1WT3A

Mutant human abo(h) blood group glycosyltransferase with bound udp and acceptor
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
283
structure length
263
Chain Sequence
MVSLPRMVYPQSKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGRFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histo-blood group ABO system transferase
publication title Structural basis for the inactivity of human blood group o2 glycosyltransferase
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 263
sequence length 283
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2004-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1wt3A00
5C8RA 1YROB 5JQQA 4NAIA 2BO8A 3EE5A 1H7LA 5C4FA 5IDTA 1ZDGA 4MYBA 5L6SA 2V0KA 3V91A 4KPZA 1SS9A 3I0IX 2YC5A 3I0HA 1W57A 4LW6A 4KNXA 4M28A 3OGZA 1W77A 3BCVA 1I52A 3Q4SA 3SXAA 2Y4MA 1O7QA 2RJ0A 5L6VA 5C38A 4HO2A 3U2TA 3TZTA 3SX5A 4FRBA 1LZ0A 4HG6A 2Y4LA 4KPXA 4FQWA 4HO3A 1R82A 2BO4A 4EE5A 5C48A 1R7YA 3DUVA 1XHBA 3V0QA 5DDVA 1LVWA 4HO9A 1LZ7A 1VGZA 2W0WA 3U2VA 3I0EA 2VSHA 2AECA 5DDTA 1QWJA 1FR8A 4JD0A 4LW3A 5BXCA 4DE7A 3R2WA 1LL0A 4Y64A 4FRHA 2WVKA 3F1YA 1G23A 2AM3A 1XZ6A 2JCLA 4NAKA 4HOCA 1ZCVA 4G3SA 2AGDA 5C4BA 3I0LA 3POLA 2VS5A 4KT7A 4KXOA 5C49A 1NQIB 1TW1A 2AE7A 1VGTA 5CMIA 3T7NA 2RIXA 3CGXA 2AM5A 4B4GA 4J18A 3I0GA 3CU0A 1H5SA 2PGYA 1WVCA 1OMXA 1ZJPA 3O3PA 1H4CA 4ARWA 5IDSA 1VICA 3U2UA 3JTJA 1R7XA 2ZU9A 4D0ZA 3OH1A 5FTSA 2AH9A 5FV9A 2WVLA 2WVMA 2ZU7A 1O0RA 4YS8A 4KQLA 3U2XA 2ICXA 2PA4A 1GA8A 5C3BA 4ECMA 1EZIA 5AJNA 4CJCA 5FUHA 3PKPA 2RJ9A 2X60A 3ZF8A 1FRWA 2OI6A 1LL3A 5J49A 4B3UA 1ZHJA 2V0LA 2V0JA 3PKQA 4EE4A 1ZI3A 1V82A 2I7BA 2PX7A 4L41C 1H5SC 1G1LA 1G0RA 1S4NA 2QH5A 1H7QA 2FYBA 2WAWA 2XWNA 4C2SA 3D8VA 1G97A 1HJLA 2QGIA 4R7PA 3V90A 4Y6UA 4Y7UA 4IRQA 2JCJA 1LZIA 2A8UA 2V0IA 3DK5A 1HM8A 2DPWA 2RJ8A 2YQCA 3V0OA 1TVYA 1IINA 4JISA 4D48A 1FO8A 5EIYA 2VSIA 4HO5A 5C3DA 2YESA 2O1FA 2JCOA 1LL2A 1G95A 3I0CA 4Y7GA 1ON6A 4HO6A 1R7TA 1ZI1A 2Y4JA 2W0VA 4P02A 4Y7FA 1GQ9A 5CMJA 1S4OA 1VZTA 4B4BA 4AC3A 2FYDB 3KIAA 1FOAA 1FO9A 2D7RA 1OMZA 3E26A 3FOQA 1HJJA 3N9WA 3ZGGA 2A8WA 2XMEA 1LZJA 3SX7A 1FXOA 3T7MA 1K4VA 2UX8A 1VH3A 1WT0A 5C36A 1TW5A 2FYAA 2Y7AA 3RSBA 1FXJA 2FY7A 5C47A 1IIMA 1FG5N 1NKHB 1H7TA 1G3LA 5C1GA 1G9RA 4Y9XA 3OAMA 5C1HA 3ST8A 4BQHA 1H7FA 1VZXA 1JYKA 3OH3A 3D5NA 4Y6NA 2AM4A 2BO7A 3I0JA 3QVBA 2VXLA 1FWYA 2I5EA 4DECA 1S4PA 2D7IA 5CQLX 4FRQA 4FRDA 4BMAA 1O7OA 1JVDA 3JUJA 1NF5B 4FRAA 3SX3A 3PNNA 1ZCYA 3OH2A 2AESA 1WT3A 3U2WA 4Y62A 3SPTA 4HO8A 3V8YA 5CQOA 4P00A 4AAWA 1OQMB 5C4CA 3LW6A 3OH4A 2VFZA 1R81A 4NANA 3CKVA 2WGZA 2GGQA 3Q7UA 1VGUA 1GX0A 2OEFA 3D98A 1NWGB 2P73A 4E1KA 3OKRA 4KC4A 1ZCTA 2RJ6A 3SXCA 1HM9A 4IRPA 4B42A 2APCA 4M4KA 1YP2A 4XWIA 1WT1A 4ZDQA 4EEAA 1VH1A 1NMMB 3V0PA 1MP3A 2VXMA 1FGGA 1MP4A 2MZBA 5CQMX 1ZCUA 3V8ZA 2YQSA 2OEGA 4FCEA 4NALA 3SXGA 1WT2A 3U0XA 1PZYB 2YQJA 3SXEA 1H7EA 3F1CA 5IFYA 1G2VA 2FFUA 1ZJ0A 2Z86A 4EE3A 4CJ8A 4EVWA 1MP5A 1H5RB 5CMHA 4B2XA 2RJ1A 1Z90A 2NXVA 2P72A 1H3MA 4GBPA 1ZJ1A 5CQNX 3RMWA 3OC9A 4KNRA 3SXDA 2V0HA 3IOIA 2X65A 5CMGX 2RIYA 2VS3A 2QKXA 3U0YA 3CKJA 2JCKA 1W55A 4KRVA 2CU2A 1YP4A 4K6RA 1GWWA 1ZI5A 1ZI4A 2RITA 1FGXA 1VM8A 2ZU8A 5FTVA 4Y7VA 3RMVA 4D11A 5HS2A 5FYEA 3ZLLA 1O23B 1GQCA 1V84A 1VZUA 4B5BA 5EJ1A 1PZTA 3USQA 5C4DA 3GUEA 1TZFA 2O1GA 4KC2A 2VS4A 1JVGA 3CKQA 3ZLKA 2I5KA 1ZJ3A 1QGQA 2ICYA 1ZJOA 2FFVA 1R7UA 4Y7TA 5AJOA 2D0JA 5C1LA 3IOJA 5C4EA 2WE9A 2VD4A 3USRA 1H4EA 2OI5A 3HL3A 2OI7A 1H5TB 4ASYA 2YQHA 4MNDA 3IOHA 1E5KA 2RJ5A 1JV3A 1KWSA 1MC3A 4B2WA 2O1HA 3T7OA 3E25A 