1WT3A

Mutant human abo(h) blood group glycosyltransferase with bound udp and acceptor
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
283
structure length
263
Chain Sequence
MVSLPRMVYPQSKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGRFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histo-blood group ABO system transferase
publication title Structural basis for the inactivity of human blood group o2 glycosyltransferase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 263
sequence length 283
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2004-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1wt3A00
3V0PA 3GUEA 1R7XA 3OC9A 1O0RA 1H7FA 2RJ6A 2MZBA 2UX8A 4KNRA 1H5RB 2JCJA 1FXJA 1ON8A 4B3UA 5C4DA 2XMEA 4AYLA 4J18A 3U2VA 2V0KA 4Y7TA 2RJ8A 2YQHA 4EE3A 2RITA 1JVDA 3U0YA 1GQ9A 2WVKA 1ZI3A 4M4KA 1ZHJA 2VXMA 1H5TB 1S4PA 1R80A 4HO4A 2OI7A 1G97A 1ZCVA 5C1HA 2D7RA 1ZJOA 2FYDB 5C3AA 3V0LA 2AM3A 4LW6A 1MP4A 5FYEA 1WT1A 2YQCA 4Y6NA 1E5KA 2AGDA 3DK5A 3OH3A 4NAKA 3D98A 3R3IA 3F1YA 3SXBA 1YROB 2BO8A 3CKNA 4FCUA 5CMGX 3D5NA 4B4GA 1VZXA 3I0JA 5FU0A 1FO8A 4DECA 4P02A 3HL3A 2Y7AA 1H5SA 1OMZA 1R7YA 3OH0A 2AE7A 2ZU7A 2Y4MA 5FV9A 2O1GA 2I5EA 2WE9A 3FOQA 1QWJA 1FO9A 1PZTA 1HM0A 4HO0A 4FRQA 3RMVA 1ZJ0A 3ZLLA 1W55A 4FRPA 3V0NA 5CQMX 2YC5A 1H7LA 4UEGA 5L6SA 1H7TA 1JV1A 3OKRA 1R81A 2OI5A 3ZGGA 4HO6A 1LZ0A 5FTVA 3KIAA 1FZWA 1S4NA 1VGWA 1K4VA 3SX3A 2YC3A 1HJLA 4EEGA 2Y4JA 3I0KA 1FGGA 3IOIA 1VZTA 1OQMB 1ZI5A 4NALA 3N9WA 1R82A 2O1HA 1IINA 2X65A 2X60A 2DPWA 1WT0A 4MYBA 4EVWA 1MP3A 1R7VA 4KC4A 4HO3A 4C2SA 3OGZA 2RJ0A 4ZDQA 2E8BA 2V0LA 5CMIA 1R7TA 3SX5A 3T7NA 4G3SA 1XHBA 4HO5A 3V90A 3ZLKA 2BO4A 5C48A 2Y4KA 1ZI1A 3CKQA 4P00A 1JYKA 3I0HA 3Q7UA 1FRWA 2Z86A 4FRLA 2V0JA 5CMJA 1TZFA 1V83A 1WSZA 4FRHA 5L6VA 1FG5N 2JCKA 4G3PA 1TVYA 4EE5A 5CQLX 1ZDFA 1H7GA 2AM5A 1O23B 1ZJ3A 1NMMB 1LZ7A 1VH3A 3U2TA 4FRDA 4Y6UA 5CMFX 1HM9A 3PKPA 2XMHA 4B42A 3I0LA 4R7PA 2GGOA 2WVMA 2Z87A 3Q4SA 4HG6A 4ARWA 1GA8A 3F1CA 1G2VA 3O3PA 4Y9XA 5C36A 1W57A 3U2WA 1YP2A 2W0WA 1ZJ2A 1Z90A 2FYBA 3DJ4A 4IRQA 1ZCUA 2OEGA 1QGQA 5C3BA 2OI6A 1KWSA 1JV3A 1R7UA 2O1FA 4KQLA 4K6RA 3JUKA 2AESA 4Y7UA 5FU8A 3CGXA 4Y7VA 2BO7A 2ZU8A 3SXAA 4Y64A 1H7HA 4KXOA 3U2UA 4D0TA 4KC1A 1H4EA 2FYAA 3CKVA 4HCQA 3U2XA 2WGZA 5CQNX 4FREA 5C1GA 3TZTA 1ZIZA 3I0FA 1MC3A 3LW6A 2NXVA 2VS3A 1G93A 4NAIA 4FROA 3T7OA 3IOHA 2I5KA 2X5SA 2D7IA 2FFUA 4B5BA 3D8VA 2VSIA 4AAWA 2E3DA 4MNDA 5C3DA 1H5RA 3V8ZA 3V0MA 5C4CA 1VH1A 1FR8A 2JCLA 1EYRA 3ZF8A 3BRKX 1H5SD 4KC2A 3ST8A 1VPAA 3V8YA 4M2AA 4B4BA 3R2WA 1H5TA 5FTSA 2VFZA 1JVGA 5JQQA 4KPXA 2YCMA 1GQCA 4D0ZA 4HO8A 1G1LA 5J49A 1FGXA 1V82A 4CVHA 2Y6PA 2RJ5A 1XZ6A 2YQSA 3SXGA 4DDZA 1VGTA 1NKHB 4AYJA 3K8DA 2P72A 1G3LA 1G9RA 5C4BA 3OAMA 1LZJA 5AJNA 5EJ1A 1LL2A 3OH2A 4EEOA 1H7QA 1YP3A 3OH4A 4CJBA 3BCVA 1WT2A 3V0OA 2RIYA 1VM8A 5C4FA 5C4EA 1G95A 4FRMA 1GWWA 4ASJA 4JISA 4Y62A 2RJ4A 2YQJA 5AJOA 3USQA 2ICXA 4CJ8A 2PA4A 1NQIB 1INIA 3E26A 5IFYA 3I0DA 5C49A 3TQDA 2RJ9A 5IDSA 1LL3A 1WVCA 1FOAA 1FR9A 4D11C 2VS5A 5CQPA 2XWLA 1O7OA 1H7EA 5AJPA 3POLA 1IIMA 2VD4A 2RIZA 4L41C 3SXCA 1TW1A 2GGQA 2X5ZA 1ZDGA 4M28A 3OH1A 2FY7A 4D48A 1PZYB 2FFVA 3CU0A 4GBPA 3EE5A 1JYLA 5EIYA 1EZIA 4KPZA 4ASYA 3V0QA 2W0VA 2YESA 3I0GA 5C8RA 2WEEA 3PKQA 3USRA 1G8OA 3CKJA 2V0HA 2PX7A 1FWYA 4KNXA 5HS2A 2WAWA 4FRAA 2QH5A 2P6WA 4B4MA 4Y63A 1VZUA 5BXCA 3SPTA 1ZCYA 2VXLA 5C47A 3U0XA 5IDTA 1INJA 2QKXA 4EE4A 4NANA 2A8UA 1W77A 1GX4A 3T7MA 4HO9A 2RJ7A 2AECA 4KRVA 3K8EA 4M2BA 4FCEA 1HM8A 1NHEB 4FRBA 2PGYA 3Q80A 1VGZA 4KT7A 2OEFA 