1WT3A

Mutant human abo(h) blood group glycosyltransferase with bound udp and acceptor
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
283
structure length
263
Chain Sequence
MVSLPRMVYPQSKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGRFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histo-blood group ABO system transferase
publication title Structural basis for the inactivity of human blood group o2 glycosyltransferase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 263
sequence length 283
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2004-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1wt3A00
3RMVA 1VPAA 4B5BA 1G0RA 1LL0A 3OC9A 5CQPA 2RJ0A 1GQCA 3I0LA 2A8WA 2NXVA 3RSBA 1ZJ2A 2VS4A 2BO4A 4EEMA 1GWWA 1YP2A 3I0FA 5CQLX 1MP3A 2QH5A 1PZYB 3I0CA 4Y9XA 1GX0A 2X5ZA 1NHEB 2AGDA 1G23A 3SXCA 2VS5A 2XWMA 1NF5B 2P73A 1VM8A 1VZUA 2AE7A 1FXOA 2XWLA 3CKJA 3Q80A 3QVBA 1EZIA 5C48A 1GA8A 1JYKA 4C2SA 1G8OA 2RJ9A 2OI5A 4YS8A 3U2VA 1H7EA 2AECA 1K4VA 3V8YA 3SX3A 4KNRA 1G1LA 3OH4A 2GGQA 1VGUA 2QGIA 3T7OA 1HJLA 2X60A 3V8ZA 4D0TA 2D7RA 1TW1A 4G3SA 4AC3A 2Y4LA 1NMMB 1ZDFA 4DDZA 1H7TA 3POLA 5DDVA 5CMJA 4NAKA 1ZHJA 1O7OA 2CU2A 2O1GA 3KIAA 2VD4A 5CMHA 2Q4JA 5AJOA 4EEGA 2XMEA 4J18A 3OH1A 5IFYA 2DPWA 2RJ1A 2X5SA 1FO8A 4JD0A 3U2UA 2YCMA 1JYLA 1VZTA 1QGSA 2JCKA 2WEEA 1H5TA 4FRDA 5EJZA 1S4NA 2VFZA 3F1YA 4FRMA 3D8VA 2I5EA 2Z86A 5CQOA 4B42A 1YP4A 1GQ9A 3BRKX 2OI7A 1R82A 4XWIA 2O1FA 3JUJA 4FQWA 1MC3A 4G3QA 2QKXA 1Z90A 1FO9A 3TZTA 3PKQA 1NQIB 1I52A 3SX7A 3OH2A 4P02A 2I7BA 2OEFA 1FGGA 5FU0A 1H5TB 2PA4A 2RIYA 5CQNX 5C38A 2P6WA 3R3IA 1ZI1A 2A8UA 3USQA 3ST8A 5C3BA 3SXDA 3T7MA 3U2TA 2AESA 1G95A 1FGXA 5AJPA 2VSHA 1QWJA 4KC2A 1QGQA 3DUVA 2E3DA 2W0VA 4IRPA 3NGWA 2BO7A 3DK5A 1HJJA 1HM9A 1XHBA 4B4BA 4HO8A 1H4DA 3V0PA 5C1GA 3I0HA 4M4KA 4EEAA 5CMGX 1JVGA 1MP4A 3LW6A 5C1HA 2BO8A 1H7LA 1H3MA 1JV3A 4Y7VA 1FXJA 3I0IX 2ICXA 5C4FA 5JQQA 3ZF8A 5J49A 4HO9A 1INJA 4CJ8A 5C8RA 4HO3A 1JV1A 2RJ7A 1OQMB 2AM3A 1TZFA 3ZLLA 3SXAA 1TW5A 2RJ6A 4KT7A 3O3PA 3ZGFA 2PX7A 3I0GA 1R80A 4KC1A 4FCEA 4LW3A 4EE3A 2ZU9A 2WAWA 3SPTA 1FWYA 2JCOA 4D48A 1V82A 4BMAA 3EE5A 4K6RA 3SX8A 4D11A 4HOCA 1ZCVA 2JCJA 1WT2A 1YP3A 3TQDA 3CKNA 2FYCB 1HM0A 2RJ5A 2VXMA 4FRBA 4R7PA 5BXCA 4FCUA 1W77A 3U2XA 2VSIA 4KC4A 1E5KA 2AM5A 5C47A 4KQLA 2RIXA 3IOIA 2WVKA 4KRVA 1LVWA 4D11C 1YROB 1LZIA 4JISA 5AJNA 1FR8A 4D0ZA 2WGZA 2RJ4A 1LL2A 4CJCA 2Y4JA 4ZDQA 1V83A 3U2WA 1INIA 2ICYA 3OH0A 1FG5N 5HS2A 3BCVA 1ZJOA 3SX5A 1ZI3A 2YC5A 1ON8A 3JUKA 3K8DA 3E25A 3V0MA 2P72A 3OH3A 1VH3A 2FYAA 5EIYA 4B4MA 4Y7GA 2GGOA 1OMXA 4B2XA 1G2VA 1G3LA 4P00A 4NAIA 2UX8A 4Y64A 4HO4A 2D0JA 4Y62A 4DE7A 4G87A 4Y6NA 4EE5A 3CGXA 1H5SD 2V0LA 3FWWA 4FROA 4ECMA 3DJ4A 1FZWA 2Y7AA 4EE4A 4HO2A 2RJ8A 2WE9A 2V0JA 4KPXA 4HO0A 1R7TA 5IDTA 1VGTA 2FYDB 5EJ1A 2ZU7A 1ZCTA 1VGZA 1H5SB 1H7GA 1ZJ0A 4Y6UA 1NKHB 1VGWA 4DECA 3CU0A 4Y7UA 3RMWA 1GWVA 2VXLA 3I0KA 3OKRA 4E1KA 1MP5A 4IRQA 3I0EA 1WT3A 4KNXA 5C4DA 1QG8A 2OEGA 4HCQA 1H4CA 1W55A 4LW6A 1OMZA 2PGYA 1H5RB 2XWNA 3SXBA 5I1FA 5C3AA 4M2AA 1S4OA 3V91A 3CKQA 5L6SA 5CMIA 1G9RA 2JCLA 1G93A 3USRA 3V0QA 3ZGGA 1R7UA 2MZBA 5C4BA 1R7XA 4MNDA 5DDTA 3I0DA 2AH9A 4FRPA 1G97A 2YQJA 3K8EA 5FTVA 1ZI4A 1O0RA 1LZJA 1ZCYA 1R7VA 2RITA 2APCA 4CVHA 2E8BA 5C49A 3PNNA 3OAMA 1FR9A 1WT0A 4UEGA 1WT1A 3V0OA 5C3DA 5FUHA 1WSZA 1ZJPA 1FOAA 1GX4A 3R2WA 5FYEA 5C1LA 1ZI5A 1LZ7A 4AYJA 1ZCUA 1H7QA 3FOQA 1IINA 2AM4A 2Y4KA 3V0LA 2D7IA 3HL3A 2Y6PA 4FREA 2VS3A 2Y4MA 4NALA 1W57A 2BO6A 3V0NA 2V0KA 1IIMA 3Q4SA 3U0XA 4KPZA 5CMFX 5FU8A 3OGZA 