2YC3A 2Q4JA 1V83A 3SX8A 2P6WA 4M2BA 4HO4A 4D11C 4FRLA 1EYRA 2PGVA 2Y4KA 3JUKA 1H5RA 3ZGFA 4EEGA 4FRPA 4HCQA 3NGWA 4AYLA 2GGOA 2Z87A 5FU8A 4D0TA 1INIA 4EEOA 1YP3A 1NHEB 2FYCB 1JV1A 1ZJ2A 2X5SA 3CKOA 4Y63A 1H5SD 4FCUA 4CJBA 3K8EA 1ZIZA 2XMHA 3FWWA 2E8BA 4B4MA 1FZWA 5I1FA 1ON8A 1QGSA 3I0FA 1G8OA 4AYJA 5FU0A 4G3PA 1G93A 1HM0A 2XWLA 4HO0A 5C3AA 2RJ7A 5AJPA 3TQDA 3V0LA 3BRKX 1VPAA 2WEEA 1H7GA 3I0DA 3SXBA 2XWMA 1H7HA 1H4DA 3I0KA 1QG8A 5CMFX 1H5TA 4ASJA 3R3IA 5EJZA 1ZDFA 2X5ZA 1R7VA 3DJ4A 2Y6PA 3V0MA 3K8DA 2BO6A 4CVHA 4G87A 1GWVA 4KC1A 1H5SB 4FROA 4UEGA 2RJ4A 5CQPA 3V0NA 4FRMA 3Q80A 1FR9A 1WSZA 1INJA 3CKNA 1VGWA 2E3DA 1HV9A 4FREA 4G3QA 4M2AA 1JYLA 1R80A 4EEMA 2RIZA 1GX4A 4DDZA 3OH0A 2YCMA
chains in the Genus database with same CATH superfamily
5C8RA 1YROB 5JQQA 4NAIA 2BO8A 3EE5A 1H7LA 5C4FA 5IDTA 1ZDGA 4MYBA 5L6SA 2V0KA 3V91A 4KPZA 1SS9A 3I0IX 2YC5A 3I0HA 1W57A 4LW6A 4KNXA 4M28A 3OGZA 1W77A 3BCVA 1I52A 3Q4SA 3SXAA 2Y4MA 1O7QA 2RJ0A 5L6VA 5C38A 4HO2A 3U2TA 3TZTA 3SX5A 4FRBA 1LZ0A 4HG6A 2Y4LA 4KPXA 4FQWA 4HO3A 1R82A 2BO4A 4EE5A 5C48A 1R7YA 3DUVA 1XHBA 3V0QA 5DDVA 1LVWA 4HO9A 1LZ7A 1VGZA 2W0WA 3U2VA 3I0EA 2VSHA 2AECA 5DDTA 1QWJA 1FR8A 4JD0A 4LW3A 5BXCA 4DE7A 3R2WA 1LL0A 4Y64A 4FRHA 2WVKA 3F1YA 1G23A 2AM3A 1XZ6A 2JCLA 4NAKA 4HOCA 1ZCVA 4G3SA 2AGDA 5C4BA 3I0LA 3POLA 2VS5A 4KT7A 4KXOA 5C49A 1NQIB 1TW1A 2AE7A 1VGTA 5CMIA 3T7NA 2RIXA 3CGXA 2AM5A 4B4GA 4J18A 3I0GA 3CU0A 1H5SA 2PGYA 1WVCA 1OMXA 1ZJPA 3O3PA 1H4CA 4ARWA 5IDSA 1VICA 3U2UA 3JTJA 1R7XA 2ZU9A 2J0AA 4D0ZA 3OH1A 5FTSA 2AH9A 4MIXA 5FV9A 2WVLA 2WVMA 2ZU7A 1O0RA 4YS8A 4KQLA 3U2XA 2ICXA 2PA4A 1GA8A 5C3BA 4ECMA 1EZIA 5AJNA 4CJCA 5FUHA 3PKPA 2RJ9A 2X60A 3ZF8A 1FRWA 2OI6A 1LL3A 5J49A 4B3UA 1ZHJA 2V0LA 2V0JA 3PKQA 4EE4A 1ZI3A 1V82A 2I7BA 4FIXA 2PX7A 4L41C 1H5SC 1G1LA 1G0RA 1S4NA 2QH5A 1H7QA 2FYBA 2WAWA 2XWNA 4C2SA 3D8VA 1G97A 1HJLA 2QGIA 4R7PA 3V90A 4Y6UA 4Y7UA 4IRQA 2JCJA 1LZIA 2A8UA 2V0IA 1HM8A 3DK5A 2DPWA 2RJ8A 2YQCA 3V0OA 1TVYA 1IINA 4JISA 4D48A 1FO8A 5EIYA 2VSIA 4HO5A 5C3DA 2YESA 2O1FA 2JCOA 1LL2A 1G95A 3I0CA 4Y7GA 1ON6A 4HO6A 1R7TA 1ZI1A 2Y4JA 2W0VA 4P02A 4Y7FA 1GQ9A 5CMJA 1S4OA 1VZTA 4B4BA 4AC3A 2FYDB 3KIAA 1FOAA 1FO9A 2D7RA 1OMZA 3E26A 3FOQA 1HJJA 3N9WA 3ZGGA 2A8WA 2XMEA 1LZJA 3SX7A 1FXOA 3T7MA 1K4VA 2UX8A 1VH3A 1WT0A 5C36A 1TW5A 2FYAA 2Y7AA 3RSBA 1FXJA 2FY7A 4O6NA 5C47A 1IIMA 1FG5N 1NKHB 1H7TA 1G3LA 5C1GA 1G9RA 4Y9XA 3OAMA 5C1HA 3ST8A 4BQHA 1H7FA 1VZXA 1JYKA 3OH3A 4FIYA 3D5NA 4Y6NA 2AM4A 2BO7A 3I0JA 3QVBA 2VXLA 1FWYA 2I5EA 4DECA 1S4PA 2D7IA 5CQLX 4FRQA 2C0NA 4FRDA 4BMAA 1O7OA 1JVDA 3JUJA 1NF5B 4FRAA 3SX3A 2J0BA 3PNNA 1ZCYA 3OH2A 2AESA 1WT3A 3U2WA 4Y62A 3SPTA 4HO8A 3V8YA 5CQOA 4P00A 4AAWA 1OQMB 5C4CA 3LW6A 3OH4A 2VFZA 1R81A 4NANA 3CKVA 2WGZA 2GGQA 3Q7UA 1VGUA 1GX0A 2OEFA 3D98A 1NWGB 2P73A 4E1KA 3OKRA 4KC4A 1ZCTA 2RJ6A 3SXCA 1HM9A 4IRPA 4B42A 2APCA 4M4KA 1YP2A 4XWIA 1WT1A 4ZDQA 4EEAA 1VH1A 1NMMB 3V0PA 1MP3A 2VXMA 1FGGA 1MP4A 2MZBA 5CQMX 1ZCUA 3V8ZA 2YQSA 2OEGA 4FCEA 4NALA 3SXGA 1WT2A 3U0XA 1PZYB 2YQJA 3SXEA 1H7EA 3F1CA 5IFYA 1G2VA 2FFUA 1ZJ0A 2Z86A 4EE3A 4CJ8A 4EVWA 1MP5A 1H5RB 5CMHA 4B2XA 2RJ1A 1Z90A 2NXVA 2P72A 1H3MA 4GBPA 1ZJ1A 5CQNX 3RMWA 3OC9A 4KNRA 3SXDA 2V0HA 3IOIA 2X65A 4Q7CA 5CMGX 2RIYA 2VS3A 2QKXA 3U0YA 3CKJA 2JCKA 1W55A 4KRVA 2CU2A 1YP4A 4K6RA 1GWWA 1ZI5A 1ZI4A 4O6MA 2RITA 1FGXA 1VM8A 2ZU8A 5FTVA 4Y7VA 3RMVA 4D11A 5HS2A 5FYEA 3ZLLA 1O23B 1GQCA 1V84A 1VZUA 4B5BA 5EJ1A 1PZTA 3USQA 5C4DA 3GUEA 1TZFA 2O1GA 4KC2A 2VS4A 1JVGA 3CKQA 3ZLKA 2I5KA 1ZJ3A 1QGQA 2ICYA 1ZJOA 2FFVA 1R7UA 