1WT3A 3CKOA 2V0IA 1TW5A 1G0RA 1VICA 1ON6A 4BMAA 3RMWA 4FQWA 1H4CA 4YS8A 3SXDA 2ICYA 4D11A 5I1FA 1NF5B 1HJJA 1SS9A 1ZJPA 5C38A 2VS4A 1NWGB 4E1KA 5DDVA 2CU2A 3QVBA 2AH9A 4Y7FA 2AM4A 2P73A 4HOCA 3SXEA 4ECMA 2APCA 2QGIA 1V84A 2D0JA 1H4DA 1MP5A 3DUVA 3JUJA 2XWNA 4EEMA 3I0EA 1S4OA 4HO2A 4LW3A 4BQHA 5EJZA 2Y4LA 5CQOA 3RSBA 2I7BA 5DDTA 1OMXA 4IRPA 4JD0A 4EEAA 3E25A 1QGSA 2VSHA 5CMHA 3I0IX 1YP4A 2BO6A 1H5SB 3NGWA 4XWIA 4B2WA 2Q4JA 3IOJA 3SX7A 3V91A 4G3QA 2FYCB 2XWMA 4AC3A 4CJCA 4B2XA 4G87A 1H3MA 4DE7A 2WVLA 2ZU9A 2A8WA 3FWWA 1I52A 2RJ1A 1ZI4A 1O7QA 1LZIA 1ZCTA 1H5SC 5FUHA 1G23A 3SX8A 3PNNA 3ZGFA 1FXOA 1GX0A 1GWVA 2JCOA 4Y7GA 1LVWA 2RIXA 3JTJA 1QG8A 1ZJ1A 1HV9A 2PGVA 1VGUA 1LL0A 3I0CA 5C1LA
chains in the Genus database with same CATH superfamily
3V0PA 3GUEA 1R7XA 3OC9A 1O0RA 1H7FA 2RJ6A 2MZBA 2UX8A 4KNRA 1H5RB 2JCJA 1FXJA 1ON8A 4B3UA 5C4DA 2XMEA 4AYLA 3I0CA 4J18A 3U2VA 2V0KA 4Y7TA 2RJ8A 2YQHA 4EE3A 2RITA 1JVDA 3U0YA 1GQ9A 2WVKA 1ZI3A 4M4KA 1ZHJA 2VXMA 1H5TB 1S4PA 1R80A 4HO4A 2OI7A 1G97A 1ZCVA 5C1HA 2D7RA 1ZJOA 2FYDB 5C3AA 3V0LA 2AM3A 4LW6A 1MP4A 5FYEA 1WT1A 2YQCA 4Y6NA 1E5KA 2AGDA 3DK5A 3OH3A 4NAKA 3D98A 3R3IA 3F1YA 3SXBA 1YROB 2BO8A 3CKNA 4FCUA 5CMGX 3D5NA 4B4GA 1VZXA 3I0JA 5FU0A 1FO8A 4DECA 4P02A 3HL3A 2Y7AA 1H5SA 1OMZA 1R7YA 3OH0A 2AE7A 2ZU7A 2Y4MA 5FV9A 2O1GA 2I5EA 2WE9A 3FOQA 1QWJA 1FO9A 1PZTA 1HM0A 4HO0A 4FRQA 3RMVA 4O6MA 1ZJ0A 3ZLLA 1W55A 4FRPA 3V0NA 5CQMX 2YC5A 1H7LA 4UEGA 5L6SA 1H7TA 1JV1A 3OKRA 1R81A 2OI5A 3ZGGA 4HO6A 1LZ0A 5FTVA 3KIAA 1FZWA 1S4NA 1VGWA 1K4VA 3SX3A 2YC3A 1HJLA 4EEGA 2Y4JA 3I0KA 1FGGA 3IOIA 1VZTA 1OQMB 1ZI5A 4NALA 3N9WA 1R82A 2O1HA 1IINA 2X65A 2X60A 2DPWA 1WT0A 4MYBA 4EVWA 1MP3A 1R7VA 4KC4A 4HO3A 4C2SA 3OGZA 2RJ0A 4ZDQA 2E8BA 2V0LA 5CMIA 1R7TA 3SX5A 3T7NA 4G3SA 1XHBA 4HO5A 3V90A 3ZLKA 2BO4A 5C48A 2Y4KA 1ZI1A 3CKQA 4P00A 1JYKA 3I0HA 3Q7UA 1FRWA 4FIXA 2Z86A 4FRLA 2V0JA 5CMJA 1TZFA 1V83A 1WSZA 4FRHA 5L6VA 1FG5N 2JCKA 4G3PA 1TVYA 4EE5A 5CQLX 1ZDFA 1H7GA 2AM5A 1O23B 1ZJ3A 1NMMB 1LZ7A 1VH3A 3U2TA 4FRDA 4Y6UA 5CMFX 1HM9A 3PKPA 2XMHA 4B42A 3I0LA 4R7PA 2GGOA 2WVMA 2Z87A 3Q4SA 4HG6A 4MIXA 4ARWA 1GA8A 3F1CA 1G2VA 3O3PA 4Y9XA 5C36A 1W57A 3U2WA 1YP2A 2W0WA 1ZJ2A 1Z90A 2FYBA 3DJ4A 4IRQA 1ZCUA 2OEGA 1QGQA 5C3BA 2OI6A 1KWSA 2J0AA 1JV3A 1R7UA 2O1FA 4KQLA 4K6RA 3JUKA 2AESA 4Y7UA 5FU8A 3CGXA 4Y7VA 2BO7A 2ZU8A 3SXAA 4Y64A 1H7HA 4KXOA 3U2UA 4D0TA 4O6NA 4KC1A 1H4EA 2FYAA 3CKVA 4HCQA 3U2XA 2WGZA 5CQNX 4FREA 5C1GA 3TZTA 1ZIZA 3I0FA 1MC3A 3LW6A 2NXVA 2VS3A 1G93A 4NAIA 4FROA 5D92A 3IOHA 3T7OA 2I5KA 2X5SA 2D7IA 2FFUA 4B5BA 3D8VA 2VSIA 4AAWA 2E3DA 4MNDA 5C3DA 1H5RA 3V8ZA 3V0MA 5C4CA 1VH1A 1FR8A 2JCLA 1EYRA 3ZF8A 3BRKX 1H5SD 4KC2A 3ST8A 1VPAA 3V8YA 4M2AA 4B4BA 3R2WA 1H5TA 5FTSA 2VFZA 1JVGA 5JQQA 4KPXA 2YCMA 1GQCA 4D0ZA 4HO8A 1G1LA 5J49A 1FGXA 1V82A 4CVHA 2Y6PA 2RJ5A 1XZ6A 2YQSA 3SXGA 4DDZA 1VGTA 1NKHB 4AYJA 3K8DA 2P72A 1G3LA 1G9RA 5C4BA 3OAMA 1LZJA 5AJNA 5EJ1A 1LL2A 3OH2A 4EEOA 1H7QA 1YP3A 3OH4A 4CJBA 3BCVA 1WT2A 3V0OA 2RIYA 1VM8A 5C4FA 5C4EA 1G95A 4FRMA 1GWWA 4ASJA 4JISA 4Y62A 2RJ4A 2YQJA 5AJOA 3USQA 2ICXA 4CJ8A 2PA4A 1NQIB 1INIA 3E26A 5IFYA 5D91A 3I0DA 5C49A 3TQDA 2RJ9A 5IDSA 1LL3A 1WVCA 1FOAA 1FR9A 4D11C 2VS5A 5CQPA 2XWLA 1O7OA 1H7EA 5AJPA 3POLA 1IIMA 2VD4A 2RIZA 4L41C 3SXCA 1TW1A 2GGQA 2X5ZA 1ZDGA 4M28A 3OH1A 2FY7A 4D48A 1PZYB 2FFVA 3CU0A 4GBPA 3EE5A 1JYLA 5EIYA 1EZIA 4KPZA 4ASYA 3V0QA 2W0VA 2YESA 3I0GA 5C8RA 2WEEA 3PKQA 3USRA 1G8OA 3CKJA 2V0HA 2PX7A 1FWYA 4KNXA 5HS2A 2WAWA 4FRAA 2QH5A 2P6WA 4B4MA 4Y63A 1VZUA 5BXCA 3SPTA 1ZCYA 2VXLA 5C47A 