2YESA 2YQCA 4FRAA 4ASYA 3SXEA 4HG6A 4G3PA 2W0WA 2ZU8A 4HO6A 1LL3A 3IOJA 3V90A 5L6VA 5FTSA 2YQHA 2WVLA 1H7HA 1S4PA 1VZXA 3U0YA 3CKVA 2X65A 2YQSA 4Y7TA 4ASJA 1TVYA 2FYBA 1ZDGA 4HO5A 2OI6A 1VICA 3Q7UA 1HM8A 1ZJ3A 1H5SA 4FRQA 1SS9A 1R7YA 1O7QA 1JVDA 4B2WA 1KWSA 2RIZA 4CJBA 2FY7A 4ARWA 3PKPA 4NANA 2PGVA 3ZLKA 1H4EA 5C4CA 2V0HA 2XMHA 2FFUA 4AYLA 1H5RA 4MYBA 3JTJA 4M2BA 1ZJ1A 4GBPA 5CQMX 1VH1A 4B4GA 4Y7FA 3N9WA 4AAWA 5IDSA 5C36A 1V84A 1H5SC 1R81A 2Z87A 3D98A 4FRLA 1H7FA 4EEOA 4FRHA 1ON6A 1WVCA 1FRWA 1EYRA 3D5NA 1ZIZA 2FFVA 2WVMA 3CKOA 3I0JA 3T7NA 4EVWA 2YC3A 2V0IA 3IOHA 1PZTA 5C4EA 1NWGB 4M28A 4KXOA 4L41C 3E26A 3F1CA 1O23B 3GUEA 5FV9A 1HV9A 4BQHA 1LZ0A 1XZ6A 2I5KA 4B3UA 2O1HA 3SXGA 4Y63A
chains in the Genus database with same CATH superfamily
3RMVA 1VPAA 4B5BA 1G0RA 1LL0A 3OC9A 5CQPA 2RJ0A 1GQCA 3I0LA 2A8WA 2NXVA 3RSBA 2C0NA 1ZJ2A 2VS4A 2BO4A 4EEMA 1GWWA 1YP2A 3I0FA 5CQLX 1MP3A 2QH5A 1PZYB 3I0CA 4Y9XA 1GX0A 2X5ZA 4O6MA 1NHEB 2AGDA 1G23A 3SXCA 2VS5A 2XWMA 1NF5B 2P73A 1VM8A 1VZUA 2AE7A 1FXOA 2XWLA 3CKJA 3Q80A 3QVBA 1EZIA 5C48A 1GA8A 1JYKA 4C2SA 1G8OA 2RJ9A 2OI5A 4YS8A 3U2VA 1H7EA 2AECA 1K4VA 3V8YA 3SX3A 4KNRA 1G1LA 3OH4A 2GGQA 1VGUA 2QGIA 3T7OA 1HJLA 5D92A 2X60A 4O6NA 3V8ZA 4D0TA 2D7RA 1TW1A 4G3SA 4AC3A 2Y4LA 1NMMB 1ZDFA 4DDZA 1H7TA 3POLA 5DDVA 5CMJA 4NAKA 1ZHJA 1O7OA 2CU2A 2O1GA 3KIAA 2VD4A 5CMHA 2Q4JA 5AJOA 4EEGA 2XMEA 4J18A 3OH1A 5IFYA 2DPWA 2RJ1A 2X5SA 1FO8A 4JD0A 3U2UA 2YCMA 1JYLA 1VZTA 1QGSA 2JCKA 2WEEA 1H5TA 4FRDA 5EJZA 4FIYA 1S4NA 2VFZA 3F1YA 4FRMA 2I5EA 3D8VA 2Z86A 5CQOA 4B42A 1YP4A 1GQ9A 3BRKX 2OI7A 1R82A 4XWIA 4FIXA 2O1FA 3JUJA 4FQWA 1MC3A 4G3QA 2QKXA 1Z90A 1FO9A 3TZTA 3PKQA 1NQIB 1I52A 3SX7A 3OH2A 4P02A 2I7BA 2OEFA 1FGGA 5FU0A 1H5TB 2PA4A 2RIYA 5CQNX 5C38A 2P6WA 3R3IA 1ZI1A 2A8UA 3USQA 3ST8A 5C3BA 3SXDA 3T7MA 3U2TA 2AESA 1G95A 1FGXA 5AJPA 2VSHA 1QWJA 4KC2A 1QGQA 3DUVA 2E3DA 2W0VA 4IRPA 3NGWA 2BO7A 3DK5A 1HJJA 1HM9A 1XHBA 4B4BA 4HO8A 1H4DA 3V0PA 5C1GA 3I0HA 4M4KA 4EEAA 5CMGX 1JVGA 1MP4A 3LW6A 5C1HA 2BO8A 1H7LA 1H3MA 1JV3A 4Y7VA 1FXJA 3I0IX 2ICXA 5C4FA 5JQQA 3ZF8A 5J49A 4HO9A 1INJA 4CJ8A 5C8RA 4HO3A 1JV1A 2RJ7A 1OQMB 2AM3A 1TZFA 3ZLLA 3SXAA 1TW5A 2RJ6A 4KT7A 3O3PA 3ZGFA 2PX7A 3I0GA 1R80A 4KC1A 4FCEA 4Q7CA 4LW3A 4EE3A 2ZU9A 2WAWA 3SPTA 1FWYA 2JCOA 4D48A 1V82A 4BMAA 3EE5A 4K6RA 3SX8A 4D11A 4HOCA 1ZCVA 2JCJA 1WT2A 1YP3A 3TQDA 3CKNA 2FYCB 1HM0A 2RJ5A 2VXMA 4FRBA 4R7PA 5BXCA 4FCUA 1W77A 3U2XA 2VSIA 4KC4A 1E5KA 2AM5A 5C47A 2VK9A 4KQLA 4MIXA 2RIXA 3IOIA 2WVKA 4KRVA 2J0AA 1LVWA 4D11C 1YROB 1LZIA 4JISA 5AJNA 1FR8A 4D0ZA 2WGZA 2RJ4A 1LL2A 4CJCA 2Y4JA 4ZDQA 1V83A 3U2WA 1INIA 2ICYA 3OH0A 1FG5N 5HS2A 3BCVA 1ZJOA 3SX5A 1ZI3A 2YC5A 1ON8A 3JUKA 3K8DA 3E25A 3V0MA 2P72A 3OH3A 1VH3A 2FYAA 5EIYA 4B4MA 4Y7GA 2GGOA 1OMXA 4B2XA 1G2VA 1G3LA 4P00A 4NAIA 2UX8A 4Y64A 4HO4A 2D0JA 4Y62A 4DE7A 4G87A 4Y6NA 4EE5A 3CGXA 1H5SD 2V0LA 3FWWA 4FROA 4ECMA 3DJ4A 1FZWA 2Y7AA 4EE4A 4HO2A 2RJ8A 2WE9A 2V0JA 4KPXA 4HO0A 1R7TA 5IDTA 1VGTA 2FYDB 5EJ1A 2ZU7A 1ZCTA 1VGZA 1H5SB 1H7GA 1ZJ0A 4Y6UA 1NKHB 1VGWA 4DECA 3CU0A 4Y7UA 3RMWA 1GWVA 2VXLA 3I0KA 3OKRA 4E1KA 1MP5A 4IRQA 3I0EA 1WT3A 4KNXA 5C4DA 1QG8A 2OEGA 4HCQA 1H4CA 1W55A 4LW6A 1OMZA 2PGYA 1H5RB 2XWNA 3SXBA 5I1FA 5C3AA 4M2AA 1S4OA 3V91A 3CKQA 5L6SA 5CMIA 1G9RA 2JCLA 1G93A 3USRA 3V0QA 3ZGGA 1R7UA 2MZBA 5C4BA 1R7XA 4MNDA 5DDTA 3I0DA 2AH9A 4FRPA 1G97A 2YQJA 3K8EA 5FTVA 1ZI4A 1O0RA 1LZJA 1ZCYA 1R7VA 2RITA 2APCA 4CVHA 2E8BA 5D91A 5C49A 3PNNA 3OAMA 1FR9A 1WT0A 4UEGA 1WT1A 3V0OA 5C3DA 5FUHA 1WSZA 1ZJPA 1FOAA 1GX4A 3R2WA 5FYEA 5C1LA 