4Y7TA 5AJOA 2D0JA 5C1LA 3IOJA 5C4EA 2WE9A 2VD4A 3USRA 1H4EA 5D92A 2OI5A 3HL3A 2OI7A 1H5TB 4ASYA 2YQHA 4MNDA 3IOHA 1E5KA 2RJ5A 1JV3A 1KWSA 1MC3A 4B2WA 2O1HA 3T7OA 3E25A 2YC3A 2Q4JA 1V83A 3SX8A 2P6WA 4M2BA 2VK9A 4HO4A 4D11C 4FRLA 1EYRA 2PGVA 2Y4KA 3JUKA 1H5RA 3ZGFA 4EEGA 4FRPA 4HCQA 3NGWA 4AYLA 2GGOA 2Z87A 5FU8A 4D0TA 1INIA 5D91A 4EEOA 1YP3A 1NHEB 2FYCB 1JV1A 1ZJ2A 2X5SA 3CKOA 4Y63A 1H5SD 4FCUA 4CJBA 3K8EA 1ZIZA 2XMHA 3FWWA 2E8BA 4B4MA 1FZWA 5I1FA 1ON8A 1QGSA 3I0FA 1G8OA 4AYJA 5FU0A 4G3PA 1G93A 1HM0A 2XWLA 4HO0A 5C3AA 2RJ7A 5AJPA 3TQDA 3V0LA 3BRKX 1VPAA 2WEEA 1H7GA 3I0DA 3SXBA 2XWMA 1H7HA 1H4DA 3I0KA 1QG8A 5CMFX 1H5TA 4ASJA 3R3IA 5EJZA 1ZDFA 2X5ZA 1R7VA 3DJ4A 2Y6PA 3V0MA 3K8DA 2BO6A 4CVHA 4G87A 1GWVA 4KC1A 1H5SB 4FROA 4UEGA 2RJ4A 5CQPA 3V0NA 4FRMA 3Q80A 1FR9A 1WSZA 1INJA 3CKNA 1VGWA 2E3DA 1HV9A 4FREA 4G3QA 4M2AA 1JYLA 1R80A 4EEMA 2RIZA 1GX4A 4DDZA 3OH0A 2YCMA
chains in the Genus database with same CATH topology
5C8RA 1YROB 5JQQA 4NAIA 2BO8A 3EE5A 1H7LA 5C4FA 5IDTA 1ZDGA 4MYBA 5L6SA 2V0KA 3V91A 4KPZA 1SS9A 3I0IX 2YC5A 3I0HA 1W57A 4LW6A 4KNXA 4M28A 3OGZA 1W77A 3BCVA 1I52A 3Q4SA 3SXAA 2Y4MA 1O7QA 2RJ0A 5L6VA 5C38A 4HO2A 3U2TA 3TZTA 3SX5A 4FRBA 1LZ0A 4HG6A 2Y4LA 4KPXA 4FQWA 4HO3A 1R82A 2BO4A 4EE5A 5C48A 1R7YA 3DUVA 1XHBA 3V0QA 5DDVA 1LVWA 4HO9A 1LZ7A 1VGZA 2W0WA 3U2VA 3I0EA 2VSHA 2AECA 5DDTA 1QWJA 1FR8A 4JD0A 4LW3A 5BXCA 4DE7A 3R2WA 1LL0A 4Y64A 4FRHA 2WVKA 3F1YA 1G23A 2AM3A 1XZ6A 2JCLA 4NAKA 4HOCA 1ZCVA 4G3SA 2AGDA 5C4BA 3I0LA 3POLA 2VS5A 4KT7A 4KXOA 5C49A 1NQIB 1TW1A 2AE7A 1VGTA 5CMIA 3T7NA 2RIXA 3CGXA 2AM5A 4B4GA 4J18A 3I0GA 3CU0A 1H5SA 2PGYA 1WVCA 1OMXA 1ZJPA 3O3PA 1H4CA 4ARWA 5IDSA 1VICA 3U2UA 3JTJA 1R7XA 2ZU9A 2J0AA 4D0ZA 3OH1A 5FTSA 2AH9A 4MIXA 5FV9A 2WVLA 2WVMA 2ZU7A 1O0RA 4YS8A 4KQLA 3U2XA 2ICXA 2PA4A 1GA8A 5C3BA 4ECMA 1EZIA 5AJNA 4CJCA 5FUHA 3PKPA 2RJ9A 2X60A 3ZF8A 1FRWA 2OI6A 1LL3A 5J49A 4B3UA 1ZHJA 2V0LA 2V0JA 3PKQA 4EE4A 1ZI3A 1V82A 2I7BA 4FIXA 2PX7A 4L41C 1H5SC 1G1LA 1G0RA 1S4NA 2QH5A 1H7QA 2FYBA 2WAWA 2XWNA 4C2SA 3D8VA 1G97A 1HJLA 2QGIA 4R7PA 3V90A 4Y6UA 4Y7UA 4IRQA 2JCJA 1LZIA 2A8UA 2V0IA 1HM8A 3DK5A 2DPWA 2RJ8A 2YQCA 3V0OA 1TVYA 1IINA 4JISA 4D48A 1FO8A 5EIYA 2VSIA 4HO5A 5C3DA 2YESA 2O1FA 2JCOA 1LL2A 1G95A 3I0CA 4Y7GA 1ON6A 4HO6A 1R7TA 1ZI1A 2Y4JA 2W0VA 4P02A 4Y7FA 1GQ9A 5CMJA 1S4OA 1VZTA 4B4BA 4AC3A 2FYDB 3KIAA 1FOAA 1FO9A 2D7RA 1OMZA 3E26A 3FOQA 1HJJA 3N9WA 3ZGGA 2A8WA 2XMEA 1LZJA 3SX7A 1FXOA 3T7MA 1K4VA 2UX8A 1VH3A 1WT0A 5C36A 1TW5A 2FYAA 2Y7AA 3RSBA 1FXJA 2FY7A 4O6NA 5C47A 1IIMA 1FG5N 1NKHB 1H7TA 1G3LA 5C1GA 1G9RA 4Y9XA 3OAMA 5C1HA 3ST8A 4BQHA 1H7FA 1VZXA 1JYKA 3OH3A 4FIYA 3D5NA 4Y6NA 2AM4A 2BO7A 3I0JA 3QVBA 2VXLA 1FWYA 2I5EA 4DECA 1S4PA 2D7IA 5CQLX 4FRQA 2C0NA 4FRDA 4BMAA 1O7OA 1JVDA 3JUJA 1NF5B 4FRAA 3SX3A 2J0BA 3PNNA 1ZCYA 3OH2A 2AESA 1WT3A 3U2WA 4Y62A 3SPTA 4HO8A 3V8YA 5CQOA 4P00A 4AAWA 1OQMB 5C4CA 3LW6A 3OH4A 2VFZA 1R81A 4NANA 3CKVA 2WGZA 2GGQA 3Q7UA 1VGUA 1GX0A 2OEFA 3D98A 1NWGB 2P73A 4E1KA 3OKRA 4KC4A 1ZCTA 2RJ6A 3SXCA 1HM9A 4IRPA 4B42A 2APCA 4M4KA 1YP2A 4XWIA 1WT1A 4ZDQA 4EEAA 1VH1A 1NMMB 3V0PA 1MP3A 2VXMA 1FGGA 1MP4A 2MZBA 5CQMX 1ZCUA 3V8ZA 2YQSA 2OEGA 4FCEA 4NALA 3SXGA 1WT2A 3U0XA 1PZYB 2YQJA 3SXEA 1H7EA 3F1CA 5IFYA 1G2VA 2FFUA 1ZJ0A 2Z86A 4EE3A 4CJ8A 4EVWA 1MP5A 1H5RB 5CMHA 4B2XA 2RJ1A 1Z90A 2NXVA 2P72A 1H3MA 4GBPA 1ZJ1A 5CQNX 3RMWA 3OC9A 4KNRA 3SXDA 2V0HA 3IOIA 2X65A 4Q7CA 5CMGX 2RIYA 2VS3A 2QKXA 3U0YA 3CKJA 2JCKA 1W55A 4KRVA 2CU2A 1YP4A 4K6RA 1GWWA 1ZI5A 1ZI4A 4O6MA 2RITA 1FGXA 1VM8A 2ZU8A 5FTVA 4Y7VA 