3U0XA 5IDTA 1INJA 2QKXA 4EE4A 4NANA 2A8UA 1W77A 1GX4A 3T7MA 4HO9A 2RJ7A 2AECA 4KRVA 3K8EA 4M2BA 4FCEA 1HM8A 1NHEB 4FRBA 2PGYA 3Q80A 1VGZA 4KT7A 2OEFA 1WT3A 3CKOA 2V0IA 1TW5A 1G0RA 1VICA 1ON6A 4BMAA 3RMWA 4FQWA 1H4CA 4YS8A 3SXDA 2ICYA 4D11A 5I1FA 1NF5B 1HJJA 1SS9A 1ZJPA 5C38A 2VS4A 1NWGB 4E1KA 5DDVA 2CU2A 3QVBA 2AH9A 4Y7FA 2AM4A 2P73A 4HOCA 3SXEA 4ECMA 2APCA 2QGIA 1V84A 2D0JA 1H4DA 1MP5A 3DUVA 3JUJA 2XWNA 4EEMA 3I0EA 1S4OA 2J0BA 4HO2A 4LW3A 4BQHA 5EJZA 2Y4LA 4Q7CA 5CQOA 3RSBA 2I7BA 5DDTA 1OMXA 4IRPA 4JD0A 4EEAA 3E25A 1QGSA 2VSHA 5CMHA 3I0IX 1YP4A 2BO6A 1H5SB 3NGWA 4XWIA 4B2WA 2Q4JA 3IOJA 3SX7A 3V91A 4G3QA 2XWMA 2FYCB 4AC3A 4CJCA 4B2XA 4G87A 1H3MA 4DE7A 2WVLA 2ZU9A 2A8WA 3FWWA 1I52A 2RJ1A 1ZI4A 1O7QA 1LZIA 1ZCTA 1H5SC 5FUHA 1G23A 3SX8A 3PNNA 3ZGFA 1FXOA 1GX0A 1GWVA 4FIYA 2JCOA 4Y7GA 1LVWA 2RIXA 3JTJA 1QG8A 2C0NA 1ZJ1A 1HV9A 2PGVA 1VGUA 1LL0A 2VK9A 5C1LA
chains in the Genus database with same CATH topology
3V0PA 3GUEA 1R7XA 3OC9A 1O0RA 1H7FA 2RJ6A 2MZBA 2UX8A 4KNRA 1H5RB 2JCJA 1FXJA 1ON8A 4B3UA 5C4DA 2XMEA 4AYLA 3I0CA 4J18A 3U2VA 2V0KA 4Y7TA 2RJ8A 2YQHA 4EE3A 2RITA 1JVDA 3U0YA 1GQ9A 2WVKA 1ZI3A 4M4KA 1ZHJA 2VXMA 1H5TB 1S4PA 1R80A 4HO4A 2OI7A 1G97A 1ZCVA 5C1HA 2D7RA 1ZJOA 2FYDB 5C3AA 3V0LA 2AM3A 4LW6A 1MP4A 5FYEA 1WT1A 2YQCA 4Y6NA 1E5KA 2AGDA 3DK5A 3OH3A 4NAKA 3D98A 3R3IA 3F1YA 3SXBA 1YROB 2BO8A 3CKNA 4FCUA 5CMGX 3D5NA 4B4GA 1VZXA 3I0JA 5FU0A 1FO8A 4DECA 4P02A 3HL3A 2Y7AA 1H5SA 1OMZA 1R7YA 3OH0A 2AE7A 2ZU7A 2Y4MA 5FV9A 2O1GA 2I5EA 2WE9A 3FOQA 1QWJA 1FO9A 1PZTA 1HM0A 4HO0A 4FRQA 3RMVA 4O6MA 1ZJ0A 3ZLLA 1W55A 4FRPA 3V0NA 5CQMX 2YC5A 1H7LA 4UEGA 5L6SA 1H7TA 1JV1A 3OKRA 1R81A 2OI5A 3ZGGA 4HO6A 1LZ0A 5FTVA 3KIAA 1FZWA 1S4NA 1VGWA 1K4VA 3SX3A 2YC3A 1HJLA 4EEGA 2Y4JA 3I0KA 1FGGA 3IOIA 1VZTA 1OQMB 1ZI5A 4NALA 3N9WA 1R82A 2O1HA 1IINA 2X65A 2X60A 2DPWA 1WT0A 4MYBA 4EVWA 1MP3A 1R7VA 4KC4A 4HO3A 4C2SA 3OGZA 2RJ0A 4ZDQA 2E8BA 2V0LA 5CMIA 1R7TA 3SX5A 3T7NA 4G3SA 1XHBA 4HO5A 3V90A 3ZLKA 2BO4A 5C48A 2Y4KA 1ZI1A 3CKQA 4P00A 1JYKA 3I0HA 3Q7UA 1FRWA 4FIXA 2Z86A 4FRLA 2V0JA 5CMJA 1TZFA 1V83A 1WSZA 4FRHA 5L6VA 1FG5N 2JCKA 4G3PA 1TVYA 4EE5A 5CQLX 1ZDFA 1H7GA 2AM5A 1O23B 1ZJ3A 1NMMB 1LZ7A 1VH3A 3U2TA 4FRDA 4Y6UA 5CMFX 1HM9A 3PKPA 2XMHA 4B42A 3I0LA 4R7PA 2GGOA 2WVMA 2Z87A 3Q4SA 4HG6A 4MIXA 4ARWA 1GA8A 3F1CA 1G2VA 3O3PA 4Y9XA 5C36A 1W57A 3U2WA 1YP2A 2W0WA 1ZJ2A 1Z90A 2FYBA 3DJ4A 4IRQA 1ZCUA 2OEGA 1QGQA 5C3BA 2OI6A 1KWSA 2J0AA 1JV3A 1R7UA 2O1FA 4KQLA 4K6RA 3JUKA 2AESA 4Y7UA 5FU8A 3CGXA 4Y7VA 2BO7A 2ZU8A 3SXAA 4Y64A 1H7HA 4KXOA 3U2UA 4D0TA 4O6NA 4KC1A 1H4EA 2FYAA 3CKVA 4HCQA 3U2XA 2WGZA 5CQNX 4FREA 5C1GA 3TZTA 1ZIZA 3I0FA 1MC3A 3LW6A 2NXVA 2VS3A 1G93A 4NAIA 4FROA 5D92A 3IOHA 3T7OA 2I5KA 2X5SA 2D7IA 2FFUA 4B5BA 3D8VA 2VSIA 4AAWA 2E3DA 4MNDA 5C3DA 1H5RA 3V8ZA 3V0MA 5C4CA 1VH1A 1FR8A 2JCLA 1EYRA 3ZF8A 3BRKX 1H5SD 4KC2A 3ST8A 1VPAA 3V8YA 4M2AA 4B4BA 3R2WA 1H5TA 5FTSA 2VFZA 1JVGA 5JQQA 4KPXA 2YCMA 1GQCA 4D0ZA 4HO8A 1G1LA 5J49A 1FGXA 1V82A 4CVHA 2Y6PA 2RJ5A 1XZ6A 2YQSA 3SXGA 4DDZA 1VGTA 1NKHB 4AYJA 3K8DA 2P72A 1G3LA 1G9RA 5C4BA 3OAMA 1LZJA 5AJNA 5EJ1A 1LL2A 3OH2A 4EEOA 1H7QA 1YP3A 3OH4A 4CJBA 3BCVA 1WT2A 3V0OA 2RIYA 1VM8A 5C4FA 5C4EA 1G95A 4FRMA 1GWWA 4ASJA 4JISA 4Y62A 2RJ4A 2YQJA 5AJOA 3USQA 2ICXA 4CJ8A 2PA4A 1NQIB 1INIA 3E26A 5IFYA 5D91A 3I0DA 5C49A 3TQDA 2RJ9A 5IDSA 1LL3A 1WVCA 1FOAA 1FR9A 4D11C 2VS5A 5CQPA 2XWLA 1O7OA 1H7EA 5AJPA 3POLA 1IIMA 2VD4A 2RIZA 4L41C 3SXCA 1TW1A 2GGQA 2X5ZA 1ZDGA 4M28A 3OH1A 2FY7A 4D48A 1PZYB 2FFVA 3CU0A 4GBPA 3EE5A 1JYLA 5EIYA 