1ZI5A 1LZ7A 4AYJA 1ZCUA 1H7QA 3FOQA 1IINA 2AM4A 2Y4KA 3V0LA 2D7IA 3HL3A 2Y6PA 4FREA 2VS3A 2Y4MA 4NALA 1W57A 2BO6A 3V0NA 2V0KA 1IIMA 3Q4SA 3U0XA 4KPZA 5CMFX 5FU8A 3OGZA 2YESA 2YQCA 4FRAA 4ASYA 3SXEA 4HG6A 4G3PA 2W0WA 2ZU8A 4HO6A 1LL3A 3IOJA 3V90A 5L6VA 5FTSA 2YQHA 2WVLA 1H7HA 1S4PA 1VZXA 3U0YA 3CKVA 2X65A 2YQSA 4Y7TA 4ASJA 1TVYA 2FYBA 1ZDGA 4HO5A 2OI6A 1VICA 3Q7UA 1HM8A 1ZJ3A 1H5SA 2J0BA 4FRQA 1SS9A 1R7YA 1O7QA 1JVDA 4B2WA 1KWSA 2RIZA 4CJBA 2FY7A 4ARWA 3PKPA 4NANA 2PGVA 3ZLKA 1H4EA 5C4CA 2V0HA 2XMHA 2FFUA 4AYLA 1H5RA 4MYBA 3JTJA 4M2BA 1ZJ1A 4GBPA 5CQMX 1VH1A 4B4GA 4Y7FA 3N9WA 4AAWA 5IDSA 5C36A 1V84A 1H5SC 1R81A 2Z87A 3D98A 4FRLA 1H7FA 4EEOA 4FRHA 1ON6A 1WVCA 1FRWA 1EYRA 3D5NA 1ZIZA 2FFVA 2WVMA 3CKOA 3I0JA 3T7NA 4EVWA 2YC3A 2V0IA 3IOHA 1PZTA 5C4EA 1NWGB 4M28A 4KXOA 4L41C 3E26A 3F1CA 1O23B 3GUEA 5FV9A 1HV9A 4BQHA 1LZ0A 1XZ6A 2I5KA 4B3UA 2O1HA 3SXGA 4Y63A
chains in the Genus database with same CATH topology
3RMVA 1VPAA 4B5BA 1G0RA 1LL0A 3OC9A 5CQPA 2RJ0A 1GQCA 3I0LA 2A8WA 2NXVA 3RSBA 2C0NA 1ZJ2A 2VS4A 2BO4A 4EEMA 1GWWA 1YP2A 3I0FA 5CQLX 1MP3A 2QH5A 1PZYB 3I0CA 4Y9XA 1GX0A 2X5ZA 4O6MA 1NHEB 2AGDA 1G23A 3SXCA 2VS5A 2XWMA 1NF5B 2P73A 1VM8A 1VZUA 2AE7A 1FXOA 2XWLA 3CKJA 3Q80A 3QVBA 1EZIA 5C48A 1GA8A 1JYKA 4C2SA 1G8OA 2RJ9A 2OI5A 4YS8A 3U2VA 1H7EA 2AECA 1K4VA 3V8YA 3SX3A 4KNRA 1G1LA 3OH4A 2GGQA 1VGUA 2QGIA 3T7OA 1HJLA 5D92A 2X60A 4O6NA 3V8ZA 4D0TA 2D7RA 1TW1A 4G3SA 4AC3A 2Y4LA 1NMMB 1ZDFA 4DDZA 1H7TA 3POLA 5DDVA 5CMJA 4NAKA 1ZHJA 1O7OA 2CU2A 2O1GA 3KIAA 2VD4A 5CMHA 2Q4JA 5AJOA 4EEGA 2XMEA 4J18A 3OH1A 5IFYA 2DPWA 2RJ1A 2X5SA 1FO8A 4JD0A 3U2UA 2YCMA 1JYLA 1VZTA 1QGSA 2JCKA 2WEEA 1H5TA 4FRDA 5EJZA 4FIYA 1S4NA 2VFZA 3F1YA 4FRMA 2I5EA 3D8VA 2Z86A 5CQOA 4B42A 1YP4A 1GQ9A 3BRKX 2OI7A 1R82A 4XWIA 4FIXA 2O1FA 3JUJA 4FQWA 1MC3A 4G3QA 2QKXA 1Z90A 1FO9A 3TZTA 3PKQA 1NQIB 1I52A 3SX7A 3OH2A 4P02A 2I7BA 2OEFA 1FGGA 5FU0A 1H5TB 2PA4A 2RIYA 5CQNX 5C38A 2P6WA 3R3IA 1ZI1A 2A8UA 3USQA 3ST8A 5C3BA 3SXDA 3T7MA 3U2TA 2AESA 1G95A 1FGXA 5AJPA 2VSHA 1QWJA 4KC2A 1QGQA 3DUVA 2E3DA 2W0VA 4IRPA 3NGWA 2BO7A 3DK5A 1HJJA 1HM9A 1XHBA 4B4BA 4HO8A 1H4DA 3V0PA 5C1GA 3I0HA 4M4KA 4EEAA 5CMGX 1JVGA 1MP4A 3LW6A 5C1HA 2BO8A 1H7LA 1H3MA 1JV3A 4Y7VA 1FXJA 3I0IX 2ICXA 5C4FA 5JQQA 3ZF8A 5J49A 4HO9A 1INJA 4CJ8A 5C8RA 4HO3A 1JV1A 2RJ7A 1OQMB 2AM3A 1TZFA 3ZLLA 3SXAA 1TW5A 2RJ6A 4KT7A 3O3PA 3ZGFA 2PX7A 3I0GA 1R80A 4KC1A 4FCEA 4Q7CA 4LW3A 4EE3A 2ZU9A 2WAWA 3SPTA 1FWYA 2JCOA 4D48A 1V82A 4BMAA 3EE5A 4K6RA 3SX8A 4D11A 4HOCA 1ZCVA 2JCJA 1WT2A 1YP3A 3TQDA 3CKNA 2FYCB 1HM0A 2RJ5A 2VXMA 4FRBA 4R7PA 5BXCA 4FCUA 1W77A 3U2XA 2VSIA 4KC4A 1E5KA 2AM5A 5C47A 2VK9A 4KQLA 4MIXA 2RIXA 3IOIA 2WVKA 4KRVA 2J0AA 1LVWA 4D11C 1YROB 1LZIA 4JISA 5AJNA 1FR8A 4D0ZA 2WGZA 2RJ4A 1LL2A 4CJCA 2Y4JA 4ZDQA 1V83A 3U2WA 1INIA 2ICYA 3OH0A 1FG5N 5HS2A 3BCVA 1ZJOA 3SX5A 1ZI3A 2YC5A 1ON8A 3JUKA 3K8DA 3E25A 3V0MA 2P72A 3OH3A 1VH3A 2FYAA 5EIYA 4B4MA 4Y7GA 2GGOA 1OMXA 4B2XA 1G2VA 1G3LA 4P00A 4NAIA 2UX8A 4Y64A 4HO4A 2D0JA 4Y62A 4DE7A 4G87A 4Y6NA 4EE5A 3CGXA 1H5SD 2V0LA 3FWWA 4FROA 4ECMA 3DJ4A 1FZWA 2Y7AA 4EE4A 4HO2A 2RJ8A 2WE9A 2V0JA 4KPXA 4HO0A 1R7TA 5IDTA 1VGTA 2FYDB 5EJ1A 2ZU7A 1ZCTA 1VGZA 1H5SB 1H7GA 1ZJ0A 4Y6UA 1NKHB 1VGWA 4DECA 3CU0A 4Y7UA 3RMWA 1GWVA 2VXLA 3I0KA 3OKRA 4E1KA 1MP5A 4IRQA 3I0EA 1WT3A 4KNXA 5C4DA 1QG8A 2OEGA 4HCQA 1H4CA 1W55A 4LW6A 1OMZA 2PGYA 1H5RB 2XWNA 3SXBA 5I1FA 5C3AA 4M2AA 1S4OA 3V91A 3CKQA 5L6SA 5CMIA 1G9RA 2JCLA 1G93A 3USRA 3V0QA 3ZGGA 1R7UA 2MZBA 5C4BA 1R7XA 4MNDA 5DDTA 3I0DA 2AH9A 4FRPA 1G97A 