3RMVA 4D11A 5HS2A 5FYEA 3ZLLA 1O23B 1GQCA 1V84A 1VZUA 4B5BA 5EJ1A 1PZTA 3USQA 5C4DA 3GUEA 1TZFA 2O1GA 4KC2A 2VS4A 1JVGA 3CKQA 3ZLKA 2I5KA 1ZJ3A 1QGQA 2ICYA 1ZJOA 2FFVA 1R7UA 4Y7TA 5AJOA 2D0JA 5C1LA 3IOJA 5C4EA 2WE9A 2VD4A 3USRA 1H4EA 5D92A 2OI5A 3HL3A 2OI7A 1H5TB 4ASYA 2YQHA 4MNDA 3IOHA 1E5KA 2RJ5A 1JV3A 1KWSA 1MC3A 4B2WA 2O1HA 3T7OA 3E25A 2YC3A 2Q4JA 1V83A 3SX8A 2P6WA 4M2BA 2VK9A 4HO4A 4D11C 4FRLA 1EYRA 2PGVA 2Y4KA 3JUKA 1H5RA 3ZGFA 4EEGA 4FRPA 4HCQA 3NGWA 4AYLA 2GGOA 2Z87A 5FU8A 4D0TA 1INIA 5D91A 4EEOA 1YP3A 1NHEB 2FYCB 1JV1A 1ZJ2A 2X5SA 3CKOA 4Y63A 1H5SD 4FCUA 4CJBA 3K8EA 1ZIZA 2XMHA 3FWWA 2E8BA 4B4MA 1FZWA 5I1FA 1ON8A 1QGSA 3I0FA 1G8OA 4AYJA 5FU0A 4G3PA 1G93A 1HM0A 2XWLA 4HO0A 5C3AA 2RJ7A 5AJPA 3TQDA 3V0LA 3BRKX 1VPAA 2WEEA 1H7GA 3I0DA 3SXBA 2XWMA 1H7HA 1H4DA 3I0KA 1QG8A 5CMFX 1H5TA 4ASJA 3R3IA 5EJZA 1ZDFA 2X5ZA 1R7VA 3DJ4A 2Y6PA 3V0MA 3K8DA 2BO6A 4CVHA 4G87A 1GWVA 4KC1A 1H5SB 4FROA 4UEGA 2RJ4A 5CQPA 3V0NA 4FRMA 3Q80A 1FR9A 1WSZA 1INJA 3CKNA 1VGWA 2E3DA 1HV9A 4FREA 4G3QA 4M2AA 1JYLA 1R80A 4EEMA 2RIZA 1GX4A 4DDZA 3OH0A 2YCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C8R A;  1YRO B;  5JQQ A;  4NAI A;  2BO8 A;  3EE5 A;  1H7L A;  5C4F A;  5IDT A;  1ZDG A;  4MYB A;  5L6S A;  2V0K A;  3V91 A;  4KPZ A;  1SS9 A;  3I0I X;  2YC5 A;  3I0H A;  1W57 A;  4LW6 A;  4KNX A;  4M28 A;  3OGZ A;  1W77 A;  3BCV A;  1I52 A;  3Q4S A;  3SXA A;  2Y4M A;  1O7Q A;  2RJ0 A;  5L6V A;  5C38 A;  4HO2 A;  3U2T A;  3TZT A;  3SX5 A;  4FRB A;  1LZ0 A;  4HG6 A;  2Y4L A;  4KPX A;  4FQW A;  4HO3 A;  1R82 A;  2BO4 A;  4EE5 A;  5C48 A;  1R7Y A;  3DUV A;  1XHB A;  3V0Q A;  5DDV A;  1LVW A;  4HO9 A;  1LZ7 A;  1VGZ A;  2W0W A;  3U2V A;  3I0E A;  2VSH A;  2AEC A;  5DDT A;  1QWJ A;  1FR8 A;  4JD0 A;  4LW3 A;  5BXC A;  4DE7 A;  3R2W A;  1LL0 A;  4Y64 A;  4FRH A;  2WVK A;  3F1Y A;  1G23 A;  2AM3 A;  1XZ6 A;  2JCL A;  4NAK A;  4HOC A;  1ZCV A;  4G3S A;  2AGD A;  5C4B A;  3I0L A;  3POL A;  2VS5 A;  4KT7 A;  4KXO A;  5C49 A;  1NQI B;  1TW1 A;  2AE7 A;  1VGT A;  5CMI A;  3T7N A;  2RIX A;  3CGX A;  2AM5 A;  4B4G A;  4J18 A;  3I0G A;  3CU0 A;  1H5S A;  2PGY A;  1WVC A;  1OMX A;  1ZJP A;  3O3P A;  1H4C A;  4ARW A;  5IDS A;  1VIC A;  3U2U A;  3JTJ A;  1R7X A;  2ZU9 A;  4D0Z A;  3OH1 A;  5FTS A;  2AH9 A;  5FV9 A;  2WVL A;  2WVM A;  2ZU7 A;  1O0R A;  4YS8 A;  4KQL A;  3U2X A;  2ICX A;  2PA4 A;  1GA8 A;  5C3B A;  4ECM A;  1EZI A;  5AJN A;  4CJC A;  5FUH A;  3PKP A;  2RJ9 A;  2X60 A;  3ZF8 A;  1FRW A;  2OI6 A;  1LL3 A;  5J49 A;  4B3U A;  1ZHJ A;  2V0L A;  2V0J A;  3PKQ A;  4EE4 A;  1ZI3 A;  1V82 A;  2I7B A;  2PX7 A;  4L41 C;  1H5S C;  1G1L A;  1G0R A;  1S4N A;  2QH5 A;  1H7Q A;  2FYB A;  2WAW A;  2XWN A;  4C2S A;  3D8V A;  1G97 A;  1HJL A;  2QGI A;  4R7P A;  3V90 A;  4Y6U A;  4Y7U A;  4IRQ A;  2JCJ A;  1LZI A;  2A8U A;  2V0I A;  3DK5 A;  1HM8 A;  2DPW A;  2RJ8 A;  2YQC A;  3V0O A;  1TVY A;  1IIN A;  4JIS A;  4D48 A;  1FO8 A;  5EIY A;  2VSI A;  4HO5 A;  5C3D A;  2YES A;  2O1F A;  2JCO A;  1LL2 A;  1G95 A;  3I0C A;  4Y7G A;  1ON6 A;  4HO6 A;  1R7T A;  1ZI1 A;  2Y4J A;  2W0V A;  4P02 A;  4Y7F A;  1GQ9 A;  5CMJ A;  1S4O A;  1VZT A;  4B4B A;  4AC3 A;  2FYD B;  3KIA A;  1FOA A;  1FO9 A;  2D7R A;  1OMZ A;  3E26 A;  3FOQ A;  1HJJ A;  3N9W A;  3ZGG A;  2A8W A;  2XME A;  1LZJ A;  3SX7 A;  1FXO A;  3T7M A;  1K4V A;  2UX8 A;  1VH3 A;  1WT0 A;  5C36 A;  1TW5 A;  2FYA A;  2Y7A A;  3RSB A;  1FXJ A;  2FY7 A;  5C47 A;  1IIM A;  1FG5 N;  1NKH B;  1H7T A;  1G3L A;  5C1G A;  1G9R A;  4Y9X A;  