1EZIA 4KPZA 4ASYA 3V0QA 2W0VA 2YESA 3I0GA 5C8RA 2WEEA 3PKQA 3USRA 1G8OA 3CKJA 2V0HA 2PX7A 1FWYA 4KNXA 5HS2A 2WAWA 4FRAA 2QH5A 2P6WA 4B4MA 4Y63A 1VZUA 5BXCA 3SPTA 1ZCYA 2VXLA 5C47A 3U0XA 5IDTA 1INJA 2QKXA 4EE4A 4NANA 2A8UA 1W77A 1GX4A 3T7MA 4HO9A 2RJ7A 2AECA 4KRVA 3K8EA 4M2BA 4FCEA 1HM8A 1NHEB 4FRBA 2PGYA 3Q80A 1VGZA 4KT7A 2OEFA 1WT3A 3CKOA 2V0IA 1TW5A 1G0RA 1VICA 1ON6A 4BMAA 3RMWA 4FQWA 1H4CA 4YS8A 3SXDA 2ICYA 4D11A 5I1FA 1NF5B 1HJJA 1SS9A 1ZJPA 5C38A 2VS4A 1NWGB 4E1KA 5DDVA 2CU2A 3QVBA 2AH9A 4Y7FA 2AM4A 2P73A 4HOCA 3SXEA 4ECMA 2APCA 2QGIA 1V84A 2D0JA 1H4DA 1MP5A 3DUVA 3JUJA 2XWNA 4EEMA 3I0EA 1S4OA 2J0BA 4HO2A 4LW3A 4BQHA 5EJZA 2Y4LA 4Q7CA 5CQOA 3RSBA 2I7BA 5DDTA 1OMXA 4IRPA 4JD0A 4EEAA 3E25A 1QGSA 2VSHA 5CMHA 3I0IX 1YP4A 2BO6A 1H5SB 3NGWA 4XWIA 4B2WA 2Q4JA 3IOJA 3SX7A 3V91A 4G3QA 2XWMA 2FYCB 4AC3A 4CJCA 4B2XA 4G87A 1H3MA 4DE7A 2WVLA 2ZU9A 2A8WA 3FWWA 1I52A 2RJ1A 1ZI4A 1O7QA 1LZIA 1ZCTA 1H5SC 5FUHA 1G23A 3SX8A 3PNNA 3ZGFA 1FXOA 1GX0A 1GWVA 4FIYA 2JCOA 4Y7GA 1LVWA 2RIXA 3JTJA 1QG8A 2C0NA 1ZJ1A 1HV9A 2PGVA 1VGUA 1LL0A 2VK9A 5C1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V0P A;  3GUE A;  1R7X A;  3OC9 A;  1O0R A;  1H7F A;  2RJ6 A;  2MZB A;  2UX8 A;  4KNR A;  1H5R B;  2JCJ A;  1FXJ A;  1ON8 A;  4B3U A;  5C4D A;  2XME A;  4AYL A;  4J18 A;  3U2V A;  2V0K A;  4Y7T A;  2RJ8 A;  2YQH A;  4EE3 A;  2RIT A;  1JVD A;  3U0Y A;  1GQ9 A;  2WVK A;  1ZI3 A;  4M4K A;  1ZHJ A;  2VXM A;  1H5T B;  1S4P A;  1R80 A;  4HO4 A;  2OI7 A;  1G97 A;  1ZCV A;  5C1H A;  2D7R A;  1ZJO A;  2FYD B;  5C3A A;  3V0L A;  2AM3 A;  4LW6 A;  1MP4 A;  5FYE A;  1WT1 A;  2YQC A;  4Y6N A;  1E5K A;  2AGD A;  3DK5 A;  3OH3 A;  4NAK A;  3D98 A;  3R3I A;  3F1Y A;  3SXB A;  1YRO B;  2BO8 A;  3CKN A;  4FCU A;  5CMG X;  3D5N A;  4B4G A;  1VZX A;  3I0J A;  5FU0 A;  1FO8 A;  4DEC A;  4P02 A;  3HL3 A;  2Y7A A;  1H5S A;  1OMZ A;  1R7Y A;  3OH0 A;  2AE7 A;  2ZU7 A;  2Y4M A;  5FV9 A;  2O1G A;  2I5E A;  2WE9 A;  3FOQ A;  1QWJ A;  1FO9 A;  1PZT A;  1HM0 A;  4HO0 A;  4FRQ A;  3RMV A;  1ZJ0 A;  3ZLL A;  1W55 A;  4FRP A;  3V0N A;  5CQM X;  2YC5 A;  1H7L A;  4UEG A;  5L6S A;  1H7T A;  1JV1 A;  3OKR A;  1R81 A;  2OI5 A;  3ZGG A;  4HO6 A;  1LZ0 A;  5FTV A;  3KIA A;  1FZW A;  1S4N A;  1VGW A;  1K4V A;  3SX3 A;  2YC3 A;  1HJL A;  4EEG A;  2Y4J A;  3I0K A;  1FGG A;  3IOI A;  1VZT A;  1OQM B;  1ZI5 A;  4NAL A;  3N9W A;  1R82 A;  2O1H A;  1IIN A;  2X65 A;  2X60 A;  2DPW A;  1WT0 A;  4MYB A;  4EVW A;  1MP3 A;  1R7V A;  4KC4 A;  4HO3 A;  4C2S A;  3OGZ A;  2RJ0 A;  4ZDQ A;  2E8B A;  2V0L A;  5CMI A;  1R7T A;  3SX5 A;  3T7N A;  4G3S A;  1XHB A;  4HO5 A;  3V90 A;  3ZLK A;  2BO4 A;  5C48 A;  2Y4K A;  1ZI1 A;  3CKQ A;  4P00 A;  1JYK A;  3I0H A;  3Q7U A;  1FRW A;  2Z86 A;  4FRL A;  2V0J A;  5CMJ A;  1TZF A;  1V83 A;  1WSZ A;  4FRH A;  5L6V A;  1FG5 N;  2JCK A;  4G3P A;  1TVY A;  4EE5 A;  5CQL X;  1ZDF A;  1H7G A;  2AM5 A;  1O23 B;  1ZJ3 A;  1NMM B;  1LZ7 A;  1VH3 A;  3U2T A;  4FRD A;  4Y6U A;  5CMF X;  1HM9 A;  3PKP A;  2XMH A;  4B42 A;  3I0L A;  4R7P A;  2GGO A;  2WVM A;  2Z87 A;  3Q4S A;  4HG6 A;  4ARW A;  1GA8 A;  3F1C A;  1G2V A;  3O3P A;  4Y9X A;  5C36 A;  1W57 A;  3U2W A;  1YP2 A;  2W0W A;  1ZJ2 A;  1Z90 A;  2FYB A;  3DJ4 A;  4IRQ A;  1ZCU A;  2OEG A;  1QGQ A;  5C3B A;  2OI6 A;  1KWS A;  1JV3 A;  1R7U A;  2O1F A;  4KQL A;  4K6R A;  3JUK A;  2AES A;  4Y7U A;  5FU8 A;  3CGX A;  4Y7V A;  2BO7 A;  2ZU8 A;  3SXA A;  4Y64 A;  1H7H A;  4KXO A;  3U2U A;  4D0T A;  4KC1 A;  1H4E A;  2FYA A;  3CKV A;  