2YQJA 3K8EA 5FTVA 1ZI4A 1O0RA 1LZJA 1ZCYA 1R7VA 2RITA 2APCA 4CVHA 2E8BA 5D91A 5C49A 3PNNA 3OAMA 1FR9A 1WT0A 4UEGA 1WT1A 3V0OA 5C3DA 5FUHA 1WSZA 1ZJPA 1FOAA 1GX4A 3R2WA 5FYEA 5C1LA 1ZI5A 1LZ7A 4AYJA 1ZCUA 1H7QA 3FOQA 1IINA 2AM4A 2Y4KA 3V0LA 2D7IA 3HL3A 2Y6PA 4FREA 2VS3A 2Y4MA 4NALA 1W57A 2BO6A 3V0NA 2V0KA 1IIMA 3Q4SA 3U0XA 4KPZA 5CMFX 5FU8A 3OGZA 2YESA 2YQCA 4FRAA 4ASYA 3SXEA 4HG6A 4G3PA 2W0WA 2ZU8A 4HO6A 1LL3A 3IOJA 3V90A 5L6VA 5FTSA 2YQHA 2WVLA 1H7HA 1S4PA 1VZXA 3U0YA 3CKVA 2X65A 2YQSA 4Y7TA 4ASJA 1TVYA 2FYBA 1ZDGA 4HO5A 2OI6A 1VICA 3Q7UA 1HM8A 1ZJ3A 1H5SA 2J0BA 4FRQA 1SS9A 1R7YA 1O7QA 1JVDA 4B2WA 1KWSA 2RIZA 4CJBA 2FY7A 4ARWA 3PKPA 4NANA 2PGVA 3ZLKA 1H4EA 5C4CA 2V0HA 2XMHA 2FFUA 4AYLA 1H5RA 4MYBA 3JTJA 4M2BA 1ZJ1A 4GBPA 5CQMX 1VH1A 4B4GA 4Y7FA 3N9WA 4AAWA 5IDSA 5C36A 1V84A 1H5SC 1R81A 2Z87A 3D98A 4FRLA 1H7FA 4EEOA 4FRHA 1ON6A 1WVCA 1FRWA 1EYRA 3D5NA 1ZIZA 2FFVA 2WVMA 3CKOA 3I0JA 3T7NA 4EVWA 2YC3A 2V0IA 3IOHA 1PZTA 5C4EA 1NWGB 4M28A 4KXOA 4L41C 3E26A 3F1CA 1O23B 3GUEA 5FV9A 1HV9A 4BQHA 1LZ0A 1XZ6A 2I5KA 4B3UA 2O1HA 3SXGA 4Y63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RMV A;  1VPA A;  4B5B A;  1G0R A;  1LL0 A;  3OC9 A;  5CQP A;  2RJ0 A;  1GQC A;  3I0L A;  2A8W A;  2NXV A;  3RSB A;  1ZJ2 A;  2VS4 A;  2BO4 A;  4EEM A;  1GWW A;  1YP2 A;  3I0F A;  5CQL X;  1MP3 A;  2QH5 A;  1PZY B;  3I0C A;  4Y9X A;  1GX0 A;  2X5Z A;  1NHE B;  2AGD A;  1G23 A;  3SXC A;  2VS5 A;  2XWM A;  1NF5 B;  2P73 A;  1VM8 A;  1VZU A;  2AE7 A;  1FXO A;  2XWL A;  3CKJ A;  3Q80 A;  3QVB A;  1EZI A;  5C48 A;  1GA8 A;  1JYK A;  4C2S A;  1G8O A;  2RJ9 A;  2OI5 A;  4YS8 A;  3U2V A;  1H7E A;  2AEC A;  1K4V A;  3V8Y A;  3SX3 A;  4KNR A;  1G1L A;  3OH4 A;  2GGQ A;  1VGU A;  2QGI A;  3T7O A;  1HJL A;  2X60 A;  3V8Z A;  4D0T A;  2D7R A;  1TW1 A;  4G3S A;  4AC3 A;  2Y4L A;  1NMM B;  1ZDF A;  4DDZ A;  1H7T A;  3POL A;  5DDV A;  5CMJ A;  4NAK A;  1ZHJ A;  1O7O A;  2CU2 A;  2O1G A;  3KIA A;  2VD4 A;  5CMH A;  2Q4J A;  5AJO A;  4EEG A;  2XME A;  4J18 A;  3OH1 A;  5IFY A;  2DPW A;  2RJ1 A;  2X5S A;  1FO8 A;  4JD0 A;  3U2U A;  2YCM A;  1JYL A;  1VZT A;  1QGS A;  2JCK A;  2WEE A;  1H5T A;  4FRD A;  5EJZ A;  1S4N A;  2VFZ A;  3F1Y A;  4FRM A;  3D8V A;  2I5E A;  2Z86 A;  5CQO A;  4B42 A;  1YP4 A;  1GQ9 A;  3BRK X;  2OI7 A;  1R82 A;  4XWI A;  2O1F A;  3JUJ A;  4FQW A;  1MC3 A;  4G3Q A;  2QKX A;  1Z90 A;  1FO9 A;  3TZT A;  3PKQ A;  1NQI B;  1I52 A;  3SX7 A;  3OH2 A;  4P02 A;  2I7B A;  2OEF A;  1FGG A;  5FU0 A;  1H5T B;  2PA4 A;  2RIY A;  5CQN X;  5C38 A;  2P6W A;  3R3I A;  1ZI1 A;  2A8U A;  3USQ A;  3ST8 A;  5C3B A;  3SXD A;  3T7M A;  3U2T A;  2AES A;  1G95 A;  1FGX A;  5AJP A;  2VSH A;  1QWJ A;  4KC2 A;  1QGQ A;  3DUV A;  2E3D A;  2W0V A;  4IRP A;  3NGW A;  2BO7 A;  3DK5 A;  1HJJ A;  1HM9 A;  1XHB A;  4B4B A;  4HO8 A;  1H4D A;  3V0P A;  5C1G A;  3I0H A;  4M4K A;  4EEA A;  5CMG X;  1JVG A;  1MP4 A;  3LW6 A;  5C1H A;  2BO8 A;  1H7L A;  1H3M A;  1JV3 A;  4Y7V A;  1FXJ A;  3I0I X;  2ICX A;  5C4F A;  5JQQ A;  3ZF8 A;  5J49 A;  4HO9 A;  1INJ A;  4CJ8 A;  5C8R A;  4HO3 A;  1JV1 A;  2RJ7 A;  1OQM B;  2AM3 A;  1TZF A;  3ZLL A;  3SXA A;  1TW5 A;  2RJ6 A;  4KT7 A;  3O3P A;  3ZGF A;  2PX7 A;  3I0G A;  1R80 A;  4KC1 A;  4FCE A;  4LW3 A;  4EE3 A;  2ZU9 A;  2WAW A;  3SPT A;  1FWY A;  2JCO A;  4D48 A;  1V82 A;  4BMA A;  3EE5 A;  4K6R A;  3SX8 A;  4D11 A;  4HOC A;  1ZCV A;  2JCJ A;  1WT2 A;  1YP3 A;  3TQD A;  3CKN A;  2FYC B;  1HM0 A;  2RJ5 A;  2VXM A;  4FRB A;  4R7P A;  5BXC A;  4FCU A;  