3OAM A;  5C1H A;  3ST8 A;  4BQH A;  1H7F A;  1VZX A;  1JYK A;  3OH3 A;  3D5N A;  4Y6N A;  2AM4 A;  2BO7 A;  3I0J A;  3QVB A;  2VXL A;  1FWY A;  2I5E A;  4DEC A;  1S4P A;  2D7I A;  5CQL X;  4FRQ A;  4FRD A;  4BMA A;  1O7O A;  1JVD A;  3JUJ A;  1NF5 B;  4FRA A;  3SX3 A;  3PNN A;  1ZCY A;  3OH2 A;  2AES A;  1WT3 A;  3U2W A;  4Y62 A;  3SPT A;  4HO8 A;  3V8Y A;  5CQO A;  4P00 A;  4AAW A;  1OQM B;  5C4C A;  3LW6 A;  3OH4 A;  2VFZ A;  1R81 A;  4NAN A;  3CKV A;  2WGZ A;  2GGQ A;  3Q7U A;  1VGU A;  1GX0 A;  2OEF A;  3D98 A;  1NWG B;  2P73 A;  4E1K A;  3OKR A;  4KC4 A;  1ZCT A;  2RJ6 A;  3SXC A;  1HM9 A;  4IRP A;  4B42 A;  2APC A;  4M4K A;  1YP2 A;  4XWI A;  1WT1 A;  4ZDQ A;  4EEA A;  1VH1 A;  1NMM B;  3V0P A;  1MP3 A;  2VXM A;  1FGG A;  1MP4 A;  2MZB A;  5CQM X;  1ZCU A;  3V8Z A;  2YQS A;  2OEG A;  4FCE A;  4NAL A;  3SXG A;  1WT2 A;  3U0X A;  1PZY B;  2YQJ A;  3SXE A;  1H7E A;  3F1C A;  5IFY A;  1G2V A;  2FFU A;  1ZJ0 A;  2Z86 A;  4EE3 A;  4CJ8 A;  4EVW A;  1MP5 A;  1H5R B;  5CMH A;  4B2X A;  2RJ1 A;  1Z90 A;  2NXV A;  2P72 A;  1H3M A;  4GBP A;  1ZJ1 A;  5CQN X;  3RMW A;  3OC9 A;  4KNR A;  3SXD A;  2V0H A;  3IOI A;  2X65 A;  5CMG X;  2RIY A;  2VS3 A;  2QKX A;  3U0Y A;  3CKJ A;  2JCK A;  1W55 A;  4KRV A;  2CU2 A;  1YP4 A;  4K6R A;  1GWW A;  1ZI5 A;  1ZI4 A;  2RIT A;  1FGX A;  1VM8 A;  2ZU8 A;  5FTV A;  4Y7V A;  3RMV A;  4D11 A;  5HS2 A;  5FYE A;  3ZLL A;  1O23 B;  1GQC A;  1V84 A;  1VZU A;  4B5B A;  5EJ1 A;  1PZT A;  3USQ A;  5C4D A;  3GUE A;  1TZF A;  2O1G A;  4KC2 A;  2VS4 A;  1JVG A;  3CKQ A;  3ZLK A;  2I5K A;  1ZJ3 A;  1QGQ A;  2ICY A;  1ZJO A;  2FFV A;  1R7U A;  4Y7T A;  5AJO A;  2D0J A;  5C1L A;  3IOJ A;  5C4E A;  2WE9 A;  2VD4 A;  3USR A;  1H4E A;  2OI5 A;  3HL3 A;  2OI7 A;  1H5T B;  4ASY A;  2YQH A;  4MND A;  3IOH A;  1E5K A;  2RJ5 A;  1JV3 A;  1KWS A;  1MC3 A;  4B2W A;  2O1H A;  3T7O A;  3E25 A;  2YC3 A;  2Q4J A;  1V83 A;  3SX8 A;  2P6W A;  4M2B A;  4HO4 A;  4D11 C;  4FRL A;  1EYR A;  2PGV A;  2Y4K A;  3JUK A;  1H5R A;  3ZGF A;  4EEG A;  4FRP A;  4HCQ A;  3NGW A;  4AYL A;  2GGO A;  2Z87 A;  5FU8 A;  4D0T A;  1INI A;  4EEO A;  1YP3 A;  1NHE B;  2FYC B;  1JV1 A;  1ZJ2 A;  2X5S A;  3CKO A;  4Y63 A;  1H5S D;  4FCU A;  4CJB A;  3K8E A;  1ZIZ A;  2XMH A;  3FWW A;  2E8B A;  4B4M A;  1FZW A;  5I1F A;  1ON8 A;  1QGS A;  3I0F A;  1G8O A;  4AYJ A;  5FU0 A;  4G3P A;  1G93 A;  1HM0 A;  2XWL A;  4HO0 A;  5C3A A;  2RJ7 A;  5AJP A;  3TQD A;  3V0L A;  3BRK X;  1VPA A;  2WEE A;  1H7G A;  3I0D A;  3SXB A;  2XWM A;  1H7H A;  1H4D A;  3I0K A;  1QG8 A;  5CMF X;  1H5T A;  4ASJ A;  3R3I A;  5EJZ A;  1ZDF A;  2X5Z A;  1R7V A;  3DJ4 A;  2Y6P A;  3V0M A;  3K8D A;  2BO6 A;  4CVH A;  4G87 A;  1GWV A;  4KC1 A;  1H5S B;  4FRO A;  4UEG A;  2RJ4 A;  5CQP A;  3V0N A;  4FRM A;  3Q80 A;  1FR9 A;  1WSZ A;  1INJ A;  3CKN A;  1VGW A;  2E3D A;  1HV9 A;  4FRE A;  4G3Q A;  4M2A A;  1JYL A;  1R80 A;  4EEM A;  2RIZ A;  1GX4 A;  4DDZ A;  3OH0 A;  2YCM A; 
#chains in the Genus database with same CATH topology