4HCQ A;  3U2X A;  2WGZ A;  5CQN X;  4FRE A;  5C1G A;  3TZT A;  1ZIZ A;  3I0F A;  1MC3 A;  3LW6 A;  2NXV A;  2VS3 A;  1G93 A;  4NAI A;  4FRO A;  3T7O A;  3IOH A;  2I5K A;  2X5S A;  2D7I A;  2FFU A;  4B5B A;  3D8V A;  2VSI A;  4AAW A;  2E3D A;  4MND A;  5C3D A;  1H5R A;  3V8Z A;  3V0M A;  5C4C A;  1VH1 A;  1FR8 A;  2JCL A;  1EYR A;  3ZF8 A;  3BRK X;  1H5S D;  4KC2 A;  3ST8 A;  1VPA A;  3V8Y A;  4M2A A;  4B4B A;  3R2W A;  1H5T A;  5FTS A;  2VFZ A;  1JVG A;  5JQQ A;  4KPX A;  2YCM A;  1GQC A;  4D0Z A;  4HO8 A;  1G1L A;  5J49 A;  1FGX A;  1V82 A;  4CVH A;  2Y6P A;  2RJ5 A;  1XZ6 A;  2YQS A;  3SXG A;  4DDZ A;  1VGT A;  1NKH B;  4AYJ A;  3K8D A;  2P72 A;  1G3L A;  1G9R A;  5C4B A;  3OAM A;  1LZJ A;  5AJN A;  5EJ1 A;  1LL2 A;  3OH2 A;  4EEO A;  1H7Q A;  1YP3 A;  3OH4 A;  4CJB A;  3BCV A;  1WT2 A;  3V0O A;  2RIY A;  1VM8 A;  5C4F A;  5C4E A;  1G95 A;  4FRM A;  1GWW A;  4ASJ A;  4JIS A;  4Y62 A;  2RJ4 A;  2YQJ A;  5AJO A;  3USQ A;  2ICX A;  4CJ8 A;  2PA4 A;  1NQI B;  1INI A;  3E26 A;  5IFY A;  3I0D A;  5C49 A;  3TQD A;  2RJ9 A;  5IDS A;  1LL3 A;  1WVC A;  1FOA A;  1FR9 A;  4D11 C;  2VS5 A;  5CQP A;  2XWL A;  1O7O A;  1H7E A;  5AJP A;  3POL A;  1IIM A;  2VD4 A;  2RIZ A;  4L41 C;  3SXC A;  1TW1 A;  2GGQ A;  2X5Z A;  1ZDG A;  4M28 A;  3OH1 A;  2FY7 A;  4D48 A;  1PZY B;  2FFV A;  3CU0 A;  4GBP A;  3EE5 A;  1JYL A;  5EIY A;  1EZI A;  4KPZ A;  4ASY A;  3V0Q A;  2W0V A;  2YES A;  3I0G A;  5C8R A;  2WEE A;  3PKQ A;  3USR A;  1G8O A;  3CKJ A;  2V0H A;  2PX7 A;  1FWY A;  4KNX A;  5HS2 A;  2WAW A;  4FRA A;  2QH5 A;  2P6W A;  4B4M A;  4Y63 A;  1VZU A;  5BXC A;  3SPT A;  1ZCY A;  2VXL A;  5C47 A;  3U0X A;  5IDT A;  1INJ A;  2QKX A;  4EE4 A;  4NAN A;  2A8U A;  1W77 A;  1GX4 A;  3T7M A;  4HO9 A;  2RJ7 A;  2AEC A;  4KRV A;  3K8E A;  4M2B A;  4FCE A;  1HM8 A;  1NHE B;  4FRB A;  2PGY A;  3Q80 A;  1VGZ A;  4KT7 A;  2OEF A;  1WT3 A;  3CKO A;  2V0I A;  1TW5 A;  1G0R A;  1VIC A;  1ON6 A;  4BMA A;  3RMW A;  4FQW A;  1H4C A;  4YS8 A;  3SXD A;  2ICY A;  4D11 A;  5I1F A;  1NF5 B;  1HJJ A;  1SS9 A;  1ZJP A;  5C38 A;  2VS4 A;  1NWG B;  4E1K A;  5DDV A;  2CU2 A;  3QVB A;  2AH9 A;  4Y7F A;  2AM4 A;  2P73 A;  4HOC A;  3SXE A;  4ECM A;  2APC A;  2QGI A;  1V84 A;  2D0J A;  1H4D A;  1MP5 A;  3DUV A;  3JUJ A;  2XWN A;  4EEM A;  3I0E A;  1S4O A;  4HO2 A;  4LW3 A;  4BQH A;  5EJZ A;  2Y4L A;  5CQO A;  3RSB A;  2I7B A;  5DDT A;  1OMX A;  4IRP A;  4JD0 A;  4EEA A;  3E25 A;  1QGS A;  2VSH A;  5CMH A;  3I0I X;  1YP4 A;  2BO6 A;  1H5S B;  3NGW A;  4XWI A;  4B2W A;  2Q4J A;  3IOJ A;  3SX7 A;  3V91 A;  4G3Q A;  2FYC B;  2XWM A;  4AC3 A;  4CJC A;  4B2X A;  4G87 A;  1H3M A;  4DE7 A;  2WVL A;  2ZU9 A;  2A8W A;  3FWW A;  1I52 A;  2RJ1 A;  1ZI4 A;  1O7Q A;  1LZI A;  1ZCT A;  1H5S C;  5FUH A;  1G23 A;  3SX8 A;  3PNN A;  3ZGF A;  1FXO A;  1GX0 A;  1GWV A;  2JCO A;  4Y7G A;  1LVW A;  2RIX A;  3JTJ A;  1QG8 A;  1ZJ1 A;  1HV9 A;  2PGV A;  1VGU A;  1LL0 A;  3I0C A;  5C1L A; 
#chains in the Genus database with same CATH topology