1W77 A;  3U2X A;  2VSI A;  4KC4 A;  1E5K A;  2AM5 A;  5C47 A;  4KQL A;  2RIX A;  3IOI A;  2WVK A;  4KRV A;  1LVW A;  4D11 C;  1YRO B;  1LZI A;  4JIS A;  5AJN A;  1FR8 A;  4D0Z A;  2WGZ A;  2RJ4 A;  1LL2 A;  4CJC A;  2Y4J A;  4ZDQ A;  1V83 A;  3U2W A;  1INI A;  2ICY A;  3OH0 A;  1FG5 N;  5HS2 A;  3BCV A;  1ZJO A;  3SX5 A;  1ZI3 A;  2YC5 A;  1ON8 A;  3JUK A;  3K8D A;  3E25 A;  3V0M A;  2P72 A;  3OH3 A;  1VH3 A;  2FYA A;  5EIY A;  4B4M A;  4Y7G A;  2GGO A;  1OMX A;  4B2X A;  1G2V A;  1G3L A;  4P00 A;  4NAI A;  2UX8 A;  4Y64 A;  4HO4 A;  2D0J A;  4Y62 A;  4DE7 A;  4G87 A;  4Y6N A;  4EE5 A;  3CGX A;  1H5S D;  2V0L A;  3FWW A;  4FRO A;  4ECM A;  3DJ4 A;  1FZW A;  2Y7A A;  4EE4 A;  4HO2 A;  2RJ8 A;  2WE9 A;  2V0J A;  4KPX A;  4HO0 A;  1R7T A;  5IDT A;  1VGT A;  2FYD B;  5EJ1 A;  2ZU7 A;  1ZCT A;  1VGZ A;  1H5S B;  1H7G A;  1ZJ0 A;  4Y6U A;  1NKH B;  1VGW A;  4DEC A;  3CU0 A;  4Y7U A;  3RMW A;  1GWV A;  2VXL A;  3I0K A;  3OKR A;  4E1K A;  1MP5 A;  4IRQ A;  3I0E A;  1WT3 A;  4KNX A;  5C4D A;  1QG8 A;  2OEG A;  4HCQ A;  1H4C A;  1W55 A;  4LW6 A;  1OMZ A;  2PGY A;  1H5R B;  2XWN A;  3SXB A;  5I1F A;  5C3A A;  4M2A A;  1S4O A;  3V91 A;  3CKQ A;  5L6S A;  5CMI A;  1G9R A;  2JCL A;  1G93 A;  3USR A;  3V0Q A;  3ZGG A;  1R7U A;  2MZB A;  5C4B A;  1R7X A;  4MND A;  5DDT A;  3I0D A;  2AH9 A;  4FRP A;  1G97 A;  2YQJ A;  3K8E A;  5FTV A;  1ZI4 A;  1O0R A;  1LZJ A;  1ZCY A;  1R7V A;  2RIT A;  2APC A;  4CVH A;  2E8B A;  5C49 A;  3PNN A;  3OAM A;  1FR9 A;  1WT0 A;  4UEG A;  1WT1 A;  3V0O A;  5C3D A;  5FUH A;  1WSZ A;  1ZJP A;  1FOA A;  1GX4 A;  3R2W A;  5FYE A;  5C1L A;  1ZI5 A;  1LZ7 A;  4AYJ A;  1ZCU A;  1H7Q A;  3FOQ A;  1IIN A;  2AM4 A;  2Y4K A;  3V0L A;  2D7I A;  3HL3 A;  2Y6P A;  4FRE A;  2VS3 A;  2Y4M A;  4NAL A;  1W57 A;  2BO6 A;  3V0N A;  2V0K A;  1IIM A;  3Q4S A;  3U0X A;  4KPZ A;  5CMF X;  5FU8 A;  3OGZ A;  2YES A;  2YQC A;  4FRA A;  4ASY A;  3SXE A;  4HG6 A;  4G3P A;  2W0W A;  2ZU8 A;  4HO6 A;  1LL3 A;  3IOJ A;  3V90 A;  5L6V A;  5FTS A;  2YQH A;  2WVL A;  1H7H A;  1S4P A;  1VZX A;  3U0Y A;  3CKV A;  2X65 A;  2YQS A;  4Y7T A;  4ASJ A;  1TVY A;  2FYB A;  1ZDG A;  4HO5 A;  2OI6 A;  1VIC A;  3Q7U A;  1HM8 A;  1ZJ3 A;  1H5S A;  4FRQ A;  1SS9 A;  1R7Y A;  1O7Q A;  1JVD A;  4B2W A;  1KWS A;  2RIZ A;  4CJB A;  2FY7 A;  4ARW A;  3PKP A;  4NAN A;  2PGV A;  3ZLK A;  1H4E A;  5C4C A;  2V0H A;  2XMH A;  2FFU A;  4AYL A;  1H5R A;  4MYB A;  3JTJ A;  4M2B A;  1ZJ1 A;  4GBP A;  5CQM X;  1VH1 A;  4B4G A;  4Y7F A;  3N9W A;  4AAW A;  5IDS A;  5C36 A;  1V84 A;  1H5S C;  1R81 A;  2Z87 A;  3D98 A;  4FRL A;  1H7F A;  4EEO A;  4FRH A;  1ON6 A;  1WVC A;  1FRW A;  1EYR A;  3D5N A;  1ZIZ A;  2FFV A;  2WVM A;  3CKO A;  3I0J A;  3T7N A;  4EVW A;  2YC3 A;  2V0I A;  3IOH A;  1PZT A;  5C4E A;  1NWG B;  4M28 A;  4KXO A;  4L41 C;  3E26 A;  3F1C A;  1O23 B;  3GUE A;  5FV9 A;  1HV9 A;  4BQH A;  1LZ0 A;  1XZ6 A;  2I5K A;  4B3U A;  2O1H A;  3SXG A;  4Y63 A; 
#chains in the Genus database with same CATH topology