 5C8R A;  1YRO B;  5JQQ A;  4NAI A;  2BO8 A;  3EE5 A;  1H7L A;  5C4F A;  5IDT A;  1ZDG A;  4MYB A;  5L6S A;  2V0K A;  3V91 A;  4KPZ A;  1SS9 A;  3I0I X;  2YC5 A;  3I0H A;  1W57 A;  4LW6 A;  4KNX A;  4M28 A;  3OGZ A;  1W77 A;  3BCV A;  1I52 A;  3Q4S A;  3SXA A;  2Y4M A;  1O7Q A;  2RJ0 A;  5L6V A;  5C38 A;  4HO2 A;  3U2T A;  3TZT A;  3SX5 A;  4FRB A;  1LZ0 A;  4HG6 A;  2Y4L A;  4KPX A;  4FQW A;  4HO3 A;  1R82 A;  2BO4 A;  4EE5 A;  5C48 A;  1R7Y A;  3DUV A;  1XHB A;  3V0Q A;  5DDV A;  1LVW A;  4HO9 A;  1LZ7 A;  1VGZ A;  2W0W A;  3U2V A;  3I0E A;  2VSH A;  2AEC A;  5DDT A;  1QWJ A;  1FR8 A;  4JD0 A;  4LW3 A;  5BXC A;  4DE7 A;  3R2W A;  1LL0 A;  4Y64 A;  4FRH A;  2WVK A;  3F1Y A;  1G23 A;  2AM3 A;  1XZ6 A;  2JCL A;  4NAK A;  4HOC A;  1ZCV A;  4G3S A;  2AGD A;  5C4B A;  3I0L A;  3POL A;  2VS5 A;  4KT7 A;  4KXO A;  5C49 A;  1NQI B;  1TW1 A;  2AE7 A;  1VGT A;  5CMI A;  3T7N A;  2RIX A;  3CGX A;  2AM5 A;  4B4G A;  4J18 A;  3I0G A;  3CU0 A;  1H5S A;  2PGY A;  1WVC A;  1OMX A;  1ZJP A;  3O3P A;  1H4C A;  4ARW A;  5IDS A;  1VIC A;  3U2U A;  3JTJ A;  1R7X A;  2ZU9 A;  2J0A A;  4D0Z A;  3OH1 A;  5FTS A;  2AH9 A;  4MIX A;  5FV9 A;  2WVL A;  2WVM A;  2ZU7 A;  1O0R A;  4YS8 A;  4KQL A;  3U2X A;  2ICX A;  2PA4 A;  1GA8 A;  5C3B A;  4ECM A;  1EZI A;  5AJN A;  4CJC A;  5FUH A;  3PKP A;  2RJ9 A;  2X60 A;  3ZF8 A;  1FRW A;  2OI6 A;  1LL3 A;  5J49 A;  4B3U A;  1ZHJ A;  2V0L A;  2V0J A;  3PKQ A;  4EE4 A;  1ZI3 A;  1V82 A;  2I7B A;  4FIX A;  2PX7 A;  4L41 C;  1H5S C;  1G1L A;  1G0R A;  1S4N A;  2QH5 A;  1H7Q A;  2FYB A;  2WAW A;  2XWN A;  4C2S A;  3D8V A;  1G97 A;  1HJL A;  2QGI A;  4R7P A;  3V90 A;  4Y6U A;  4Y7U A;  4IRQ A;  2JCJ A;  1LZI A;  2A8U A;  2V0I A;  1HM8 A;  3DK5 A;  2DPW A;  2RJ8 A;  2YQC A;  3V0O A;  1TVY A;  1IIN A;  4JIS A;  4D48 A;  1FO8 A;  5EIY A;  2VSI A;  4HO5 A;  5C3D A;  2YES A;  2O1F A;  2JCO A;  1LL2 A;  1G95 A;  3I0C A;  4Y7G A;  1ON6 A;  4HO6 A;  1R7T A;  1ZI1 A;  2Y4J A;  2W0V A;  4P02 A;  4Y7F A;  1GQ9 A;  5CMJ A;  1S4O A;  1VZT A;  4B4B A;  4AC3 A;  2FYD B;  3KIA A;  1FOA A;  1FO9 A;  2D7R A;  1OMZ A;  3E26 A;  3FOQ A;  1HJJ A;  3N9W A;  3ZGG A;  2A8W A;  2XME A;  1LZJ A;  3SX7 A;  1FXO A;  3T7M A;  1K4V A;  2UX8 A;  1VH3 A;  1WT0 A;  5C36 A;  1TW5 A;  2FYA A;  2Y7A A;  3RSB A;  1FXJ A;  2FY7 A;  4O6N A;  5C47 A;  1IIM A;  1FG5 N;  1NKH B;  1H7T A;  1G3L A;  5C1G A;  1G9R A;  4Y9X A;  3OAM A;  5C1H A;  3ST8 A;  4BQH A;  1H7F A;  1VZX A;  1JYK A;  3OH3 A;  4FIY A;  3D5N A;  4Y6N A;  2AM4 A;  2BO7 A;  3I0J A;  3QVB A;  2VXL A;  1FWY A;  2I5E A;  4DEC A;  1S4P A;  2D7I A;  5CQL X;  4FRQ A;  2C0N A;  4FRD A;  4BMA A;  1O7O A;  1JVD A;  3JUJ A;  1NF5 B;  4FRA A;  3SX3 A;  2J0B A;  3PNN A;  1ZCY A;  3OH2 A;  2AES A;  1WT3 A;  3U2W A;  4Y62 A;  3SPT A;  4HO8 A;  3V8Y A;  5CQO A;  4P00 A;  4AAW A;  1OQM B;  5C4C A;  3LW6 A;  3OH4 A;  2VFZ A;  1R81 A;  4NAN A;  3CKV A;  2WGZ A;  2GGQ A;  3Q7U A;  1VGU A;  1GX0 A;  2OEF A;  3D98 A;  1NWG B;  2P73 A;  4E1K A;  3OKR A;  4KC4 A;  1ZCT A;  2RJ6 A;  3SXC A;  1HM9 A;  4IRP A;  4B42 A;  2APC A;  4M4K A;  1YP2 A;  4XWI A;  1WT1 A;  4ZDQ A;  4EEA A;  1VH1 A;  1NMM B;  3V0P A;  1MP3 A;  2VXM A;  1FGG A;  1MP4 A;  2MZB A;  5CQM X;  1ZCU A;  3V8Z A;  2YQS A;  2OEG A;  4FCE A;  4NAL A;  3SXG A;  1WT2 A;  3U0X A;  1PZY B;  2YQJ A;  3SXE A;  1H7E A;  3F1C A;  5IFY A;  1G2V A;  2FFU A;  1ZJ0 A;  2Z86 A;  4EE3 A;  4CJ8 A;  4EVW A;  1MP5 A;  1H5R B;  5CMH A;  4B2X A;  2RJ1 A;  1Z90 A;  2NXV A;  2P72 A;  1H3M A;  4GBP A;  1ZJ1 A;  5CQN X;  3RMW A;  3OC9 A;  4KNR A;  3SXD A;  2V0H A;  3IOI A;  2X65 A;  4Q7C A;  5CMG X;  2RIY A;  2VS3 A;  2QKX A;  3U0Y A;  3CKJ A;  2JCK A;  1W55 A;  4KRV A;  2CU2 A;  1YP4 A;  4K6R A;  1GWW A;  1ZI5 A;  1ZI4 A;  4O6M A;  2RIT A;  1FGX A;  1VM8 A;  2ZU8 A;  5FTV A;  4Y7V A;  3RMV A;  4D11 A;  5HS2 A;  5FYE A;  3ZLL A;  1O23 B;  1GQC A;  1V84 A;  1VZU A;  4B5B A;  5EJ1 A;  1PZT A;  3USQ A;  5C4D A;  3GUE A;  1TZF A;  2O1G A;  4KC2 A;  