 3V0P A;  3GUE A;  1R7X A;  3OC9 A;  1O0R A;  1H7F A;  2RJ6 A;  2MZB A;  2UX8 A;  4KNR A;  1H5R B;  2JCJ A;  1FXJ A;  1ON8 A;  4B3U A;  5C4D A;  2XME A;  4AYL A;  3I0C A;  4J18 A;  3U2V A;  2V0K A;  4Y7T A;  2RJ8 A;  2YQH A;  4EE3 A;  2RIT A;  1JVD A;  3U0Y A;  1GQ9 A;  2WVK A;  1ZI3 A;  4M4K A;  1ZHJ A;  2VXM A;  1H5T B;  1S4P A;  1R80 A;  4HO4 A;  2OI7 A;  1G97 A;  1ZCV A;  5C1H A;  2D7R A;  1ZJO A;  2FYD B;  5C3A A;  3V0L A;  2AM3 A;  4LW6 A;  1MP4 A;  5FYE A;  1WT1 A;  2YQC A;  4Y6N A;  1E5K A;  2AGD A;  3DK5 A;  3OH3 A;  4NAK A;  3D98 A;  3R3I A;  3F1Y A;  3SXB A;  1YRO B;  2BO8 A;  3CKN A;  4FCU A;  5CMG X;  3D5N A;  4B4G A;  1VZX A;  3I0J A;  5FU0 A;  1FO8 A;  4DEC A;  4P02 A;  3HL3 A;  2Y7A A;  1H5S A;  1OMZ A;  1R7Y A;  3OH0 A;  2AE7 A;  2ZU7 A;  2Y4M A;  5FV9 A;  2O1G A;  2I5E A;  2WE9 A;  3FOQ A;  1QWJ A;  1FO9 A;  1PZT A;  1HM0 A;  4HO0 A;  4FRQ A;  3RMV A;  4O6M A;  1ZJ0 A;  3ZLL A;  1W55 A;  4FRP A;  3V0N A;  5CQM X;  2YC5 A;  1H7L A;  4UEG A;  5L6S A;  1H7T A;  1JV1 A;  3OKR A;  1R81 A;  2OI5 A;  3ZGG A;  4HO6 A;  1LZ0 A;  5FTV A;  3KIA A;  1FZW A;  1S4N A;  1VGW A;  1K4V A;  3SX3 A;  2YC3 A;  1HJL A;  4EEG A;  2Y4J A;  3I0K A;  1FGG A;  3IOI A;  1VZT A;  1OQM B;  1ZI5 A;  4NAL A;  3N9W A;  1R82 A;  2O1H A;  1IIN A;  2X65 A;  2X60 A;  2DPW A;  1WT0 A;  4MYB A;  4EVW A;  1MP3 A;  1R7V A;  4KC4 A;  4HO3 A;  4C2S A;  3OGZ A;  2RJ0 A;  4ZDQ A;  2E8B A;  2V0L A;  5CMI A;  1R7T A;  3SX5 A;  3T7N A;  4G3S A;  1XHB A;  4HO5 A;  3V90 A;  3ZLK A;  2BO4 A;  5C48 A;  2Y4K A;  1ZI1 A;  3CKQ A;  4P00 A;  1JYK A;  3I0H A;  3Q7U A;  1FRW A;  4FIX A;  2Z86 A;  4FRL A;  2V0J A;  5CMJ A;  1TZF A;  1V83 A;  1WSZ A;  4FRH A;  5L6V A;  1FG5 N;  2JCK A;  4G3P A;  1TVY A;  4EE5 A;  5CQL X;  1ZDF A;  1H7G A;  2AM5 A;  1O23 B;  1ZJ3 A;  1NMM B;  1LZ7 A;  1VH3 A;  3U2T A;  4FRD A;  4Y6U A;  5CMF X;  1HM9 A;  3PKP A;  2XMH A;  4B42 A;  3I0L A;  4R7P A;  2GGO A;  2WVM A;  2Z87 A;  3Q4S A;  4HG6 A;  4MIX A;  4ARW A;  1GA8 A;  3F1C A;  1G2V A;  3O3P A;  4Y9X A;  5C36 A;  1W57 A;  3U2W A;  1YP2 A;  2W0W A;  1ZJ2 A;  1Z90 A;  2FYB A;  3DJ4 A;  4IRQ A;  1ZCU A;  2OEG A;  1QGQ A;  5C3B A;  2OI6 A;  1KWS A;  2J0A A;  1JV3 A;  1R7U A;  2O1F A;  4KQL A;  4K6R A;  3JUK A;  2AES A;  4Y7U A;  5FU8 A;  3CGX A;  4Y7V A;  2BO7 A;  2ZU8 A;  3SXA A;  4Y64 A;  1H7H A;  4KXO A;  3U2U A;  4D0T A;  4O6N A;  4KC1 A;  1H4E A;  2FYA A;  3CKV A;  4HCQ A;  3U2X A;  2WGZ A;  5CQN X;  4FRE A;  5C1G A;  3TZT A;  1ZIZ A;  3I0F A;  1MC3 A;  3LW6 A;  2NXV A;  2VS3 A;  1G93 A;  4NAI A;  4FRO A;  5D92 A;  3IOH A;  3T7O A;  2I5K A;  2X5S A;  2D7I A;  2FFU A;  4B5B A;  3D8V A;  2VSI A;  4AAW A;  2E3D A;  4MND A;  5C3D A;  1H5R A;  3V8Z A;  3V0M A;  5C4C A;  1VH1 A;  1FR8 A;  2JCL A;  1EYR A;  3ZF8 A;  3BRK X;  1H5S D;  4KC2 A;  3ST8 A;  1VPA A;  3V8Y A;  4M2A A;  4B4B A;  3R2W A;  1H5T A;  5FTS A;  2VFZ A;  1JVG A;  5JQQ A;  4KPX A;  2YCM A;  1GQC A;  4D0Z A;  4HO8 A;  1G1L A;  5J49 A;  1FGX A;  1V82 A;  4CVH A;  2Y6P A;  2RJ5 A;  1XZ6 A;  2YQS A;  3SXG A;  4DDZ A;  1VGT A;  1NKH B;  4AYJ A;  3K8D A;  2P72 A;  1G3L A;  1G9R A;  5C4B A;  3OAM A;  1LZJ A;  5AJN A;  5EJ1 A;  1LL2 A;  3OH2 A;  4EEO A;  1H7Q A;  1YP3 A;  3OH4 A;  4CJB A;  3BCV A;  1WT2 A;  3V0O A;  2RIY A;  1VM8 A;  5C4F A;  5C4E A;  1G95 A;  4FRM A;  1GWW A;  4ASJ A;  4JIS A;  4Y62 A;  2RJ4 A;  2YQJ A;  5AJO A;  3USQ A;  2ICX A;  4CJ8 A;  2PA4 A;  1NQI B;  1INI A;  3E26 A;  5IFY A;  5D91 A;  3I0D A;  5C49 A;  3TQD A;  2RJ9 A;  5IDS A;  1LL3 A;  1WVC A;  1FOA A;  1FR9 A;  4D11 C;  2VS5 A;  5CQP A;  2XWL A;  1O7O A;  1H7E A;  5AJP A;  3POL A;  1IIM A;  2VD4 A;  2RIZ A;  4L41 C;  3SXC A;  1TW1 A;  2GGQ A;  2X5Z A;  1ZDG A;  4M28 A;  3OH1 A;  2FY7 A;  4D48 A;  1PZY B;  2FFV A;  3CU0 A;  4GBP A;  3EE5 A;  1JYL A;  5EIY A;  1EZI A;  4KPZ A;  4ASY A;  3V0Q A;  2W0V A;  2YES A;  3I0G A;  5C8R A;  2WEE A;  3PKQ A;  3USR A;  1G8O A;  3CKJ A;  2V0H A;  2PX7 A;  1FWY A;  4KNX A;  5HS2 A;  