D0J A;  5FU0 A;  4EE3 A;  4Y7G A;  4KXO A;  1NWG B;  3V0M A;  5J49 A;  3FWW A;  5C4D A;  2ZU9 A;  4FIX A;  4FRP A;  1ZI1 A;  5BXC A;  4BQH A;  1SS9 A;  2FFV A;  3U2T A;  1FXO A;  1PZT A;  1ZI3 A;  2QH5 A;  4HG6 A;  1R7Y A;  3T7O A;  1HM8 A;  2P72 A;  3SXD A;  2Q4J A;  1XHB A;  2APC A;  1G23 A;  1VGT A;  3F1Y A;  2Y7A A;  3LW6 A;  4P00 A;  4Y7V A;  2NXV A;  1EYR A;  2AM5 A;  5CMG X;  1JVG A;  1VH3 A;  2RJ5 A;  1WSZ A;  4M28 A;  5CQL X;  2I7B A;  2AGD A;  1LVW A;  2JCJ A;  4ECM A;  1WT2 A;  2O1G A;  2WGZ A;  2Z86 A;  4FRL A;  4CVH A;  1FGG A;  1R80 A;  1R7V A;  4NAK A;  4B2W A;  2VS3 A;  3SXB A;  4B4G A;  5C4B A;  4E1K A;  3I0E A;  3BRK X;  5JQQ A;  4KRV A;  3IOH A;  2YQH A;  1W77 A;  3JTJ A;  4HO6 A;  4Y63 A;  3RMW A;  3E26 A;  1FO8 A;  5FTV A;  3I0G A;  3V90 A;  1K4V A;  3OH4 A;  2AEC A;  5FU8 A;  1W57 A;  1QWJ A;  4HO3 A;  5CQN X;  3D5N A;  3IOJ A;  3OH0 A;  2JCO A;  1OMZ A;  1WT3 A;  1JYK A;  4HO5 A;  2WVK A;  4NAI A;  3GUE A;  5FUH A;  3V0O A;  3SX8 A;  2ICY A;  2RIZ A;  5C38 A;  1LZJ A;  4G3P A;  1H4C A;  1ZJ3 A;  5L6V A;  1VZX A;  3PKQ A;  2Y4L A;  3ZLL A;  4LW6 A;  1O7Q A;  3U2X A;  4AAW A;  4Y64 A;  3SX7 A;  5C4E A;  1ZCV A;  5C1L A;  1FXJ A;  2AE7 A;  1V82 A;  1NHE B;  3EE5 A;  4Y9X A;  3D98 A;  4ASJ A;  2XWN A;  4B4M A;  3SX3 A;  2RJ9 A;  5L6S A;  1NF5 B;  4UEG A;  3SX5 A;  1H7H A;  1H7T A;  2OI7 A;  1ZCT A;  2V0J A;  3RMV A;  3SXC A;  3I0D A;  5C8R A;  2X60 A;  1OQM B;  1G8O A;  4B5B A;  1YP3 A;  1GA8 A;  1O0R A;  1G3L A;  1HJL A;  4K6R A;  1ZHJ A;  1H5T B;  4MYB A;  1VGU A;  1TW5 A;  1JV3 A;  4MIX A;  2V0I A;  1HV9 A;  1TVY A;  5FTS A;  2OI6 A;  2V0L A;  1QG8 A;  2RJ8 A;  3Q4S A;  4ZDQ A;  1IIM A;  1EZI A;  3BCV A;  2GGO A;  3N9W A;  4EEO A;  1GWW A;  3NGW A;  4FRE A;  1ZI4 A;  4NAN A;  4HO8 A;  1FZW A;  1H3M A;  1VGW A;  2X65 A;  2ZU7 A;  3OH2 A;  4J18 A;  5C36 A;  2XWL A;  3U2U A;  1H5R A;  2XME A;  5D92 A;  3V8Z A;  4FRQ A;  1ON6 A;  4EEM A;  1ZCY A;  4FRH A;  5C1H A;  3V8Y A;  1WT0 A;  3TZT A;  4JIS A;  2YES A;  4JD0 A;  5DDV A;  4LW3 A;  2A8U A;  4G87 A;  2FYD B;  5C3A A;  2RJ7 A;  4G3Q A;  2V0K A;  3I0F A;  3SXE A;  3I0J A;  4FCE A;  2WAW A;  1NKH B;  4B3U A;  4YS8 A;  4FRO A;  2FFU A;  2A8W A;  4BMA A;  4M2B A;  2P73 A;  3V91 A;  5C3D A;  2W0W A;  3R3I A;  3U2W A;  1KWS A;  1GWV A;  4M2A A;  5IDT A;  1IIN A;  4Y7T A;  4Q7C A;  2ZU8 A;  4G3S A;  3USR A;  4R7P A;  3JUJ A;  4P02 A;  2WVM A;  4Y7U A;  2W0V A;  3SXA A;  1GQ9 A;  2VSI A;  3KIA A;  4FCU A;  2RIX A;  2P6W A;  2JCK A;  3QVB A;  1ZDF A;  4CJB A;  4KQL A;  2YC3 A;  1H7F A;  2I5E A;  5CMH A;  1LL2 A;  4B4B A;  2VS5 A;  3K8D A;  3ZGF A;  1G9R A;  1G93 A;  2AES A;  5C47 A;  5C48 A;  3OGZ A;  2CU2 A;  3OAM A;  1OMX A;  1QGQ A;  3OC9 A;  1HM9 A;  4FRM A;  3RSB A;  2RJ4 A;  1TW1 A;  1MP5 A;  2RIY A;  3ST8 A;  4EEA A;  3OH3 A;  1H7G A;  5EIY A;  1S4O A;  4CJ8 A;  3T7N A;  1H5S A;  1GQC A;  2RJ1 A;  2DPW A;  2UX8 A;  1TZF A;  1H4D A;  2VFZ A;  3V0Q A;  1V83 A;  4MND A;  4AC3 A;  3PKP A;  5FV9 A;  3T7M A;  4HOC A;  3CKO A;  2XWM A;  2YQJ A;  3K8E A;  1ZJ2 A;  1VH1 A;  5EJZ A;  4HO9 A;  1VPA A;  4B42 A;  1FWY A;  1W55 A;  5CMI A;  1FGX A;  5EJ1 A;  2QGI A;  1JYL A;  4DDZ A;  2YCM A;  1R81 A;  1FR9 A;  3CU0 A;  1ON8 A;  1ZJ0 A;  3CKV A;  2JCL A;  2V0H A;  5CMF X;  1FOA A;  4FRD A;  4NAL A;  5AJO A;  3IOI A;  4D11 C;  3DUV A;  4IRQ A;  3I0I X;  4KNX A;  4CJC A;  5IFY A;  2YQS A;  2Z87 A;  3U2V A;  1ZIZ A;  3TQD A;  1ZJ1 A;  2VXL A;  4Y6N A;  3JUK A;  4KC4 A;  3D8V A;  4O6M A;  1H5R B;  2D7I A;  1YRO B;  1YP4 A;  1G1L A;  2VS4 A;  4EEG A;  2FYC B;  1JVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...