2VS4 A;  1JVG A;  3CKQ A;  3ZLK A;  2I5K A;  1ZJ3 A;  1QGQ A;  2ICY A;  1ZJO A;  2FFV A;  1R7U A;  4Y7T A;  5AJO A;  2D0J A;  5C1L A;  3IOJ A;  5C4E A;  2WE9 A;  2VD4 A;  3USR A;  1H4E A;  5D92 A;  2OI5 A;  3HL3 A;  2OI7 A;  1H5T B;  4ASY A;  2YQH A;  4MND A;  3IOH A;  1E5K A;  2RJ5 A;  1JV3 A;  1KWS A;  1MC3 A;  4B2W A;  2O1H A;  3T7O A;  3E25 A;  2YC3 A;  2Q4J A;  1V83 A;  3SX8 A;  2P6W A;  4M2B A;  2VK9 A;  4HO4 A;  4D11 C;  4FRL A;  1EYR A;  2PGV A;  2Y4K A;  3JUK A;  1H5R A;  3ZGF A;  4EEG A;  4FRP A;  4HCQ A;  3NGW A;  4AYL A;  2GGO A;  2Z87 A;  5FU8 A;  4D0T A;  1INI A;  5D91 A;  4EEO A;  1YP3 A;  1NHE B;  2FYC B;  1JV1 A;  1ZJ2 A;  2X5S A;  3CKO A;  4Y63 A;  1H5S D;  4FCU A;  4CJB A;  3K8E A;  1ZIZ A;  2XMH A;  3FWW A;  2E8B A;  4B4M A;  1FZW A;  5I1F A;  1ON8 A;  1QGS A;  3I0F A;  1G8O A;  4AYJ A;  5FU0 A;  4G3P A;  1G93 A;  1HM0 A;  2XWL A;  4HO0 A;  5C3A A;  2RJ7 A;  5AJP A;  3TQD A;  3V0L A;  3BRK X;  1VPA A;  2WEE A;  1H7G A;  3I0D A;  3SXB A;  2XWM A;  1H7H A;  1H4D A;  3I0K A;  1QG8 A;  5CMF X;  1H5T A;  4ASJ A;  3R3I A;  5EJZ A;  1ZDF A;  2X5Z A;  1R7V A;  3DJ4 A;  2Y6P A;  3V0M A;  3K8D A;  2BO6 A;  4CVH A;  4G87 A;  1GWV A;  4KC1 A;  1H5S B;  4FRO A;  4UEG A;  2RJ4 A;  5CQP A;  3V0N A;  4FRM A;  3Q80 A;  1FR9 A;  1WSZ A;  1INJ A;  3CKN A;  1VGW A;  2E3D A;  1HV9 A;  4FRE A;  4G3Q A;  4M2A A;  1JYL A;  1R80 A;  4EEM A;  2RIZ A;  1GX4 A;  4DDZ A;  3OH0 A;  2YCM A; 
#chains in the Genus database with same CATH homology
 5C8R A;  1YRO B;  5JQQ A;  4NAI A;  2BO8 A;  3EE5 A;  1H7L A;  5C4F A;  5IDT A;  1ZDG A;  4MYB A;  5L6S A;  2V0K A;  3V91 A;  4KPZ A;  1SS9 A;  3I0I X;  2YC5 A;  3I0H A;  1W57 A;  4LW6 A;  4KNX A;  4M28 A;  3OGZ A;  1W77 A;  3BCV A;  1I52 A;  3Q4S A;  3SXA A;  2Y4M A;  1O7Q A;  2RJ0 A;  5L6V A;  5C38 A;  4HO2 A;  3U2T A;  3TZT A;  3SX5 A;  4FRB A;  1LZ0 A;  4HG6 A;  2Y4L A;  4KPX A;  4FQW A;  4HO3 A;  1R82 A;  2BO4 A;  4EE5 A;  5C48 A;  1R7Y A;  3DUV A;  1XHB A;  3V0Q A;  5DDV A;  1LVW A;  4HO9 A;  1LZ7 A;  1VGZ A;  2W0W A;  3U2V A;  3I0E A;  2VSH A;  2AEC A;  5DDT A;  1QWJ A;  1FR8 A;  4JD0 A;  4LW3 A;  5BXC A;  4DE7 A;  3R2W A;  1LL0 A;  4Y64 A;  4FRH A;  2WVK A;  3F1Y A;  1G23 A;  2AM3 A;  1XZ6 A;  2JCL A;  4NAK A;  4HOC A;  1ZCV A;  4G3S A;  2AGD A;  5C4B A;  3I0L A;  3POL A;  2VS5 A;  4KT7 A;  4KXO A;  5C49 A;  1NQI B;  1TW1 A;  2AE7 A;  1VGT A;  5CMI A;  3T7N A;  2RIX A;  3CGX A;  2AM5 A;  4B4G A;  4J18 A;  3I0G A;  3CU0 A;  1H5S A;  2PGY A;  1WVC A;  1OMX A;  1ZJP A;  3O3P A;  1H4C A;  4ARW A;  5IDS A;  1VIC A;  3U2U A;  3JTJ A;  1R7X A;  2ZU9 A;  2J0A A;  4D0Z A;  3OH1 A;  5FTS A;  2AH9 A;  4MIX A;  5FV9 A;  2WVL A;  2WVM A;  2ZU7 A;  1O0R A;  4YS8 A;  4KQL A;  3U2X A;  2ICX A;  2PA4 A;  1GA8 A;  5C3B A;  4ECM A;  1EZI A;  5AJN A;  4CJC A;  5FUH A;  3PKP A;  2RJ9 A;  2X60 A;  3ZF8 A;  1FRW A;  2OI6 A;  1LL3 A;  5J49 A;  4B3U A;  1ZHJ A;  2V0L A;  2V0J A;  3PKQ A;  4EE4 A;  1ZI3 A;  1V82 A;  2I7B A;  4FIX A;  2PX7 A;  4L41 C;  1H5S C;  1G1L A;  1G0R A;  1S4N A;  2QH5 A;  1H7Q A;  2FYB A;  2WAW A;  2XWN A;  4C2S A;  3D8V A;  1G97 A;  1HJL A;  2QGI A;  4R7P A;  3V90 A;  4Y6U A;  4Y7U A;  4IRQ A;  2JCJ A;  1LZI A;  2A8U A;  2V0I A;  1HM8 A;  3DK5 A;  2DPW A;  2RJ8 A;  2YQC A;  3V0O A;  1TVY A;  1IIN A;  4JIS A;  4D48 A;  1FO8 A;  5EIY A;  2VSI A;  4HO5 A;  5C3D A;  2YES A;  2O1F A;  2JCO A;  1LL2 A;  1G95 A;  3I0C A;  4Y7G A;  1ON6 A;  4HO6 A;  1R7T A;  1ZI1 A;  2Y4J A;  2W0V A;  4P02 A;  