2WAW A;  4FRA A;  2QH5 A;  2P6W A;  4B4M A;  4Y63 A;  1VZU A;  5BXC A;  3SPT A;  1ZCY A;  2VXL A;  5C47 A;  3U0X A;  5IDT A;  1INJ A;  2QKX A;  4EE4 A;  4NAN A;  2A8U A;  1W77 A;  1GX4 A;  3T7M A;  4HO9 A;  2RJ7 A;  2AEC A;  4KRV A;  3K8E A;  4M2B A;  4FCE A;  1HM8 A;  1NHE B;  4FRB A;  2PGY A;  3Q80 A;  1VGZ A;  4KT7 A;  2OEF A;  1WT3 A;  3CKO A;  2V0I A;  1TW5 A;  1G0R A;  1VIC A;  1ON6 A;  4BMA A;  3RMW A;  4FQW A;  1H4C A;  4YS8 A;  3SXD A;  2ICY A;  4D11 A;  5I1F A;  1NF5 B;  1HJJ A;  1SS9 A;  1ZJP A;  5C38 A;  2VS4 A;  1NWG B;  4E1K A;  5DDV A;  2CU2 A;  3QVB A;  2AH9 A;  4Y7F A;  2AM4 A;  2P73 A;  4HOC A;  3SXE A;  4ECM A;  2APC A;  2QGI A;  1V84 A;  2D0J A;  1H4D A;  1MP5 A;  3DUV A;  3JUJ A;  2XWN A;  4EEM A;  3I0E A;  1S4O A;  2J0B A;  4HO2 A;  4LW3 A;  4BQH A;  5EJZ A;  2Y4L A;  4Q7C A;  5CQO A;  3RSB A;  2I7B A;  5DDT A;  1OMX A;  4IRP A;  4JD0 A;  4EEA A;  3E25 A;  1QGS A;  2VSH A;  5CMH A;  3I0I X;  1YP4 A;  2BO6 A;  1H5S B;  3NGW A;  4XWI A;  4B2W A;  2Q4J A;  3IOJ A;  3SX7 A;  3V91 A;  4G3Q A;  2XWM A;  2FYC B;  4AC3 A;  4CJC A;  4B2X A;  4G87 A;  1H3M A;  4DE7 A;  2WVL A;  2ZU9 A;  2A8W A;  3FWW A;  1I52 A;  2RJ1 A;  1ZI4 A;  1O7Q A;  1LZI A;  1ZCT A;  1H5S C;  5FUH A;  1G23 A;  3SX8 A;  3PNN A;  3ZGF A;  1FXO A;  1GX0 A;  1GWV A;  4FIY A;  2JCO A;  4Y7G A;  1LVW A;  2RIX A;  3JTJ A;  1QG8 A;  2C0N A;  1ZJ1 A;  1HV9 A;  2PGV A;  1VGU A;  1LL0 A;  2VK9 A;  5C1L A; 
#chains in the Genus database with same CATH homology
 3V0P A;  3GUE A;  1R7X A;  3OC9 A;  1O0R A;  1H7F A;  2RJ6 A;  2MZB A;  2UX8 A;  4KNR A;  1H5R B;  2JCJ A;  1FXJ A;  1ON8 A;  4B3U A;  5C4D A;  2XME A;  4AYL A;  3I0C A;  4J18 A;  3U2V A;  2V0K A;  4Y7T A;  2RJ8 A;  2YQH A;  4EE3 A;  2RIT A;  1JVD A;  3U0Y A;  1GQ9 A;  2WVK A;  1ZI3 A;  4M4K A;  1ZHJ A;  2VXM A;  1H5T B;  1S4P A;  1R80 A;  4HO4 A;  2OI7 A;  1G97 A;  1ZCV A;  5C1H A;  2D7R A;  1ZJO A;  2FYD B;  5C3A A;  3V0L A;  2AM3 A;  4LW6 A;  1MP4 A;  5FYE A;  1WT1 A;  2YQC A;  4Y6N A;  1E5K A;  2AGD A;  3DK5 A;  3OH3 A;  4NAK A;  3D98 A;  3R3I A;  3F1Y A;  3SXB A;  1YRO B;  2BO8 A;  3CKN A;  4FCU A;  5CMG X;  3D5N A;  4B4G A;  1VZX A;  3I0J A;  5FU0 A;  1FO8 A;  4DEC A;  4P02 A;  3HL3 A;  2Y7A A;  1H5S A;  1OMZ A;  1R7Y A;  3OH0 A;  2AE7 A;  2ZU7 A;  2Y4M A;  5FV9 A;  2O1G A;  2I5E A;  2WE9 A;  3FOQ A;  1QWJ A;  1FO9 A;  1PZT A;  1HM0 A;  4HO0 A;  4FRQ A;  3RMV A;  4O6M A;  1ZJ0 A;  3ZLL A;  1W55 A;  4FRP A;  3V0N A;  5CQM X;  2YC5 A;  1H7L A;  4UEG A;  5L6S A;  1H7T A;  1JV1 A;  3OKR A;  1R81 A;  2OI5 A;  3ZGG A;  4HO6 A;  1LZ0 A;  5FTV A;  3KIA A;  1FZW A;  1S4N A;  1VGW A;  1K4V A;  3SX3 A;  2YC3 A;  1HJL A;  4EEG A;  2Y4J A;  3I0K A;  1FGG A;  3IOI A;  1VZT A;  1OQM B;  1ZI5 A;  4NAL A;  3N9W A;  1R82 A;  2O1H A;  1IIN A;  2X65 A;  2X60 A;  2DPW A;  1WT0 A;  4MYB A;  4EVW A;  1MP3 A;  1R7V A;  4KC4 A;  4HO3 A;  4C2S A;  3OGZ A;  2RJ0 A;  4ZDQ A;  2E8B A;  2V0L A;  5CMI A;  1R7T A;  3SX5 A;  3T7N A;  4G3S A;  1XHB A;  4HO5 A;  3V90 A;  3ZLK A;  2BO4 A;  5C48 A;  2Y4K A;  1ZI1 A;  3CKQ A;  4P00 A;  1JYK A;  3I0H A;  3Q7U A;  1FRW A;  4FIX A;  2Z86 A;  4FRL A;  2V0J A;  5CMJ A;  1TZF A;  1V83 A;  1WSZ A;  4FRH A;  5L6V A;  1FG5 N;  2JCK A;  4G3P A;  1TVY A;  4EE5 A;  5CQL X;  1ZDF A;  1H7G A;  2AM5 A;  1O23 B;  1ZJ3 A;  1NMM B;  1LZ7 A;  1VH3 A;  3U2T A;  4FRD A;  4Y6U A;  5CMF X;  1HM9 A;  3PKP A;  2XMH A;  4B42 A;  3I0L A;  4R7P A;  2GGO A;  2WVM A;  2Z87 A;  3Q4S A;  4HG6 A;  4MIX A;  