 3RMV A;  1VPA A;  4B5B A;  1G0R A;  1LL0 A;  3OC9 A;  5CQP A;  2RJ0 A;  1GQC A;  3I0L A;  2A8W A;  2NXV A;  3RSB A;  2C0N A;  1ZJ2 A;  2VS4 A;  2BO4 A;  4EEM A;  1GWW A;  1YP2 A;  3I0F A;  5CQL X;  1MP3 A;  2QH5 A;  1PZY B;  3I0C A;  4Y9X A;  1GX0 A;  2X5Z A;  4O6M A;  1NHE B;  2AGD A;  1G23 A;  3SXC A;  2VS5 A;  2XWM A;  1NF5 B;  2P73 A;  1VM8 A;  1VZU A;  2AE7 A;  1FXO A;  2XWL A;  3CKJ A;  3Q80 A;  3QVB A;  1EZI A;  5C48 A;  1GA8 A;  1JYK A;  4C2S A;  1G8O A;  2RJ9 A;  2OI5 A;  4YS8 A;  3U2V A;  1H7E A;  2AEC A;  1K4V A;  3V8Y A;  3SX3 A;  4KNR A;  1G1L A;  3OH4 A;  2GGQ A;  1VGU A;  2QGI A;  3T7O A;  1HJL A;  5D92 A;  2X60 A;  4O6N A;  3V8Z A;  4D0T A;  2D7R A;  1TW1 A;  4G3S A;  4AC3 A;  2Y4L A;  1NMM B;  1ZDF A;  4DDZ A;  1H7T A;  3POL A;  5DDV A;  5CMJ A;  4NAK A;  1ZHJ A;  1O7O A;  2CU2 A;  2O1G A;  3KIA A;  2VD4 A;  5CMH A;  2Q4J A;  5AJO A;  4EEG A;  2XME A;  4J18 A;  3OH1 A;  5IFY A;  2DPW A;  2RJ1 A;  2X5S A;  1FO8 A;  4JD0 A;  3U2U A;  2YCM A;  1JYL A;  1VZT A;  1QGS A;  2JCK A;  2WEE A;  1H5T A;  4FRD A;  5EJZ A;  4FIY A;  1S4N A;  2VFZ A;  3F1Y A;  4FRM A;  2I5E A;  3D8V A;  2Z86 A;  5CQO A;  4B42 A;  1YP4 A;  1GQ9 A;  3BRK X;  2OI7 A;  1R82 A;  4XWI A;  4FIX A;  2O1F A;  3JUJ A;  4FQW A;  1MC3 A;  4G3Q A;  2QKX A;  1Z90 A;  1FO9 A;  3TZT A;  3PKQ A;  1NQI B;  1I52 A;  3SX7 A;  3OH2 A;  4P02 A;  2I7B A;  2OEF A;  1FGG A;  5FU0 A;  1H5T B;  2PA4 A;  2RIY A;  5CQN X;  5C38 A;  2P6W A;  3R3I A;  1ZI1 A;  2A8U A;  3USQ A;  3ST8 A;  5C3B A;  3SXD A;  3T7M A;  3U2T A;  2AES A;  1G95 A;  1FGX A;  5AJP A;  2VSH A;  1QWJ A;  4KC2 A;  1QGQ A;  3DUV A;  2E3D A;  2W0V A;  4IRP A;  3NGW A;  2BO7 A;  3DK5 A;  1HJJ A;  1HM9 A;  1XHB A;  4B4B A;  4HO8 A;  1H4D A;  3V0P A;  5C1G A;  3I0H A;  4M4K A;  4EEA A;  5CMG X;  1JVG A;  1MP4 A;  3LW6 A;  5C1H A;  2BO8 A;  1H7L A;  1H3M A;  1JV3 A;  4Y7V A;  1FXJ A;  3I0I X;  2ICX A;  5C4F A;  5JQQ A;  3ZF8 A;  5J49 A;  4HO9 A;  1INJ A;  4CJ8 A;  5C8R A;  4HO3 A;  1JV1 A;  2RJ7 A;  1OQM B;  2AM3 A;  1TZF A;  3ZLL A;  3SXA A;  1TW5 A;  2RJ6 A;  4KT7 A;  3O3P A;  3ZGF A;  2PX7 A;  3I0G A;  1R80 A;  4KC1 A;  4FCE A;  4Q7C A;  4LW3 A;  4EE3 A;  2ZU9 A;  2WAW A;  3SPT A;  1FWY A;  2JCO A;  4D48 A;  1V82 A;  4BMA A;  3EE5 A;  4K6R A;  3SX8 A;  4D11 A;  4HOC A;  1ZCV A;  2JCJ A;  1WT2 A;  1YP3 A;  3TQD A;  3CKN A;  2FYC B;  1HM0 A;  2RJ5 A;  2VXM A;  4FRB A;  4R7P A;  5BXC A;  4FCU A;  1W77 A;  3U2X A;  2VSI A;  4KC4 A;  1E5K A;  2AM5 A;  5C47 A;  2VK9 A;  4KQL A;  4MIX A;  2RIX A;  3IOI A;  2WVK A;  4KRV A;  2J0A A;  1LVW A;  4D11 C;  1YRO B;  1LZI A;  4JIS A;  5AJN A;  1FR8 A;  4D0Z A;  2WGZ A;  2RJ4 A;  1LL2 A;  4CJC A;  2Y4J A;  4ZDQ A;  1V83 A;  3U2W A;  1INI A;  2ICY A;  3OH0 A;  1FG5 N;  5HS2 A;  3BCV A;  1ZJO A;  3SX5 A;  1ZI3 A;  2YC5 A;  1ON8 A;  3JUK A;  3K8D A;  3E25 A;  3V0M A;  2P72 A;  3OH3 A;  1VH3 A;  2FYA A;  5EIY A;  4B4M A;  4Y7G A;  2GGO A;  1OMX A;  4B2X A;  1G2V A;  1G3L A;  4P00 A;  4NAI A;  2UX8 A;  4Y64 A;  4HO4 A;  2D0J A;  4Y62 A;  4DE7 A;  4G87 A;  4Y6N A;  4EE5 A;  3CGX A;  1H5S D;  2V0L A;  3FWW A;  4FRO A;  4ECM A;  3DJ4 A;  1FZW A;  2Y7A A;  4EE4 A;  4HO2 A;  2RJ8 A;  2WE9 A;  2V0J A;  4KPX A;  4HO0 A;  1R7T A;  5IDT A;  1VGT A;  2FYD B;  5EJ1 A;  2ZU7 A;  1ZCT A;  1VGZ A;  1H5S B;  1H7G A;  1ZJ0 A;  4Y6U A;  1NKH B;  1VGW A;  4DEC A;  3CU0 A;  4Y7U A;  3RMW A;  1GWV A;  2VXL A;  3I0K A;  3OKR A;  4E1K A;  1MP5 A;  4IRQ A;  3I0E A;  1WT3 A;  4KNX A;  5C4D A;  1QG8 A;  2OEG A;  4HCQ A;  1H4C A;  1W55 A;  4LW6 A;  1OMZ A;  2PGY A;  1H5R B;  2XWN A;  3SXB A;  5I1F A;  5C3A A;  4M2A A;  1S4O A;  3V91 A;  3CKQ A;  5L6S A;  5CMI A;  1G9R A;  2JCL A;  1G93 A;  3USR A;  3V0Q A;  3ZGG A;  1R7U A;  2MZB A;  5C4B A;  1R7X A;  4MND A;  5DDT A;  3I0D A;  2AH9 A;  4FRP A;  1G97 A;  2YQJ A;  3K8E A;  5FTV A;  1ZI4 A;  1O0R A;  1LZJ A;  1ZCY A;  1R7V A;  2RIT A;  2APC A;  4CVH A;  2E8B A;  5D91 A;  5C49 A;  3PNN A;  3OAM A;  1FR9 A;  1WT0 A;  