4Y7F A;  1GQ9 A;  5CMJ A;  1S4O A;  1VZT A;  4B4B A;  4AC3 A;  2FYD B;  3KIA A;  1FOA A;  1FO9 A;  2D7R A;  1OMZ A;  3E26 A;  3FOQ A;  1HJJ A;  3N9W A;  3ZGG A;  2A8W A;  2XME A;  1LZJ A;  3SX7 A;  1FXO A;  3T7M A;  1K4V A;  2UX8 A;  1VH3 A;  1WT0 A;  5C36 A;  1TW5 A;  2FYA A;  2Y7A A;  3RSB A;  1FXJ A;  2FY7 A;  4O6N A;  5C47 A;  1IIM A;  1FG5 N;  1NKH B;  1H7T A;  1G3L A;  5C1G A;  1G9R A;  4Y9X A;  3OAM A;  5C1H A;  3ST8 A;  4BQH A;  1H7F A;  1VZX A;  1JYK A;  3OH3 A;  4FIY A;  3D5N A;  4Y6N A;  2AM4 A;  2BO7 A;  3I0J A;  3QVB A;  2VXL A;  1FWY A;  2I5E A;  4DEC A;  1S4P A;  2D7I A;  5CQL X;  4FRQ A;  2C0N A;  4FRD A;  4BMA A;  1O7O A;  1JVD A;  3JUJ A;  1NF5 B;  4FRA A;  3SX3 A;  2J0B A;  3PNN A;  1ZCY A;  3OH2 A;  2AES A;  1WT3 A;  3U2W A;  4Y62 A;  3SPT A;  4HO8 A;  3V8Y A;  5CQO A;  4P00 A;  4AAW A;  1OQM B;  5C4C A;  3LW6 A;  3OH4 A;  2VFZ A;  1R81 A;  4NAN A;  3CKV A;  2WGZ A;  2GGQ A;  3Q7U A;  1VGU A;  1GX0 A;  2OEF A;  3D98 A;  1NWG B;  2P73 A;  4E1K A;  3OKR A;  4KC4 A;  1ZCT A;  2RJ6 A;  3SXC A;  1HM9 A;  4IRP A;  4B42 A;  2APC A;  4M4K A;  1YP2 A;  4XWI A;  1WT1 A;  4ZDQ A;  4EEA A;  1VH1 A;  1NMM B;  3V0P A;  1MP3 A;  2VXM A;  1FGG A;  1MP4 A;  2MZB A;  5CQM X;  1ZCU A;  3V8Z A;  2YQS A;  2OEG A;  4FCE A;  4NAL A;  3SXG A;  1WT2 A;  3U0X A;  1PZY B;  2YQJ A;  3SXE A;  1H7E A;  3F1C A;  5IFY A;  1G2V A;  2FFU A;  1ZJ0 A;  2Z86 A;  4EE3 A;  4CJ8 A;  4EVW A;  1MP5 A;  1H5R B;  5CMH A;  4B2X A;  2RJ1 A;  1Z90 A;  2NXV A;  2P72 A;  1H3M A;  4GBP A;  1ZJ1 A;  5CQN X;  3RMW A;  3OC9 A;  4KNR A;  3SXD A;  2V0H A;  3IOI A;  2X65 A;  4Q7C A;  5CMG X;  2RIY A;  2VS3 A;  2QKX A;  3U0Y A;  3CKJ A;  2JCK A;  1W55 A;  4KRV A;  2CU2 A;  1YP4 A;  4K6R A;  1GWW A;  1ZI5 A;  1ZI4 A;  4O6M A;  2RIT A;  1FGX A;  1VM8 A;  2ZU8 A;  5FTV A;  4Y7V A;  3RMV A;  4D11 A;  5HS2 A;  5FYE A;  3ZLL A;  1O23 B;  1GQC A;  1V84 A;  1VZU A;  4B5B A;  5EJ1 A;  1PZT A;  3USQ A;  5C4D A;  3GUE A;  1TZF A;  2O1G A;  4KC2 A;  2VS4 A;  1JVG A;  3CKQ A;  3ZLK A;  2I5K A;  1ZJ3 A;  1QGQ A;  2ICY A;  1ZJO A;  2FFV A;  1R7U A;  4Y7T A;  5AJO A;  2D0J A;  5C1L A;  3IOJ A;  5C4E A;  2WE9 A;  2VD4 A;  3USR A;  1H4E A;  5D92 A;  2OI5 A;  3HL3 A;  2OI7 A;  1H5T B;  4ASY A;  2YQH A;  4MND A;  3IOH A;  1E5K A;  2RJ5 A;  1JV3 A;  1KWS A;  1MC3 A;  4B2W A;  2O1H A;  3T7O A;  3E25 A;  2YC3 A;  2Q4J A;  1V83 A;  3SX8 A;  2P6W A;  4M2B A;  2VK9 A;  4HO4 A;  4D11 C;  4FRL A;  1EYR A;  2PGV A;  2Y4K A;  3JUK A;  1H5R A;  3ZGF A;  4EEG A;  4FRP A;  4HCQ A;  3NGW A;  4AYL A;  2GGO A;  2Z87 A;  5FU8 A;  4D0T A;  1INI A;  5D91 A;  4EEO A;  1YP3 A;  1NHE B;  2FYC B;  1JV1 A;  1ZJ2 A;  2X5S A;  3CKO A;  4Y63 A;  1H5S D;  4FCU A;  4CJB A;  3K8E A;  1ZIZ A;  2XMH A;  3FWW A;  2E8B A;  4B4M A;  1FZW A;  5I1F A;  1ON8 A;  1QGS A;  3I0F A;  1G8O A;  4AYJ A;  5FU0 A;  4G3P A;  1G93 A;  1HM0 A;  2XWL A;  4HO0 A;  5C3A A;  2RJ7 A;  5AJP A;  3TQD A;  3V0L A;  3BRK X;  1VPA A;  2WEE A;  1H7G A;  3I0D A;  3SXB A;  2XWM A;  1H7H A;  1H4D A;  3I0K A;  1QG8 A;  5CMF X;  1H5T A;  4ASJ A;  3R3I A;  5EJZ A;  1ZDF A;  2X5Z A;  1R7V A;  3DJ4 A;  2Y6P A;  3V0M A;  3K8D A;  2BO6 A;  4CVH A;  4G87 A;  1GWV A;  4KC1 A;  1H5S B;  4FRO A;  4UEG A;  2RJ4 A;  5CQP A;  3V0N A;  4FRM A;  3Q80 A;  1FR9 A;  1WSZ A;  1INJ A;  3CKN A;  1VGW A;  2E3D A;  1HV9 A;  4FRE A;  4G3Q A;  4M2A A;  1JYL A;  1R80 A;  4EEM A;  2RIZ A;  1GX4 A;  4DDZ A;  3OH0 A;  2YCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...