4ARW A;  1GA8 A;  3F1C A;  1G2V A;  3O3P A;  4Y9X A;  5C36 A;  1W57 A;  3U2W A;  1YP2 A;  2W0W A;  1ZJ2 A;  1Z90 A;  2FYB A;  3DJ4 A;  4IRQ A;  1ZCU A;  2OEG A;  1QGQ A;  5C3B A;  2OI6 A;  1KWS A;  2J0A A;  1JV3 A;  1R7U A;  2O1F A;  4KQL A;  4K6R A;  3JUK A;  2AES A;  4Y7U A;  5FU8 A;  3CGX A;  4Y7V A;  2BO7 A;  2ZU8 A;  3SXA A;  4Y64 A;  1H7H A;  4KXO A;  3U2U A;  4D0T A;  4O6N A;  4KC1 A;  1H4E A;  2FYA A;  3CKV A;  4HCQ A;  3U2X A;  2WGZ A;  5CQN X;  4FRE A;  5C1G A;  3TZT A;  1ZIZ A;  3I0F A;  1MC3 A;  3LW6 A;  2NXV A;  2VS3 A;  1G93 A;  4NAI A;  4FRO A;  5D92 A;  3IOH A;  3T7O A;  2I5K A;  2X5S A;  2D7I A;  2FFU A;  4B5B A;  3D8V A;  2VSI A;  4AAW A;  2E3D A;  4MND A;  5C3D A;  1H5R A;  3V8Z A;  3V0M A;  5C4C A;  1VH1 A;  1FR8 A;  2JCL A;  1EYR A;  3ZF8 A;  3BRK X;  1H5S D;  4KC2 A;  3ST8 A;  1VPA A;  3V8Y A;  4M2A A;  4B4B A;  3R2W A;  1H5T A;  5FTS A;  2VFZ A;  1JVG A;  5JQQ A;  4KPX A;  2YCM A;  1GQC A;  4D0Z A;  4HO8 A;  1G1L A;  5J49 A;  1FGX A;  1V82 A;  4CVH A;  2Y6P A;  2RJ5 A;  1XZ6 A;  2YQS A;  3SXG A;  4DDZ A;  1VGT A;  1NKH B;  4AYJ A;  3K8D A;  2P72 A;  1G3L A;  1G9R A;  5C4B A;  3OAM A;  1LZJ A;  5AJN A;  5EJ1 A;  1LL2 A;  3OH2 A;  4EEO A;  1H7Q A;  1YP3 A;  3OH4 A;  4CJB A;  3BCV A;  1WT2 A;  3V0O A;  2RIY A;  1VM8 A;  5C4F A;  5C4E A;  1G95 A;  4FRM A;  1GWW A;  4ASJ A;  4JIS A;  4Y62 A;  2RJ4 A;  2YQJ A;  5AJO A;  3USQ A;  2ICX A;  4CJ8 A;  2PA4 A;  1NQI B;  1INI A;  3E26 A;  5IFY A;  5D91 A;  3I0D A;  5C49 A;  3TQD A;  2RJ9 A;  5IDS A;  1LL3 A;  1WVC A;  1FOA A;  1FR9 A;  4D11 C;  2VS5 A;  5CQP A;  2XWL A;  1O7O A;  1H7E A;  5AJP A;  3POL A;  1IIM A;  2VD4 A;  2RIZ A;  4L41 C;  3SXC A;  1TW1 A;  2GGQ A;  2X5Z A;  1ZDG A;  4M28 A;  3OH1 A;  2FY7 A;  4D48 A;  1PZY B;  2FFV A;  3CU0 A;  4GBP A;  3EE5 A;  1JYL A;  5EIY A;  1EZI A;  4KPZ A;  4ASY A;  3V0Q A;  2W0V A;  2YES A;  3I0G A;  5C8R A;  2WEE A;  3PKQ A;  3USR A;  1G8O A;  3CKJ A;  2V0H A;  2PX7 A;  1FWY A;  4KNX A;  5HS2 A;  2WAW A;  4FRA A;  2QH5 A;  2P6W A;  4B4M A;  4Y63 A;  1VZU A;  5BXC A;  3SPT A;  1ZCY A;  2VXL A;  5C47 A;  3U0X A;  5IDT A;  1INJ A;  2QKX A;  4EE4 A;  4NAN A;  2A8U A;  1W77 A;  1GX4 A;  3T7M A;  4HO9 A;  2RJ7 A;  2AEC A;  4KRV A;  3K8E A;  4M2B A;  4FCE A;  1HM8 A;  1NHE B;  4FRB A;  2PGY A;  3Q80 A;  1VGZ A;  4KT7 A;  2OEF A;  1WT3 A;  3CKO A;  2V0I A;  1TW5 A;  1G0R A;  1VIC A;  1ON6 A;  4BMA A;  3RMW A;  4FQW A;  1H4C A;  4YS8 A;  3SXD A;  2ICY A;  4D11 A;  5I1F A;  1NF5 B;  1HJJ A;  1SS9 A;  1ZJP A;  5C38 A;  2VS4 A;  1NWG B;  4E1K A;  5DDV A;  2CU2 A;  3QVB A;  2AH9 A;  4Y7F A;  2AM4 A;  2P73 A;  4HOC A;  3SXE A;  4ECM A;  2APC A;  2QGI A;  1V84 A;  2D0J A;  1H4D A;  1MP5 A;  3DUV A;  3JUJ A;  2XWN A;  4EEM A;  3I0E A;  1S4O A;  2J0B A;  4HO2 A;  4LW3 A;  4BQH A;  5EJZ A;  2Y4L A;  4Q7C A;  5CQO A;  3RSB A;  2I7B A;  5DDT A;  1OMX A;  4IRP A;  4JD0 A;  4EEA A;  3E25 A;  1QGS A;  2VSH A;  5CMH A;  3I0I X;  1YP4 A;  2BO6 A;  1H5S B;  3NGW A;  4XWI A;  4B2W A;  2Q4J A;  3IOJ A;  3SX7 A;  3V91 A;  4G3Q A;  2XWM A;  2FYC B;  4AC3 A;  4CJC A;  4B2X A;  4G87 A;  1H3M A;  4DE7 A;  2WVL A;  2ZU9 A;  2A8W A;  3FWW A;  1I52 A;  2RJ1 A;  1ZI4 A;  1O7Q A;  1LZI A;  1ZCT A;  1H5S C;  5FUH A;  1G23 A;  3SX8 A;  3PNN A;  3ZGF A;  1FXO A;  1GX0 A;  1GWV A;  4FIY A;  2JCO A;  4Y7G A;  1LVW A;  2RIX A;  3JTJ A;  1QG8 A;  2C0N A;  1ZJ1 A;  1HV9 A;  2PGV A;  1VGU A;  1LL0 A;  2VK9 A;  5C1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...