4UEG A;  1WT1 A;  3V0O A;  5C3D A;  5FUH A;  1WSZ A;  1ZJP A;  1FOA A;  1GX4 A;  3R2W A;  5FYE A;  5C1L A;  1ZI5 A;  1LZ7 A;  4AYJ A;  1ZCU A;  1H7Q A;  3FOQ A;  1IIN A;  2AM4 A;  2Y4K A;  3V0L A;  2D7I A;  3HL3 A;  2Y6P A;  4FRE A;  2VS3 A;  2Y4M A;  4NAL A;  1W57 A;  2BO6 A;  3V0N A;  2V0K A;  1IIM A;  3Q4S A;  3U0X A;  4KPZ A;  5CMF X;  5FU8 A;  3OGZ A;  2YES A;  2YQC A;  4FRA A;  4ASY A;  3SXE A;  4HG6 A;  4G3P A;  2W0W A;  2ZU8 A;  4HO6 A;  1LL3 A;  3IOJ A;  3V90 A;  5L6V A;  5FTS A;  2YQH A;  2WVL A;  1H7H A;  1S4P A;  1VZX A;  3U0Y A;  3CKV A;  2X65 A;  2YQS A;  4Y7T A;  4ASJ A;  1TVY A;  2FYB A;  1ZDG A;  4HO5 A;  2OI6 A;  1VIC A;  3Q7U A;  1HM8 A;  1ZJ3 A;  1H5S A;  2J0B A;  4FRQ A;  1SS9 A;  1R7Y A;  1O7Q A;  1JVD A;  4B2W A;  1KWS A;  2RIZ A;  4CJB A;  2FY7 A;  4ARW A;  3PKP A;  4NAN A;  2PGV A;  3ZLK A;  1H4E A;  5C4C A;  2V0H A;  2XMH A;  2FFU A;  4AYL A;  1H5R A;  4MYB A;  3JTJ A;  4M2B A;  1ZJ1 A;  4GBP A;  5CQM X;  1VH1 A;  4B4G A;  4Y7F A;  3N9W A;  4AAW A;  5IDS A;  5C36 A;  1V84 A;  1H5S C;  1R81 A;  2Z87 A;  3D98 A;  4FRL A;  1H7F A;  4EEO A;  4FRH A;  1ON6 A;  1WVC A;  1FRW A;  1EYR A;  3D5N A;  1ZIZ A;  2FFV A;  2WVM A;  3CKO A;  3I0J A;  3T7N A;  4EVW A;  2YC3 A;  2V0I A;  3IOH A;  1PZT A;  5C4E A;  1NWG B;  4M28 A;  4KXO A;  4L41 C;  3E26 A;  3F1C A;  1O23 B;  3GUE A;  5FV9 A;  1HV9 A;  4BQH A;  1LZ0 A;  1XZ6 A;  2I5K A;  4B3U A;  2O1H A;  3SXG A;  4Y63 A; 
#chains in the Genus database with same CATH homology
 3RMV A;  1VPA A;  4B5B A;  1G0R A;  1LL0 A;  3OC9 A;  5CQP A;  2RJ0 A;  1GQC A;  3I0L A;  2A8W A;  2NXV A;  3RSB A;  2C0N A;  1ZJ2 A;  2VS4 A;  2BO4 A;  4EEM A;  1GWW A;  1YP2 A;  3I0F A;  5CQL X;  1MP3 A;  2QH5 A;  1PZY B;  3I0C A;  4Y9X A;  1GX0 A;  2X5Z A;  4O6M A;  1NHE B;  2AGD A;  1G23 A;  3SXC A;  2VS5 A;  2XWM A;  1NF5 B;  2P73 A;  1VM8 A;  1VZU A;  2AE7 A;  1FXO A;  2XWL A;  3CKJ A;  3Q80 A;  3QVB A;  1EZI A;  5C48 A;  1GA8 A;  1JYK A;  4C2S A;  1G8O A;  2RJ9 A;  2OI5 A;  4YS8 A;  3U2V A;  1H7E A;  2AEC A;  1K4V A;  3V8Y A;  3SX3 A;  4KNR A;  1G1L A;  3OH4 A;  2GGQ A;  1VGU A;  2QGI A;  3T7O A;  1HJL A;  5D92 A;  2X60 A;  4O6N A;  3V8Z A;  4D0T A;  2D7R A;  1TW1 A;  4G3S A;  4AC3 A;  2Y4L A;  1NMM B;  1ZDF A;  4DDZ A;  1H7T A;  3POL A;  5DDV A;  5CMJ A;  4NAK A;  1ZHJ A;  1O7O A;  2CU2 A;  2O1G A;  3KIA A;  2VD4 A;  5CMH A;  2Q4J A;  5AJO A;  4EEG A;  2XME A;  4J18 A;  3OH1 A;  5IFY A;  2DPW A;  2RJ1 A;  2X5S A;  1FO8 A;  4JD0 A;  3U2U A;  2YCM A;  1JYL A;  1VZT A;  1QGS A;  2JCK A;  2WEE A;  1H5T A;  4FRD A;  5EJZ A;  4FIY A;  1S4N A;  2VFZ A;  3F1Y A;  4FRM A;  2I5E A;  3D8V A;  2Z86 A;  5CQO A;  4B42 A;  1YP4 A;  1GQ9 A;  3BRK X;  2OI7 A;  1R82 A;  4XWI A;  4FIX A;  2O1F A;  3JUJ A;  4FQW A;  1MC3 A;  4G3Q A;  2QKX A;  1Z90 A;  1FO9 A;  3TZT A;  3PKQ A;  1NQI B;  1I52 A;  3SX7 A;  3OH2 A;  4P02 A;  2I7B A;  2OEF A;  1FGG A;  5FU0 A;  1H5T B;  2PA4 A;  2RIY A;  5CQN X;  5C38 A;  2P6W A;  3R3I A;  1ZI1 A;  2A8U A;  3USQ A;  3ST8 A;  5C3B A;  3SXD A;  3T7M A;  3U2T A;  2AES A;  1G95 A;  1FGX A;  5AJP A;  2VSH A;  1QWJ A;  4KC2 A;  1QGQ A;  3DUV A;  2E3D A;  2W0V A;  4IRP A;  3NGW A;  2BO7 A;  3DK5 A;  1HJJ A;  1HM9 A;  1XHB A;  4B4B A;  4HO8 A;  1H4D A;  3V0P A;  5C1G A;  3I0H A;  4M4K A;  4EEA A;  5CMG X;  1JVG A;  1MP4 A;  3LW6 A;  5C1H A;  2BO8 A;  1H7L A;  1H3M A;  1JV3 A;  4Y7V A;  1FXJ A;  3I0I X;  2ICX A;  5C4F A;  5JQQ A;  3ZF8 A;  5J49 A;  4HO9 A;  1INJ A;  4CJ8 A;  5C8R A;  4HO3 A;  1JV1 A;  2RJ7 A;  1OQM B;  2AM3 A;  1TZF A;  3ZLL A;  3SXA A;  1TW5 A;  2RJ6 A;  4KT7 A;  3O3P A;  3ZGF A;  2PX7 A;  3I0G A;  1R80 A;  4KC1 A;  4FCE A;  4Q7C A;  4LW3 A;  4EE3 A;  2ZU9 A;  2WAW A;  3SPT A;  1FWY A;  2JCO A;  4D48 A;  1V82 A;  4BMA A;  3EE5 A;  4K6R A;  3SX8 A;  4D11 A;  4HOC A;  1ZCV A;  2JCJ A;  1WT2 A;  1YP3 A;  3TQD A;  3CKN A;  2FYC B;  1HM0 A;  2RJ5 A;  2VXM A;  4FRB A;  4R7P A;  5BXC A;  4FCU A;  1W77 A;  3U2X A;  2VSI A;  4KC4 A;  1E5K A;  2AM5 A;  5C47 A;  2VK9 A;  4KQL A;  4MIX A;  2RIX A;  3IOI A;  2WVK A;  4KRV A;  2J0A A;  1LVW A;  4D11 C;  1YRO B;  1LZI A;  4JIS A;  5AJN A;  1FR8 A;  4D0Z A;  2WGZ A;  2RJ4 A;  1LL2 A;  4CJC A;  2Y4J A;  4ZDQ A;  1V83 A;  3U2W A;  1INI A;  2ICY A;  3OH0 A;  1FG5 N;  5HS2 A;  3BCV A;  1ZJO A;  3SX5 A;  1ZI3 A;  2YC5 A;  1ON8 A;  3JUK A;  3K8D A;  3E25 A;  3V0M A;  2P72 A;  3OH3 A;  1VH3 A;  2FYA A;  5EIY A;  4B4M A;  4Y7G A;  2GGO A;  1OMX A;  4B2X A;  1G2V A;  1G3L A;  4P00 A;  4NAI A;  2UX8 A;  4Y64 A;  4HO4 A;  2D0J A;  4Y62 A;  4DE7 A;  4G87 A;  4Y6N A;  4EE5 A;  3CGX A;  1H5S D;  2V0L A;  3FWW A;  4FRO A;  4ECM A;  3DJ4 A;  1FZW A;  2Y7A A;  4EE4 A;  4HO2 A;  2RJ8 A;  2WE9 A;  2V0J A;  4KPX A;  4HO0 A;  1R7T A;  5IDT A;  1VGT A;  2FYD B;  5EJ1 A;  2ZU7 A;  1ZCT A;  1VGZ A;  1H5S B;  1H7G A;  1ZJ0 A;  4Y6U A;  1NKH B;  1VGW A;  4DEC A;  3CU0 A;  4Y7U A;  3RMW A;  1GWV A;  2VXL A;  3I0K A;  3OKR A;  4E1K A;  1MP5 A;  4IRQ A;  3I0E A;  1WT3 A;  4KNX A;  5C4D A;  1QG8 A;  2OEG A;  4HCQ A;  1H4C A;  1W55 A;  4LW6 A;  1OMZ A;  2PGY A;  1H5R B;  2XWN A;  3SXB A;  5I1F A;  5C3A A;  4M2A A;  1S4O A;  3V91 A;  3CKQ A;  5L6S A;  5CMI A;  1G9R A;  2JCL A;  1G93 A;  3USR A;  3V0Q A;  3ZGG A;  1R7U A;  2MZB A;  5C4B A;  1R7X A;  4MND A;  5DDT A;  3I0D A;  2AH9 A;  4FRP A;  1G97 A;  2YQJ A;  3K8E A;  5FTV A;  1ZI4 A;  1O0R A;  1LZJ A;  1ZCY A;  1R7V A;  2RIT A;  2APC A;  4CVH A;  2E8B A;  5D91 A;  5C49 A;  3PNN A;  3OAM A;  1FR9 A;  1WT0 A;  4UEG A;  1WT1 A;  3V0O A;  5C3D A;  5FUH A;  1WSZ A;  1ZJP A;  1FOA A;  1GX4 A;  3R2W A;  5FYE A;  5C1L A;  1ZI5 A;  1LZ7 A;  4AYJ A;  1ZCU A;  1H7Q A;  3FOQ A;  1IIN A;  2AM4 A;  2Y4K A;  3V0L A;  2D7I A;  3HL3 A;  2Y6P A;  4FRE A;  2VS3 A;  2Y4M A;  4NAL A;  1W57 A;  2BO6 A;  3V0N A;  2V0K A;  1IIM A;  3Q4S A;  3U0X A;  4KPZ A;  5CMF X;  5FU8 A;  3OGZ A;  2YES A;  2YQC A;  4FRA A;  4ASY A;  3SXE A;  4HG6 A;  4G3P A;  2W0W A;  2ZU8 A;  4HO6 A;  1LL3 A;  3IOJ A;  3V90 A;  5L6V A;  5FTS A;  2YQH A;  2WVL A;  1H7H A;  1S4P A;  1VZX A;  3U0Y A;  3CKV A;  2X65 A;  2YQS A;  4Y7T A;  4ASJ A;  1TVY A;  2FYB A;  1ZDG A;  4HO5 A;  2OI6 A;  1VIC A;  3Q7U A;  1HM8 A;  1ZJ3 A;  1H5S A;  2J0B A;  4FRQ A;  1SS9 A;  1R7Y A;  1O7Q A;  1JVD A;  4B2W A;  1KWS A;  2RIZ A;  4CJB A;  2FY7 A;  4ARW A;  3PKP A;  4NAN A;  2PGV A;  3ZLK A;  1H4E A;  5C4C A;  2V0H A;  2XMH A;  2FFU A;  4AYL A;  1H5R A;  4MYB A;  3JTJ A;  4M2B A;  1ZJ1 A;  4GBP A;  5CQM X;  1VH1 A;  4B4G A;  4Y7F A;  3N9W A;  4AAW A;  5IDS A;  5C36 A;  1V84 A;  1H5S C;  1R81 A;  2Z87 A;  3D98 A;  4FRL A;  1H7F A;  4EEO A;  4FRH A;  1ON6 A;  1WVC A;  1FRW A;  1EYR A;  3D5N A;  1ZIZ A;  2FFV A;  2WVM A;  3CKO A;  3I0J A;  3T7N A;  4EVW A;  2YC3 A;  2V0I A;  3IOH A;  1PZT A;  5C4E A;  1NWG B;  4M28 A;  4KXO A;  4L41 C;  3E26 A;  3F1C A;  1O23 B;  3GUE A;  5FV9 A;  1HV9 A;  4BQH A;  1LZ0 A;  1XZ6 A;  2I5K A;  4B3U A;  2O1H A;  3SXG A;  4Y63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...